Sequence Similarity Clusters for the Entities in PDB 4PTU

Entity #1 | Chains: A
Antibody pn132p2C05, light chain protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 45986
95 % 1 2 32206 Flexibility: No
Max RMSD: 0.2, Avg RMSD: 0.2
PDBFlex
90 % 14 797 2
70 % 48 2418 2
50 % 59 3071 2
40 % 59 3071 2
30 % 127 6236 1
Entity #2 | Chains: B
Antibody pn132p2C05, heavy chain protein, length: 235 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 49437
95 % 1 2 32205 Flexibility: No
Max RMSD: 0.3, Avg RMSD: 0.3
PDBFlex
90 % 1 2 30906
70 % 59 2969 1
50 % 66 3121 1
40 % 66 3121 1
30 % 128 6236 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 6MEE 2 B, D antibody HEPC74 Light Chain 9606
4 6BJZ 2 L 5c8 Fab Light chain 9606
5 6O3D 1 L PGZL1 FAB LIGHT CHAIN 9606
6 4XCF 1 L 4E10 Fab light chain 9606
7 5X08 2 L Fab 4E10 Light chain 9606
8 6O3K 1 L PGZL1.H4K3 light chain 9606
9 4XAW 1 L 4E10 Fab light chain 9606
10 5UCB 2 L Fab Light Chain 9606
11 2VXV 2 L HUMAN IGG ABT-325 9606
12 5I8C 2 B VRC34.01 Fab light chain 9606
13 5WK2 1 L M116 LIGHT CHAIN 9606
14 4PTU 1 A Antibody pn132p2C05, light chain 9606
15 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
16 4XC3 1 L 4E10 Fab light chain 9606
17 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
18 5VSI 2 L CH1/Ckappa Fab light chain 9606
19 6QCU 1 L Light chain 9606
20 6PZG 1 L NA-80 Fab light chain 9606
21 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
22 4NWU 2 L APE1551 Ab Fab light chain 9606
23 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
24 6SVL 2 B, E, I, L, M, P Fab_light_chain 9606
25 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
26 6CA7 1 L PCT64_13C light chain 9606
27 6MVL 3 L Antibody Fab fragment light chain 9606
28 5OB5 3 L fAb Light chain 9606
29 3QQ9 1 C, L 101F LIGHT CHAIN 10090
30 5I1K 1 L FAB LIGHT CHAIN 9606
31 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
32 5UEA 3 B, L Fab Light Chain 9606
33 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
34 3QRG 1 L Fab light chain 9606
35 3NCJ 1 L Fab15 Mut8 light chain 9606
36 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
37 4NWT 1 L APE1531 Ab Fab light chain 9606
38 3NA9 1 L Fab15 light chain 9606
39 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
40 5U6A 1 A Light Chain 9606
41 6K0Y 2 B Antibody Light Chain 9606
42 4HHA 1 A Fab KE5 Fab fragment KE5 9606
43 5UEK 3 L Fab 12E Light Chain 9606
44 3NAA 1 L Fab15 Mut5 light chain 9606
45 5IK3 2 B, D 1E03 Fab fragment light chain 9606
46 6DC4 2 L Fab AM22 Light Chain 9606
47 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
48 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
49 5IT2 2 L light chain 9606
50 6MY4 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
51 6DW2 1 A 6078 Fab light chain 9606
52 6BQB 1 L MGG4 Fab light chain 9606
53 4PUB 2 L DX-2930 LIGHT CHAIN 9606
54 6B14 2 L Light chain of Fab BL3-6S97N 10090
55 5VKD 3 L Fab light chain 9606
56 5XHG 1 A, C polypeptide(L) 10090
57 3OAZ 2 K, L Fab 2G12, light chain 9606
58 6OTC 3 L sFab H3 light chain 32630
59 6MY5 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
60 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
61 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
62 3EO0 1 A, C GC-1008 Fab Light Chain 10090
63 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
64 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
65 4JHA 2 L D25 light chain 9606
66 6B9Z 1 A Trastuzumab Fab light chain 10090
67 4PTT 1 A Antibody pn132p2C05, light chain 9606
68 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
69 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
70 4DGV 2 L HCV1 Light Chain 9606
71 6U8D 3 L Light chain of Fab HCV2 Light chain of Fab HCV2 9606
72 6PE7 2 L FAB Light chain 9606
73 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
74 6IAS 2 L Fab NKp46-1 light chain 32630
75 6OBZ 2 B, L Light chain of FluA-20 Fab, Immunoglobulin light chain 9606
76 6GFE 2 L, M Immunoglobulin gamma-4 light chain 9606
77 3P0Y 3 L Fab DL11 light chain 9606
78 6ANA 3 L LL2 Fab Light Chain 10090
79 5IBU 1 B, L 6652 Light Chain 9606
80 6AOD 1 A FXIa Antibody FAB Light Chain 9606
81 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
82 6ELE 2 B, L fAB light chain 9606
83 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
84 3NAC 1 L Fab15 Mut7 light chain 9606
85 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
86 4DGY 2 L HCV1 Light Chain 9606
87 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
88 3EO9 1 L Efalizumab Fab fragment, light chain 9606
89 6N35 1 K, L Fab 2G12 light chain 9606
90 5WUV 1 L light chain 9606
91 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
92 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
93 6BAH 1 A Trastuzumab Fab light chain,Immunoglobulin kappa constant 10090
94 6D0X 2 B 1210 Antibody, light chain 9606
