Sequence Similarity Clusters for the Entities in PDB 6PWE

Entity #1 | Chains: A,E
Histone H3 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 18 26 1019
95 % 185 250 42
90 % 191 258 43
70 % 194 261 51
50 % 203 271 79
40 % 203 271 95
30 % 203 271 95
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 5 7 5510
95 % 203 275 34
90 % 210 284 36
70 % 211 283 46
50 % 211 283 76
40 % 211 283 92
30 % 211 283 92
Entity #3 | Chains: C,G
Histone H2A protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 6002
95 % 4 6 7436
90 % 4 6 7413
70 % 182 253 54
50 % 189 260 85
40 % 189 260 100
30 % 189 260 100
Entity #4 | Chains: D,H
Histone H2B protein, length: 123 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 8080
95 % 4 6 7693
90 % 4 6 7665
70 % 189 259 53
50 % 194 266 82
40 % 194 266 99
30 % 194 266 99
Entity #5 | Chains: I
DNA (147-MER) dna, length: 147 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (147-MER) dna, length: 147 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4WNN 1 A, C, E, G Histone H2A.1 4932
2 1TZY 1 A, E Histone H2A-IV 9031
3 1KX5 5 C, G histone H2A.1 8355
4 2ARO 1 A, E Histone H2A-IV 9031
5 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
8 1S32 4 C, G histone H2A 8355
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 3UTA 3 C, G Histone H2A 8355
15 6KVD 4 C, G Histone H2A.J 9606
16 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B31 5 G Histone H2A.Z 9606
19 5B1L 3 C, G Histone H2A type 1 10090
20 6K1K 3 C, G Histone H2AX 9606
21 3UTB 3 C, G Histone H2A 8355
22 1M19 4 C, G Histone H2A.1 8355
23 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
26 3C1B 3 C, G Histone H2A type 1 8355
27 5B1M 3 C, G Histone H2A type 1 10090
28 2NQB 4 C, G Histone H2A 7227
29 5OMX 5 C, G Histone H2A 8355
30 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
31 5F99 3 C, G Histone H2A type 1 8355
32 5Z30 3 C, G Histone H2A.Z 9606
33 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 3UT9 3 C, G Histone H2A 8355
35 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
36 5B32 5 G Histone H2A.Z 9606
37 4WU8 5 C, G Histone H2A type 1 8355
38 1P3I 4 C, G Histone H2A 8355
39 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
40 1F66 4 C, G HISTONE H2A.Z 9606
41 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
42 1M18 4 C, G Histone H2A.1 8355
43 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
44 2PYO 5 C, G Histone H2A 7227
45 1P3L 4 C, G Histone H2A 8355
46 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
47 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
48 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
49 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
50 5CP6 5 C, G Histone H2A 8355
51 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
52 5BT1 2 C Histone H2A.1 4932
53 5XF6 3 C, G Histone H2A 8355
54 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
55 3MVD 3 C, G Histone H2A 8355
56 4J8U 3 C, G Histone H2A type 1 8355
57 4WU9 3 C, G Histone H2A type 1 8355
58 3REH 3 C, G Histone H2A type 1 8355
59 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
60 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
61 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 5E5A 4 C, G Histone H2A 8355
63 3REJ 3 C, G Histone H2A type 1 8355
64 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
65 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 1P3P 4 C, G Histone H2A 8355
67 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 1M1A 4 C, G Histone H2A.1 8355
69 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
70 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
71 3MNN 3 C, G Histone H2A 8355
72 1P3G 4 C, G Histone H2A 8355
73 4J8W 3 C, G Histone H2A 8355
74 1P34 4 C, G Histone H2A 8355
75 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
76 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
77 5ONG 5 C, G Histone H2A 8355
78 5ONW 5 C, G Histone H2A 8355
79 5DNM 3 C, G Histone H2A 8355
80 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
81 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
82 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
83 3X1T 4 C, G Histone H2A 10090
84 2NZD 5 C, G histone H2A 8355
85 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
86 5DNN 3 C, G Histone H2A 8355
87 5GT3 3 C, G Histone H2A type 1-D 9606
88 5GT0 3 C, G Histone H2A type 1-A 9606
89 3LJA 3 C, G Histone H2A 8355
90 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
91 3TU4 3 C, G Histone H2A 8355
92 1P3O 4 C, G Histone H2A 8355
93 1KX4 4 C, G histone H2A.1 8355
94 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
95 1P3M 4 C, G Histone H2A 8355
96 4J8V 3 C, G Histone H2A 8355
97 5B33 3 C, G Histone H2A.Z 9606
98 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
99 3LZ0 3 C, G Histone H2A residues 2-120 8355
100 1P3F 4 C, G Histone H2A 8355
101 1P3K 4 C, G Histone H2A 8355
102 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
103 1P3A 4 C, G Histone H2A 8355
104 3LZ1 3 C, G Histone H2A residues 2-120 8355
105 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 2F8N 7 K Histone H2A type 1 10090
107 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 5XM0 3 C, G Histone H2A type 1-B 10090
109 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
110 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
111 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
112 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 3REK 3 C, G Histone H2A type1 8355
114 4KGC 3 C, G Histone H2A 8355
115 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
116 5GSU 3 C, G Histone H2A type 1-A 9606
117 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
118 3REL 3 C, G Histone H2A 8355
119 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 3REI 3 C, G Histone H2A type1 8355
121 1P3B 4 C, G Histone H2A 8355
