Sequence Similarity Clusters for the Entities in PDB 3ZRY

Entity #1 | Chains: A,B,C
ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL protein, length: 510 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 8 13 614
95 % 10 15 620 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.9
PDBFlex
90 % 10 15 653
70 % 42 63 174
50 % 43 114 123
40 % 43 114 143
30 % 43 114 148
Entity #2 | Chains: D,E,F
ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL protein, length: 478 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 14 534
95 % 10 15 624 Flexibility: Low
Max RMSD: 4.1, Avg RMSD: 2.0
PDBFlex
90 % 11 19 566
70 % 55 85 137
50 % 44 65 202
40 % 44 65 222
30 % 44 65 229
Entity #3 | Chains: G
ATP SYNTHASE SUBUNIT GAMMA, MITOCHONDRIAL protein, length: 278 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 8 12 2266
95 % 9 13 2552 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 1.2
PDBFlex
90 % 9 13 2624
70 % 9 13 2653
50 % 11 18 2213
40 % 42 62 798
30 % 50 76 661
Entity #4 | Chains: H
ATP SYNTHASE SUBUNIT DELTA, MITOCHONDRIAL protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 13 2048
95 % 9 13 2622 Flexibility: Low
Max RMSD: 3.6, Avg RMSD: 1.8
PDBFlex
90 % 9 13 2692
70 % 9 13 2733
50 % 10 17 2367
40 % 10 17 2383
30 % 19 36 1353
Entity #5 | Chains: I
ATP SYNTHASE CATALYTIC SECTOR F1 EPSILON SUBUNIT protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 26408
95 % 10 14 2534 Flexibility: Low
Max RMSD: 4.3, Avg RMSD: 1.8
PDBFlex
90 % 10 14 2598
70 % 10 14 2632
50 % 10 14 2636
40 % 10 14 2670
30 % 10 14 2652
Entity #6 | Chains: J,K,L,M,N,O,P,Q,R,S
ATP SYNTHASE SUBUNIT 9, MITOCHONDRIAL protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 12 19 166
95 % 12 19 221 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.6
PDBFlex
90 % 12 19 232
70 % 13 23 183
50 % 14 36 137
40 % 14 36 152
30 % 14 36 158

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2JDI 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM RESIDUES 44-553 9913 7.1.2.2 | Details
2 2CK3 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 9913 7.1.2.2 | Details
3 1H8E 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE 9913 7.1.2.2 | Details
4 2V7Q 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM RESIDUES 44-553 9913 3.6.1.14 | Details
5 2JIZ 1 A, B, C, H, I, J ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM RESIDUES 44-553 9913 7.1.2.2 | Details
6 1W0J 1 A, B, C ATP SYNTHASE ALPHA CHAIN HEART ISOFORM, MITOCHONDRIAL PRECURSOR 9913 7.1.2.2 | Details
7 2JJ2 1 A, B, C, H, I, J ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM RESIDUES 44-553 9913 7.1.2.2 | Details
8 1E79 1 A, B, C ATP SYNTHASE ALPHA CHAIN HEART ISOFORM 9913 7.1.2.2 | Details
9 1E1R 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE 9913 7.1.2.2 | Details
10 3ZIA 1 A, B, C, K, L, M ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 4932
11 2JJ1 1 A, B, C, H, I, J ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM RESIDUES 44-553 9913 7.1.2.2 | Details
12 3OEE 1 A, B, C, J, K, L, S, T, U ATP synthase subunit alpha UNP RESIDUES 36-545 4932 7.1.2.2 | Details
13 1E1Q 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE 9913 7.1.2.2 | Details
14 2HLD 1 A, B, C, J, K, L, S, T, U ATP synthase alpha chain, mitochondrial 4932 7.1.2.2 | Details
15 1EFR 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE SUBUNIT ALPHA 9913 7.1.2.2 | Details
16 1MAB 1 A PROTEIN (F1-ATPASE ALPHA CHAIN) ALPHA CHAIN 10116 7.1.2.2 | Details
17 4ASU 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 9913
18 1NBM 1 A, B, C F1-ATPASE 9913 7.1.2.2 | Details
19 1W0K 1 A, B, C ATP SYNTHASE ALPHA CHAIN HEART ISOFORM, MITOCHONDRIAL PRECURSOR 9913 7.1.2.2 | Details
20 1OHH 1 A, B, C ATP synthase subunit alpha, mitochondrial 9913
21 3OEH 1 A, B, C, J, K, L, S, T, U ATP synthase subunit alpha UNP RESIDUES 36-545 4932 7.1.2.2 | Details
22 2XOK 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 4932
23 3OE7 1 A, B, C, J, K, L, S, T, U ATP synthase subunit alpha UNP RESIDUES 36-545 4932 7.1.2.2 | Details
