2JR8 | pdb_00002jr8

Solution structure of Manduca sexta moricin

• PDB DOI: https://doi.org/10.2210/pdb2JR8/pdb
• BMRB: 15323

• Classification: ANTIMICROBIAL PROTEIN
• Organism(s): Manduca sexta
• Mutation(s): No 
• Membrane Protein: Yes  OPM


• Deposited: 2007-06-21 Released: 2008-03-25 
• Deposition Author(s): Gong, Y., Dai, H., Rayaprolu, S., Huang, R., Prakash, O., Jiang, H.

---

Experimental Data Snapshot

• Method: SOLUTION NMR
• Conformers Calculated: 100 
• Conformers Submitted: 20 
• Selection Criteria: structures with the lowest energy 

Literature

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.

Dai, H., Rayaprolu, S., Gong, Y., Huang, R., Prakash, O., Jiang, H.

(2008) J Pept Sci 14: 855-863

• PubMed: 18265434 
• DOI: https://doi.org/10.1002/psc.1016
• Primary Citation Related Structures: 
  2JR8


• PubMed Abstract: 
  

  In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional 1H-1H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented.

---

Organizational Affiliation: 
• Department of Biochemistry, Kansas State University, USA.

Biological Assembly 1  

Global Symmetry: Asymmetric - C1 
Global Stoichiometry: Monomer - A1 

Biological assembly 1 assigned by authors.

Macromolecule Content 

• Total Structure Weight: 4.55 kDa 
• Atom Count: 321 
• Modeled Residue Count: 42 
• Deposited Residue Count: 42 
• Unique protein chains: 1

Macromolecules

Entity ID: 1
Molecule	Chains	Sequence Length	Organism	Details	Image
Antimicrobial peptide moricin	A	42	Manduca sexta	Mutation(s): 0  Membrane Entity: Yes
UniProt
Find proteins for Q86MA1 (Manduca sexta) Explore Q86MA1  Go to UniProtKB:  Q86MA1

Experimental Data & Validation

Experimental Data

• Method: SOLUTION NMR
• Conformers Calculated: 100 
• Conformers Submitted: 20 
• Selection Criteria: structures with the lowest energy 

Structure Validation

Entry History 

Deposition Data

• Released Date: 2008-03-25 
Deposition Author(s): Gong, Y., Dai, H., Rayaprolu, S., Huang, R., Prakash, O., Jiang, H.

Revision History  

• Version 1.0: 2008-03-25
  Type: Initial release
  
• Version 1.1: 2011-07-13
  Changes: Version format compliance
• Version 1.2: 2020-02-19
  Changes: Data collection, Database references, Derived calculations, Other
• Version 1.3: 2023-06-14
  Changes: Database references, Other
• Version 1.4: 2024-05-08
  Changes: Data collection, Database references