122 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 4KUD 3 C, G Histone H2A.2 4932
124 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 4J8X 3 C, G Histone H2A 8355
126 3LEL 3 C, G, M, Q Histone H2A 8355
127 3KUY 3 C, G Histone H2A 8355
128 4R8P 3 C, G Histone H2A 8355
129 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 3X1U 4 C, G Histone H2A 10090
131 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
132 3WA9 3 C, G Histone H2A.Z 9606
133 1ID3 4 C, G HISTONE H2A.1 4932
134 3C1C 3 C, G Histone H2A type 1 8355
135 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
136 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 3WAA 3 C, G Histone H2A.V 9606
138 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
139 4JJN 3 C, G Histone H2A.2 4932
140 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
143 6OM3 3 C, G, O, S Histone H2A 8355
144 5XM1 3 C, G Histone H2A type 1-B 10090
145 6K1J 3 C, G Histone H2AX 9606
146 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
147 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
148 2HIO 1 A PROTEIN (HISTONE H2A) 9031
149 4QLC 5 C, G Histone H2A 7227
150 4LD9 3 C, G Histone H2A 8355
151 3O62 3 C, G Histone H2A type 1 8355
152 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
153 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
154 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
155 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
156 2FJ7 5 C, G histone H2A 8355
157 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
158 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
159 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
160 3B6F 5 C, G Histone H2A 8355
161 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
162 3B6G 5 C, G Histone H2A 8355
163 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
164 3KXB 3 C, G Histone H2A 8355
165 5HQ2 3 G Histone H2A 8355
166 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
167 5OXV 3 C, G, M, Q Histone H2A 8355
168 1ZBB 5 C, G, c, g Histone H2A.1 8355
169 6LTJ 3 C, G Histone H2A type 1 8355
170 6VEN 3 C, G Histone H2A type 1 8355
171 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
172 6T9L 3 C, G Histone H2A 8355
173 6UPH 3 C, G Histone H2A 28985
174 6UPK 3 C Histone H2A 9606
175 6UPL 3 C, K Histone H2A 9606
176 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
177 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
178 6KW4 3 O, S Histone H2A 8355
179 6KW3 3 O, S Histone H2A 8355
180 6SEG 3 C, G Histone H2A type 2-A 9606
181 6SE0 3 C Histone H2A type 2-A 9606
182 6SE0 5 G Histone H2A type 2-A 9606
183 6SE6 3 C, G Histone H2A type 2-A 9606
184 6SEE 3 C, G Histone H2A type 2-A 9606
185 6SEF 3 C, G Histone H2A type 2-A 9606
186 6PWV 6 I, M Histone H2A type 1 8355
187 6PWW 6 I, M Histone H2A type 1 8355
188 6PWX 4 I, M Histone H2A type 1 8355
189 6PWE 3 C, G Histone H2A 7227
190 6PWF 3 C, G Histone H2A 7227
191 6KIU 3 C, G Histone H2A 8355
192 6KIV 3 C, G Histone H2A 8355
193 6KIW 3 C, G Histone H2A 8355
194 6KIX 3 C, G Histone H2A 8355
195 6KIZ 3 C, G Histone H2A 8355
196 6S01 3 C, G Histone H2A 8355
197 6K1P 3 C, G Histone H2A 8355
198 6RNY 3 C, G Histone H2A type 1 9606
199 6JYL 3 C, G Histone H2A 8355
200 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
202 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
203 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
204 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
205 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
206 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6R1U 3 C, G Histone H2A 8355
208 6R25 6 C, G Histone H2A 8355
209 6O96 3 C, G Histone H2A 8355
210 6R0C 3 C, G Histone H2A type 1 9606
211 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
212 6J99 3 C, G Histone H2A 8355
213 6NQA 4 C, G Histone H2A type 1 8355
214 6NOG 3 C, G Histone H2A type 1 8355
215 6NN6 3 C, G Histone H2A type 1 8355
216 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
217 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
218 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
219 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
220 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
221 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
222 6NJ9 2 C, G Histone H2A type 1 8355
223 6NE3 3 C, G Histone H2A type 1 8355
224 6I84 2 Q, V Histone H2A type 1 8355
225 6IRO 4 C, G Histone H2A 8355
226 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
227 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
228 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
229 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
230 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
231 6DZT 3 C, G Histone H2A 7227
232 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
233 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
235 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
236 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
237 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
238 6GEN 4 E, F Histone H2A.1 4932
239 6GEJ 4 E, F Histone H2A.1 4932
240 6G0L 3 C Histone H2A type 1 8355
241 6G0L 5 G Histone H2A type 1 8355
242 6FTX 3 C, G Histone H2A type 1 8355
243 6FML 11 O, S Histone H2A type 1 9606
244 5Z3L 3 C, G Histone H2A 8355
245 5Z3O 3 C, G Histone H2A 8355
246 5Z3T 4 C, G Histone H2A 8355
247 5Z3U 4 C, G Histone H2A 8355
248 5Z3V 4 C, G Histone H2A 8355
249 6C0W 3 C, G Histone H2A 9606
250 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
251 6ESF 3 C, G Histone H2A 8355
252 6ESG 3 C, G Histone H2A 8355
253 6ESH 3 C, G Histone H2A 8355
254 6ESI 3 C, G Histone H2A 8355
255 5O9G 3 C, G Histone H2A 8355
256 5X0X 3 C, G Histone H2A 8355
257 5X0Y 3 C, G Histone H2A 8355
258 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
259 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
260 3C9K 1 A, E Histone H2A-IV 9031