95 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
96 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
97 5TL5 1 L M2177 LIGHT CHAIN 10090
98 2FX7 1 L Fab 4E10 Light Chain 9606
99 6O39 1 A Antibody F2.I Fab, Light chain 9606
100 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
101 6QKD 2 L, M, O, T FAB LIGHT CHAIN 9844
102 5XKU 2 B HNIgGA6 light chain 9606
103 6MTT 1 L Antibody VRC46.01 Fb light chain 9606
104 5I18 1 L FAB LIGHT CHAIN 9606
105 6HKG 2 B FISW84 Fab Fragment Light Chain 9606
106 3SOB 1 L antibody light chain 9606
107 6B5M 2 L CIS43 Fab Light chain 9606
108 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
109 5DR5 2 L AbD09097 Fab light chain 9606
110 4KQ3 1 L CNTO3186 light chain Fab 9606
111 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
112 4I77 2 L Lebrikizumab light chain Fab 9606
113 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
114 4HJG 1 A Trastuzumab light chain 9606
115 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
116 3FN0 1 L Fab Z13e1 light chain 9606
117 5NYX 2 L, N, P LIGHT CHAIN fab light chain 9606
118 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
119 6ELJ 2 B, L fAB light chain 9606
120 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
121 4MAU 1 L C2244 light chain SEE REMARK 999 10090
122 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
123 6CBV 2 L Light Chain, Fab fragment 9606
124 5JW5 2 B, L MEDI8852 Light chain 9606
125 6DCV 1 A, L Light chain of CBTAU27.1 Fab 9606
126 3QWO 1 B, L motavizumab light chain 10090
127 4IOI 1 A Trastuzumab light chain 9606
128 6GHG 2 B, L Fab light chain 9606
129 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
130 5VAG 2 B Light chain of antibody m826 9606
131 5I16 1 A, L FAB LIGHT CHAIN 9606
132 6O3L 1 B, L PGZL1.H4K3 light chain 9606
133 4RBP 1 K, L Fab 2G12 light chain 9606
134 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
135 6DCW 1 L Light chain of CBTAU27.1 Fab 9606
136 5GGQ 1 L nivolumab light chain 9606
137 6B5N 2 L CIS43 Fab Light chain 9606
138 3OAY 1 K, L Fab 2G12, light chain 9606
139 6AND 3 L Pinatuzumab Fab light chain 9606
140 5K9J 2 L 56.a.09 light chain 9606
141 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
142 5TF1 2 L O2-CC Fab Light Chain 9606
143 3TCL 2 B, L CH04 Light Chain Fab 9606
144 5F7E 2 L Fab light chain 9606
145 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
146 5FHA 2 L Antibody 114 Fab light chain 9606
147 5UMN 3 D, F Antibody C05, light chain 9606
148 4X7S 2 L Ig kappa chain C region residues 23-236 9606
149 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
150 5E8E 1 A IGA FAB LIGHT CHAIN 9606
151 3QPQ 1 C, E, I, L C1068 light chain 10090
152 6PHB 2 A, C 2530 Antibody Fab, Light Chain 9606
153 6MXR 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
154 6ELL 2 B, L fAB light chain 9606
155 2HFF 1 A, L CB2 Fab, light chain 9606
156 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
157 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
158 6MXS 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
159 5GGS 2 B, D light chain 9606
160 5I1L 1 A, L FAB LIGHT CHAIN 9606
161 5GGV 1 L light chain 9606
162 3L5X 1 L H2L6 LIGHT CHAIN 9606
163 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
164 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
165 2R8S 2 L Fab light chain 10090
166 4HKZ 1 A Trastuzumab light chain 9606
167 6DB8 3 L Fab-Light chain 32630
168 6DDR 1 A Anti-MICA Fab fragment light chain clone 13A9 10090
169 6MEH 3 L antibody HEPC74 Light Chain 9606
170 3SO3 2 B A11 FAB light chain 9606
171 3OAU 2 L Fab 2G12, light chain 9606
172 5WEQ 1 A MR78 mutant light chain 9606
173 6DKJ 2 B, L Fab light chain 9606
174 4WY7 2 L Fab 4E10Light chain 9606
175 4ZYK 2 B, L AM14 light chain 9606
176 6DWA 1 A, L 4497 Fab Light Chain 9606
177 6E56 3 I, J antibody H2214 light chain, K1642 9606
178 5E94 1 A, C Antibody Fab fragment light chain 10090
179 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
180 4HIE 1 A Fab 023.102 9606
181 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
182 6MED 2 B, D, I antibody HEPC3 Light Chain 9606
183 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
184 6ME1 2 B, D VRC34.01 Fab light chain 9606
185 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
186 5Y11 2 B MAb 4-5 light chain 9606
187 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
188 4KMT 1 L light chain O12/KAPPA Fab 9606
189 1RHH 1 A, C Fab X5, light chain 9606
190 6U3Z 2 B, D V20_5A4 Light Chain Fab 9544
191 6CW3 2 B, D antibody light chain 9606
192 6BTJ 2 B, L Light chain of H7.5 Fab 9606
193 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
194 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
195 4XTR 3 D, F Antibody Light chain 32630
196 1RZ7 1 L Fab 48d light chain 9606
197 1RZG 2 B, D Fab 412d heavy chain 9606
198 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
