Chemical Component Summary

NameB-NONYLGLUCOSIDE
Identifiers(2R,3S,4S,5R,6R)-2-(hydroxymethyl)-6-nonoxy-oxane-3,4,5-triol
FormulaC15 H30 O6
Molecular Weight306.39
TypeSACCHARIDE
Isomeric SMILESCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O
InChIInChI=1S/C15H30O6/c1-2-3-4-5-6-7-8-9-20-15-14(19)13(18)12(17)11(10-16)21-15/h11-19H,2-10H2,1H3/t11-,12-,13+,14-,15-/m1/s1
InChIKeyQFAPUKLCALRPLH-UXXRCYHCSA-N

Chemical Details

Formal Charge0
Atom Count51
Chiral Atom Count5
Bond Count51
Aromatic Bond Count0

Drug Info: DrugBank

DrugBank IDDB02451 
NameB-nonylglucoside
Groupsexperimental
SynonymsB-nonylglucoside
CAS number69984-73-2

Drug Targets

NameTarget SequencePharmacological ActionActions
Cytochrome c oxidase subunit 1MAVRASEISRVYEAYPEKKATLYFLVLGFLALIVGSLFGPFQALNYGNVD...unknown
Cytochrome c oxidase subunit 2MVDEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKL...unknown
Cytochrome c oxidase polypeptide 2AMEEKPKGALAVILVLTLTILVFWLGVYAVFFARGunknown
RhodopsinMNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVL...unknown
Aquaporin-1MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNV...unknown
View More
Drug Info/Drug Targets: DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Knox C, Law V, Jewison T, Liu P, Ly S, Frolkis A, Pon A, Banco K, Mak C, Neveu V, Djoumbou Y, Eisner R, Guo AC, Wishart DS. Nucleic Acids Res. 2011 Jan; 39 (Database issue):D1035-41. | PMID:21059682