199 3PGF 3 L SAB Light Chain 9606
200 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
201 6DFJ 2 L anti-Zika antibody Z021, Light Chain 9606
202 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
203 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
204 6B9Y 1 A Trastuzumab Fab light chain 9606
205 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
206 2QQN 3 L Antibody light chain 9606
207 6MSY 1 L Fab 2G12, light chain 9606
208 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
209 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
210 6BAE 1 A Trastuzumab Fab light chain 10090
211 6MTP 1 B, L Antibody VRC42.04 Fab light chain 9606
212 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
213 3X3F 2 L Light chain of KMTR2 9606
214 2CMR 3 L D5 9606
215 5ZV3 3 L Light chain (kappa) of antibody CBTAU28.1 9606
216 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
217 5CZX 3 D, L 20358 Fab light chain 9606
218 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
219 3GRW 2 L Fab light chain 9606
220 6B3K 2 L Light chain of Fab BL3-6 10090
221 5I1D 1 A, L FAB LIGHT CHAIN 9606
222 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
223 6AYZ 2 C, D Fab Light Chain 9606
224 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
225 6O3A 1 A Antibody F7.B Fab, Light chain 9606
226 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
227 4LKC 1 A Fab fragment of PCSK9 antibody 9606
228 4KZD 2 L BL3-6 Fab antibody, light chain 10090
229 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
230 4HIH 1 A, C Fab 023.102 9606
231 6O1F 4 L Light Chain hu31A.v11 9606
232 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
233 5IES 2 L VRC01cHuGL2 Fab light chain 9606
234 6OCB 2 L Light chain of FluA-20 Fab 9606
235 6RCS 2 B R5.016 light chain 9606
236 3S34 1 L 1121B Fab light chain 10090
237 6B6Z 1 A, C Apo Fab Light Chain 9606
238 6NMS 1 A, L Fab 136 anti-SIRP-alpha antibody Variable Light Chain 9606
239 6EMJ 2 B, L fAb light chain 9606
240 5W1G 2 L CR1-07 Fab light chain 9606
241 6CNR 1 L Aducanumab light chain 9606
242 6PLK 2 L, M ZIKV-116 light chain 9606
243 6OKM 2 L Fab 3C8 light chain 9606
244 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
245 4NRX 3 B, E, L m66 Light Chain 9606
246 3O2D 1 L ibalizumab light chain 10090
247 6DB9 3 L Fab-Light-Chain 32630
248 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
249 5O14 3 D, L Fab 1A12 Light Chain 9606
250 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
251 5V7R 1 L CBTAU-7.1 Fab light chain 9606
252 6B5O 2 L CIS43 Fab Light chain 9606
253 2R0L 1 L antibody light chain 32630
254 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
255 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
256 6N7U 2 B BDBV223 antibody light chain Fab 9606
257 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
258 6N32 1 L, M Fab 2G12 light chain 9606
259 3Q1S 1 L Z13e1 Fab light chain 9606
260 6TYB 4 L NEUTRALIZING ANTIBODY ITS90.03 FAB LIGHT CHAIN 9544
261 6DWC 1 A, L 4497 Fab Light Chain 9606
262 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
263 5VZ1 1 A, C Apo Antibody Fab Light Chain 9606
264 5OD8 2 B B2 Fab fragment - Light chain 9606
265 3KR3 3 L antibody-Fab (light chain) 9606
266 5DK3 1 A, F Light Chain 9606
267 6DZN 1 L Antibody ADI-15878, light chain 9606
268 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
269 5GGU 2 B, L light chain 9606
270 5KW9 3 L IgA Light chain 9606
271 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
272 5W2B 2 L Fab Light Chain 9606
273 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
274 6E4X 2 Y S5V2-29 light chain 9606
275 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
276 2FX9 1 L, M Fab 4E10 Light Chain 9606
277 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
278 6AXL 1 B, C Fab317 light chains 9606
279 1TZG 1 L, M Fab 4E10 light chain 9606
280 6HIG 2 L Light Chain 10090
281 3W9D 2 B, D Antibody Fab light chain 9606
282 6CXG 1 K, L anti-HIV-1 Fab 2G12 light chain 9606
283 6CO3 1 L Fab light chain 9606
284 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
285 6O41 1 A, C, L germline PGZL1_gVmDmJ light chain 9606
286 3BN9 2 C, E E2 Fab Light Chain 9606
287 6EYN 1 A, C, L 8D6 Fab light chain 8D6 Fab light chain 9606
288 4HWE 2 L Fab light chain light chain 9606
289 6DZR 2 L h38c2 light chain 9606
290 6DF0 1 L 4G10-4D5 Antibody Light chain 32630
291 6U9U 2 L GM9_TH8seq732127 FAB light chain 9606
292 6DF1 1 L Anti-phosphotyrosine antibody 4G10-4D5 heavy chain 9606
293 5TZ2 2 L C47B222 Fab Light Chain 9606
294 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
295 4OGX 3 L DX-2930 LIGHT CHAIN 9606
296 3W9E 3 B Antibody Fab light chain 9606
297 5TFS 2 L 02-K Fab Light chain 9606
298 4KZE 2 L BL3-6 Fab antibody, light chain 10090
299 5WT9 2 L Light Chain of Nivolumab 9606
300 4HIJ 1 A, C Fab 023.102 light chain 9606
301 6MU3 1 K, L Fab 2G12, light chain 9606
302 4XVU 3 D, F, J, L Antibody light chain 32630
303 5B71 1 A, C SKY59 Fab light chain 9606
304 6BF4 3 C, L VRC-PG05 Fab light chain 9606
305 6FG1 2 D LIGHT CHAIN OF FAB NAA32 9606
306 3EYF 1 A, C 8f9 Fab 9606
307 3NAB 1 L Fab15 Mut6 light chain 9606
308 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
309 5I1C 1 L FAB LIGHT CHAIN 9606
310 5WNA 2 D, L mAb 3D3 Fab light chain 9606
311 1RZ8 1 A, C Fab 17b light chain 9606
312 4WV1 3 A, D Fab light chain 9606
313 5EII 2 B, L Fab Light Chain 9606
314 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
315 4FNL 2 L, M Antibody C05, Light Chain 9606
316 4UB0 2 L IgG1, light chain 9606
317 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
318 1BJ1 1 J, L Fab fragment, light chain HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
319 5I1H 1 L FAB LIGHT CHAIN 9606
320 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
321 6BFT 1 B, L Avastin Light Chain Fab fragment mutant 9606
322 6DFI 2 L anti-Zika antibody Z021, Light Chain 9606
323 5I1J 1 L FAB LIGHT CHAIN 9606
324 3IDX 3 L Fab b13 light chain 9606
325 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
326 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
327 4K94 1 L Fab19 heavy chain 9606
328 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
329 6B5L 2 L CIS43 Fab Light Chain 9606
330 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
331 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
332 5XAJ 2 B, L FabHM14c10 light chain 9606
333 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
334 5VEB 2 B, L anti-CDH6 Fab light chain 9606
335 6N81 2 D, L A1227 Fab light chain 9606
336 3X3G 2 L Light chain of KMTR2 9606
337 5E08 2 L Fab Light Chain 9606
338 6AZ2 3 E, F Fab Light Chain 9606
339 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
340 5IBT 2 L UCA Light Chain 9606
341 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
342 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
343 6DF2 1 A, L Anti-phosphotyrosine antibody c310-4D5 heavy chain 32630
344 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
345 5XRQ 2 B, L Fab H3v-47 light chain 9606
346 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
347 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
348 4NGH 1 L FAB LIGHT CHAIN 9606
349 4EDW 2 L tanezumab Fab light chain 9606
350 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
351 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
352 4NM4 1 L, M Antibody CR8043, Light Chain 9606
353 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
354 4G7V 2 L fragment antibody light chain 9606
355 4HFW 1 A, L 6-26 Fab Light chain 9606
356 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
357 6NMU 1 A, L Fab 115 anti-SIRP-alpha antibody Variable Light Chain 9606
358 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
359 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
360 5JO4 2 B D80 Fab Light Chain 9606
361 5JO4 4 D G6 Fab Light Chain 9606
362 3INU 2 L, N KZ52 antibody fragment light chain 9606
363 5EU7 3 C, D FAB light chain 9606
364 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
365 5X8M 3 C durvalumab light chain 9606
366 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
367 4HII 1 A, C Fab 023.102 light chain 9606
368 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
369 4DN3 1 L CNTO888 LIGHT CHAIN 9606
370 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
371 5WNB 2 L, M mAb 3D3 Fab light chain 9606
372 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
373 3EYV 1 A, L hu3S193 Fab, light chain 10090
374 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
375 6Q20 2 L 1E01 Fab kappa light chain 9606
376 5IJK 3 C, D 1E03 Fab fragment light chain 9606
377 3BDY 2 L Fab Fragment -Light Chain 9606
378 5I8E 2 B, D VRC34.01 Fab light chain 9606
379 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
380 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
381 5UIX 2 L DH576 Fab light chain 9606
382 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
383 6MFT 2 B, L Light chain glVRC01 9606
384 4HWB 3 L Fab light chain 9606
385 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
386 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
387 2HFG 1 L CB3s Fab light chain (kappa) 9606
388 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
389 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
390 5ZIA 2 B, E, I, L, M, P Light chain (kappa) of CBTAU-24.1 antibody 9606
391 4JQI 3 L Fab30 light chain 10090
392 6B0H 3 A, C 1262 antibody, light chain 9606
393 6U8C 2 C, L Antibody light chain Fab 9606
394 3SKJ 1 L, M Antibody, light chain 9606
395 3U30 2 B, E Light chain Fab 9606
396 6B0A 2 L 1269 antibody, light chain 9606
397 6MFJ 2 B, L DH677.3 Fab light chain 9606
398 5HYS 2 B, D, F, L Uncharacterized protein 9606
399 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
400 5I15 1 L FAB LIGHT CHAIN 9606
401 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
402 6U8K 3 E, G, L Light chain of Fab HCV3 Light chain of Fab HCV3 9606
403 5I1E 1 L FAB LIGHT CHAIN 9606
404 2NYY 2 C CR1 monoclonal antibody light chain 9606
405 2GCY 1 A huC25 fab fragment light chain 10090
406 4JLR 2 B, L Motavizumab Fab light chain 9606
407 2QQK 3 L Antibody Light Chain 9606
408 4J1U 1 A, C, E antibody 93F3 Light chain 10090
409 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
410 5SX5 1 K, L Panitumumab Fab Light Chain 9606
411 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
412 6JC2 2 L ipilimumab fab light chain 9606
413 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
414 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
415 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
416 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
417 5BK2 3 D, L sAB Light Chain 9606
418 1TZH 2 A, L Fab YADS1 Light Chain 10090
419 5O1R 3 L, M Uncharacterized protein 9606
420 6CMI 2 C m102.3 light chain 9606
421 4JZJ 3 B, L Fab Light Chain 10090
422 5BO1 3 L, M Fab light chain 9606
423 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
424 4M6O 1 L CNTO7309 light chain 9606
425 5LSP 3 L, T 107_A07 Fab light chain 9606
426 6MWN 3 D, L Fab HAVx Light Chain 9606
427 4DVR 2 L Fab 48d Light chain 9606
428 3EYQ 1 C M2J5 Fab 9606
429 6PI7 2 B, E Uncharacterized protein 9606
430 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
431 6HXW 3 D, L IPH53 light chain 32630
432 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
433 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
434 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
435 6BGT 2 A Herceptin light chain mutant 9606
436 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
437 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
438 6MTQ 1 L Antibody VRC42.N1 Fab light chain 9606
439 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
440 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
441 3DVG 1 A Human IgG1 fab fragment light chain 9606
442 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
443 2AGJ 1 L Yvo Fab, Light Chain 9606
444 3EYO 1 A, C 8f9 Fab 9606
445 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
446 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
447 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
448 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
449 4DN4 1 L CNTO888 LIGHT CHAIN 9606
450 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
451 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
452 6MHR 2 B, E Urelumab Fab kappa chain 9606
453 2FJG 2 A, L Fab light chain 9606
454 4DKF 3 L, M FAb2 Light Chain 9606
455 5TLK 1 A, E M2177 LIGHT CHAIN 10090
456 5TLK 3 C, G H2191 LIGHT CHAIN 10090
457 6OGX 2 D Fab1 Light Chain 9606
458 6OGX 5 L Fab2 light chain 9606
459 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
460 6MEJ 5 L antibody HEPC3 Light Chain 9606
461 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
462 3EFD 1 L FabL 10090
463 4LF3 1 A, D Fab heavy chain 10090
464 6MTO 1 L Antibody VRC42.01 Fab light chain 9606
465 6IAP 2 D Fab NKp46-4 light chain 32630
466 6IAP 5 L Fab NKp46-1 light chain 32630
467 5K59 4 F, L Fab light chain 9606
468 6MUB 1 K, L Fab 2G12, light chain 9606
469 6BFQ 2 B, D, F, L Fab Light Chain 9606
470 5WI9 2 E, L 39F7 Fab light chain 9606
471 6PZF 2 E, L NA-63 Fab light chain 9606
472 6BKC 2 L Fab AR3B light chain 9606
473 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
474 6O3B 1 A, E Antibody Fab F6, Light chain 9606
475 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
476 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
477 4LEO 2 B RG7116 Fab light chain 10090
478 4G7Y 2 L Fragment antibody light chain 9606
479 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
480 4PY8 4 J antibody 3.1 light chain Fab 9606
481 3SDY 4 L Antibody CR8020, Light Chain 9606
482 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
483 3IXT 1 B, L Motavizumab Fab light chain 10090
484 4NP4 3 L, M bezlotoxumab light chain 9606
485 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
486 4XCE 1 B, D, L 4E10 Fab light chain 9606
487 1BBJ 1 A, L IGG4-KAPPA B72.3 FAB (LIGHT CHAIN) 10090
488 6U85 2 L antibody Fab Light chain 9606
489 5I1I 1 L FAB LIGHT CHAIN 9606
490 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
491 4ERS 1 L Fab light chain 9606
492 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
493 4MWF 2 B, L Fab AR3C light chain 9606
494 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
495 3SQO 3 L J16 Light chain 9606
496 4K3J 4 L Onartuzumab Fab light chain 10090
497 6PE8 2 B, L FAB Light chain 9606
498 6N8D 2 B, E A1431 Fab light chain 9606
499 6CYF 2 C, E, L, T IgG1 antibody, kappa light chain 9606
500 4PS4 1 L M1295 LIGHT CHAIN 9606
501 5GGT 3 L IGK@ protein 9606
502 6OL5 4 L iglb12 Light Chain 9606
503 6MNF 1 K, L Fab 2G12, light chain 9606
504 3HI1 2 A, L F105 Light Chain 9606
505 4PY7 2 B, J antibody 3.1 light chain Fab 9606
506 6AL5 2 L B43 LIGHT CHAIN 9606
507 4K8R 3 C Fab1, light chain 9606
508 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
509 6CMG 2 B m102.3 light chain 9606
510 6HHC 1 L FXIA ANTIBODY FAB LIGHT CHAIN 9606
511 6U38 3 L Fab Light Chain 9606
512 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
513 6ML8 4 L C05 antibody Fab light chain 9606
514 1TZI 1 A Fab YADS2 Light Chain 10090
515 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
516 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
517 6PPG 2 A, L Fab MCAF5352A light chain 9606
518 4X7T 2 B, L Omalizumab-Fab Light chain 9606
519 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
520 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
521 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
522 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
523 5XMH 2 C, L YES8c light chain 9606
524 6O3U 1 A, C, E, L PGZL1.H4K3 light chain 9606
525 6MEI 3 L antibody HEPC3 Light Chain 9606
526 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
527 5I1G 1 L FAB LIGHT CHAIN 9606
528 2QQL 3 L Antibody Light Chain 9606
529 4XCC 1 L 4E10 Fab light chain 9606
530 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
531 5SX4 1 I, L Panitumumab Fab Light Chain 9606
532 3WD5 2 L Adalimumab Light Chain 9606
533 5Y2L 4 J a group 2 HA binding antibody AF4H1K1 Fab light chain 9606
534 4NHC 1 L FAB LIGHT CHAIN 9606
535 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
536 6U36 3 L Fab Light Chain 9606
537 5GZO 3 D, L Antibody light chain 9606
538 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
539 5GMQ 3 C MCA1 light chain 9606
540 6CA9 1 A, C PCT64_LMCA Fab light chain 9606
541 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
542 5TRU 1 L, l Ipilimumab Fab light chain 9606
543 4FP8 3 L, M, N, O Antibody C05, light chain 9606
544 6BKB 3 L Fab AR3A light chain 9606
545 6O42 1 A, L PGZL1_gVmDmJ light chain 9606
546 6R2S 1 A Antibody DB9 light chain 9606
547 6I8S 3 I, J, K, L LIGHT CHAIN OF FAB FRAGMENT FROM AN PAI-1 ANTIBODY FAB FRAGMENT 9606
548 4YPG 1 A, L Sifalimumab light chain 9606
549 6NMR 1 B, G, K, L Fab 119 anti-SIRP-alpha antibody Variable Light Chain 9606
550 6CW2 4 B antibody light chain 9606
551 3BE1 3 L Fab Fragment-Light Chain 9606
552 2FJH 2 A, L Fab fragment light chain 9606
553 5XEZ 3 D, L Antibody, mAb1, light chain 9606
554 4K9E 1 L light chain 10090
555 6MEF 2 L antibody AR3C Light Chain 9606
556 3P0V 1 L, M Fab DL11 light chain 9606
557 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
558 6OEL 5 L engineered Fab light chain 9606
559 5VIG 2 B, L Fab light chain 9606
560 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
561 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
562 6I04 3 D, L Fab light chain 9606
563 4KVN 3 L Human IgG Light Chain 9606
564 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
565 5VYF 1 A, L Antibody light chain 10090
566 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
567 4K7P 4 L antibody 10C4 Fab fragment light chain 10090
568 5WUX 2 B, D, L light 9606
569 3OB0 1 K, L Fab 2G12, light chain Fab 9606
570 6MFP 4 D, L DH677.3 Fab light chain 9606
571 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
572 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
573 6GK7 1 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-27.1(S31Y,T100I) FAB ANTIBODY FRAGMENT 9606
574 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
575 5DUM 2 L 65C6 Light Chain 9606
576 4I18 1 B, L antibody light chain Fab 10090
577 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
578 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
579 3IDY 3 C, L Fab b13 light chain 9606
580 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
581 3IVK 1 B, L Fab light chain man 10090
582 3KYK 2 L Light Chain Li33 IgG1 9606
583 5TGB 2 B, L 02-CB Fab Light Chain 9606
584 5I19 1 L FAB LIGHT CHAIN 9606
585 5TH9 1 L, M, N GS-5745 Fab light chain 9986
586 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
587 6OKN 2 B, D Fab 1A7 light chain 9606
588 6OC3 2 B, D Light chain of FluA-20 Fab 9606
589 6NZ7 4 I, L 429 B01 FAB light chain 9606
590 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
591 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
592 6GK8 2 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-28.1(S32R;E35K) FAB ANTIBODY FRAGMENT 9606
593 5FEC 2 B, L germline 3BNC60 light chain 9606
594 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
595 2R56 2 L, M IgE Fab Fragment, light chain 9606
596 1ZA6 1 A, C, E, G IGG Light chain 9606
597 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
598 4ZS6 1 D, L fab Light Chain 9606
599 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
600 6APB 3 L ADI-14359 Fab Light Chain 9606
601 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
602 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
603 5K9K 2 B, L 56.a.09 Light chain 9606
604 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
605 5W4L 6 C, E Antibody N12-i3 light chain 9606
606 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
607 6D01 2 B, D, F, H 1210 Antibody, Light chain 9606
608 6Q23 3 F, I, K, L 1G01 Fab kappa light chain 9606
609 5CZV 3 L Fab 20350 light chain 9606
610 5XF1 3 D, L Antibody mAb1 Light chain 9606
611 4P59 3 L MOR09825 Fab fragment light chain 9606
612 5XXY 2 L light chain of atezolizumab fab 9606
613 5CJO 3 L FAB light chain 10090
614 4LMQ 3 I, L Stromal cell-derived factor 1 9606
615 3N85 2 L Fab37 Light Chain 9606
616 3G6J 3 E, G Fab light chain 9606
617 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
618 6MH2 1 A, C Herceptin Fab arm light chain 9606
619 6K7O 3 C, E, G, L h128-3 Fab light chain 9606
620 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
621 6B9J 3 B, L Fab vv138 Light chain 9606
622 5O4G 2 A MF3958 FAB light chain 9606
623 6PE9 2 B, D, F, L, M FAB Light chain 9606
624 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
625 4DKE 3 L, M FAb1.1 Light Chain 9606
626 5I17 1 A, L FAB LIGHT CHAIN 9606
627 5VIC 2 L Fab light chain 9606
628 6MEK 3 D, L HEPC3 Light Chain 9606
629 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
630 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
631 4R8W 4 L Light chain of neutralizing antibody CT149 9606
632 5TPN 3 L hRSV0 light chain 9606
633 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
634 6Q1Z 2 C, L 1G04 Fab kappa light chain 9606
635 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
636 4NRY 1 B, L m66 Heavy Chain 9606
637 6OE4 2 C, F CR9501 Fab Light Chain 9606
638 6N2X 1 K, L Fab 2G12 light chain 9606
639 3S37 1 L 1121B Fab light chain 10090
640 5XHF 1 A, C polypeptide (L chain) 10090
641 5VL7 4 L Fab33 light chain 9606
642 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
643 6P8N 3 D, L P-p1f1 Light Chain 10090
644 5JXE 2 C, F Pembrolizumab Fab light chain 9606
645 5W42 4 L Fab H3v-47 light chain 9606
646 4JM2 3 C 17b Light chain Fab 9606
647 6DEZ 1 A, L Anti-phosphotyrosine antibody PY20-4D5 light chain 32630
648 1S78 2 C, E Pertuzumab Fab light chain 10090
649 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
650 5D1Z 1 A, H Y10 Light Chain 9606
651 5D1Z 3 C, E D4-10 Light Chain 9606
652 5GGR 2 B, L light chain 9606
653 5IBL 4 D, L 6639 Light Chain 9606
654 4XHJ 3 C, G Fab-RC light chain 9606
655 5O4O 1 A MF3178 FAB light chain 9606
656 6O3J 1 B, L PGZL1 light chain 9606
657 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
658 4N90 3 E, G, I Fab light chain 9606
659 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
660 5D1Q 1 A D2-06 Light Chain 9606
661 5D1Q 4 D P5 Light Chain 9606
662 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
663 6DC5 3 C, F, I Fab AM22 light chain 9606
664 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
665 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
666 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
667 5XHV 3 L, Q S40 light chain 9606
668 5UWE 2 L HUMAN ANTI-HIV ANTIBODY N12-I2 Fab LIGHT CHAIN 9606
669 4IOF 3 D, F Fab-bound IDE, light chain 10090
670 5FUO 3 L FAB LIGHT CHAIN 9606
671 4JHW 2 L D25 light chain 9606
672 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
673 6CXL 1 K, L anti-HIV-1 Fab 2G12 light chain 9606
674 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
675 4M1C 3 D, F Fab-bound IDE, light chain 9606
676 5UQY 3 C, G, K, O MR78 Fab light chain 9606
677 6D0U 3 D, F, I, L Antibody C05, light chain 9606
678 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
679 3ULV 2 L Fab15 light chain 9606
680 3ULV 6 E Fab1068 light chain 9606
681 5UG0 3 C 2897 light chain 9606
682 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
683 6OUS 4 N, P, R, T, V, X RB1 Fab Light chain 9606
684 6P8M 3 L P-p3b3 Light Chain 10090
685 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
686 6P91 3 L Fab 18.5C Antibody light chain 9606
687 6N7J 2 B, L BDBV223 antibody light chain Fab 9606
688 5UOE 3 L, N, Q, T, W FAB light chain 9606
689 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
690 5D1X 4 D P5 Light Chain 9606
691 5JW3 4 L MEDI8852 light chain 9606
692 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
693 5UMI 2 B, L PA50 Fab Light chain 9606
694 6BKD 3 L Fab AR3D light chain 9606
695 6D11 2 B, D 1450 Antibody, Light chain 9606
696 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
697 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
698 3S36 1 L 1121B light chain 10090
699 5CWS 1 A, G sAB-158 Fab Light Chain 9606
700 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
701 2R0K 2 L antibody light chain of Fab58 9606
702 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
703 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
704 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
705 4G80 3 B, D, F, H fragment antibody light chain 9606
706 3JWO 3 L FAB 48D LIGHT CHAIN 9606
707 5CD5 3 D DRVIA7 Fab Light Chain 9606
708 5Y2M 4 J, L a group 2 HA binding antibody AF4H1K1 Fab light chain 9606
709 3P11 2 L Fab DL11 light chain 9606
710 6EYO 3 L, M 8D6 Fab light chain 8D6 Fab light chain 9606
711 3F12 1 A, C M2J1 Fab 9606
712 3B2V 1 L IMC-11F8 FAB Light chain 9606
713 5IGX 3 L germline NIH45-46 light chain 9606
714 3ULU 2 L Fab15 light chain 9606
715 3ULU 6 E Fab1068 light chain 9606
716 6O3G 1 B, D, F, L PGZL1 light chain 9606
717 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
718 5W1K 1 A, F, K, S CR1-28 Fab light chain 9606
719 5W1K 3 C, H, M, N CR1-10 Fab light chain 9606
720 4XI5 3 C Fab-94 light chain 9606
721 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
722 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
723 6EAY 1 L CA45 light chain 9541
724 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
725 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
726 5W1M 1 A, C, E, G CR1-07 Fab light chain 9606
727 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
728 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
729 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
730 6RCV 4 D, I R5.016 light chain 9606
731 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
732 5JW4 6 R MEDI8852 light chain 9606
733 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
734 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
735 5J3D 2 B, D, L 14N4 light chain 9606
736 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
737 5ESZ 2 B, L CH04 Light Chain 9606
738 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
739 3EFF 1 A, C FAB 10090
740 3PJS 1 A, C FAB light chain 10090
741 6OE5 3 C Motavizumab Fab Light Chain 10090
742 6OE5 5 L CR9501 Fab Light Chain 9606
743 6MAM 2 B, D, F ADI-15946 Fab Light Chain 9606
744 5O7P 2 A MF3178 FAB light chain 9606
745 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
746 4ZYP 5 E, G, I AM14 antibody light chain 9606
747 6B3M 4 D, J, N, P, U, W 70-1F02 Fab Light Chain 9606
748 6RCU 4 D R5.016 light chain 9606
749 5DWU 4 L Fab - Light Chain 9606
750 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
751 6EA7 4 L, N, R ADI-15878 Fab Light Chain 9606
752 5I8H 5 F, H VRC34.01 Fab light chain 9606
753 4RQS 2 C 17b Fab Light Chain 9606
754 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
755 4R4H 3 L Antibody 2.2c, Light chain 9606
756 6EA5 4 L, N, R ADI-15878 Fab Light Chain 9606
757 5FHC 5 L Antibody 114 Fab light chain 9606
758 4XMN 6 L Antibody 87 light chain 32630
759 4XMM 8 L Antibody 57 light chain 9606
760 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
761 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
762 6UKJ 3 L Fab Light Chain 9606
763 6U02 2 C, F, I, L Fab-63 Light Chain 9606
764 6PZZ 2 E, G, J, L NA-80 fragment antibody light chain 9606
765 6PWC 5 L Fab30 light chain 32630
766 6OT0 5 L Fab light chain 10090
767 6OGE 2 B Pertuzumab FAB LIGHT CHAIN 9606
768 6OGE 4 D Trastuzumab FAB LIGHT CHAIN 9606
769 6QD7 1 L, P, Z Light chain 9606
770 6QD8 1 L, Y, Z Light chain 9606
771 6NI2 4 L Fab30 Light Chain 32630
772 6NC3 4 L, T, U, V, W, X Monoclonal antibody VRC34.01 fragment antigen binding light chain 9606
773 6MZJ 2 C, L VRC01GL light chain germline VK3-11 with the mature CDRL3 of VRC01 9606
774 6MYY 2 C, F, L VRC01GL light chain germline VK3-11 with the mature CDR L3 of VRC01 9606
775 6MLM 4 G, I, L Light chain Fv of H7.5 Fab 9606
776 6MJZ 3 L PIA174 Fab Light chain 9606
777 6HJP 4 H, J, L Light chain of FISW84 Fab Fragment 9606
778 6HJQ 4 H, J, L Light chain of FISW84 Fab 9606
779 6E5P 1 1, 4, K, L, Q, T 2G12 Light chain 9606
780 6E1K 2 C, E cat06 light chain 9606
781 6CMO 5 L Fab light chain 32630
782 6CM3 4 J, L, N 17b Fab light chain 9606
783 6BF7 3 D, F Fab H11-E light chain 10090
784 6BF9 3 D, F Fab H11-E light chain 10090
785 6B7Z 3 D, F FAB H11 light chain 10090
786 6B70 3 D, F FAB H11-E light chain 10090
787 5VN3 1 L, N, O 17b Fab light chain 9606
788 5THR 4 J, K, L 17b Fab VL domain 9606
789 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
790 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
791 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
792 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
793 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
794 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
795 2ESG 1 L, M Immunoglobulin A1 light chain 9606
796 1R70 1 A, C Human IgA2(m1) Light Chain 9606
797 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606