24 1H8H 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE 9913 7.1.2.2 | Details
25 3OFN 1 A, B, C, J, K, L, S, T, U ATP synthase subunit alpha UNP RESIDUES 36-545 4932 7.1.2.2 | Details
26 4YXW 1 A, B, C ATP synthase subunit alpha, mitochondrial 9913
27 2WSS 1 A, B, C, J, K, L ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 9913
28 4TSF 1 A, B, C ATP synthase subunit alpha, mitochondrial 9913
29 4TT3 1 A, B, C ATP synthase subunit alpha, mitochondrial 9913
30 4Z1M 1 A, B, C ATP synthase subunit alpha, mitochondrial 9913
31 1COW 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE 9913 7.1.2.2 | Details
32 3FKS 1 A, B, C, J, K, L, S, T, U ATP synthase subunit alpha, mitochondrial UNP residues 36-545 4932 7.1.2.2 | Details
33 2F43 1 A ATP synthase alpha chain, mitochondrial 10116 7.1.2.2 | Details
34 2XND 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL RESIDUES 62-553 9913 7.1.2.2 | Details
35 5FL7 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA 4952
36 2WPD 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 4932
37 2W6J 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL 9913 7.1.2.2 | Details
38 2W6I 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL 9913 7.1.2.2 | Details
39 6FOC 1 A, B, C ATP synthase subunit alpha,ATP synthase subunit alpha,ATP synthase subunit alpha We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA,We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA,We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA,We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1512-1522. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA 1772 7.1.2.2 | Details
40 2W6H 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL 9913 7.1.2.2 | Details
41 2W6E 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL 9913 7.1.2.2 | Details
42 2W6G 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL 9913 7.1.2.2 | Details
43 3ZRY 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL 4932
44 2W6F 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL 9913 7.1.2.2 | Details
45 6RD4 17 T, U, V ATP synthase subunit alpha 37502
46 6RD6 5 T ATP synthase subunit alpha 37502
47 6RD9 17 T, U, V ATP synthase subunit alpha 37502
48 6RDA 13 T ATP synthase subunit alpha 37502
49 6RDB 6 T, U, V ATP synthase subunit alpha 37502
50 6RDC 17 T, U, V ATP synthase subunit alpha 37502
51 6RDD 13 T ATP synthase subunit alpha 37502
52 6RDE 6 T, U, V ATP synthase subunit alpha 37502
53 6RDF 13 T ATP synthase subunit alpha 37502
54 6RDG 6 T, U, V ATP synthase subunit alpha 37502
55 6RDH 17 T, U, V ATP synthase subunit alpha 37502
56 6RDI 17 T, U, V ATP synthase subunit alpha 37502
57 6RDJ 6 T, U, V ATP synthase subunit alpha 37502
58 6RDK 17 T, U, V ATP synthase subunit alpha 37502
59 6RDL 17 T, U, V ATP synthase subunit alpha 37502
60 6RDM 6 T, U, V ATP synthase subunit alpha 37502
61 6RDN 17 T, U, V ATP synthase subunit alpha 37502
62 6RDO 17 T, U, V ATP synthase subunit alpha 37502
63 6RDP 6 T, U, V ATP synthase subunit alpha 37502
64 6RDQ 17 T, U, V ATP synthase subunit alpha 37502
65 6RDR 17 T, U, V ATP synthase subunit alpha 37502
66 6RDS 6 T, U, V ATP synthase subunit alpha 37502
67 6RDT 17 T, U, V ATP synthase subunit alpha 37502
68 6RDU 17 T, U, V ATP synthase subunit alpha 37502
69 6RDV 6 T, U, V ATP synthase subunit alpha 37502
70 6RDW 17 T, U, V ATP synthase subunit alpha 37502
71 6RDX 17 T, U, V ATP synthase subunit alpha 37502
72 6RDY 6 T, U, V ATP synthase subunit alpha 37502
73 6RDZ 17 T, U, V ATP synthase subunit alpha 37502
74 6RE0 17 T, U, V ATP synthase subunit alpha 37502
75 6RE1 6 T, U, V ATP synthase subunit alpha 37502
76 6RE2 17 T, U, V ATP synthase subunit alpha 37502
77 6RE3 17 T, U, V ATP synthase subunit alpha 37502
78 6RE4 6 T, U, V ATP synthase subunit alpha 37502
79 6RE5 17 T, U, V ATP synthase subunit alpha 37502
80 6RE6 17 T, U, V ATP synthase subunit alpha 37502
81 6RE7 6 T, U, V ATP synthase subunit alpha 37502
82 6RE8 17 T, U, V ATP synthase subunit alpha 37502
83 6RE9 17 T, U, V ATP synthase subunit alpha 37502
84 6REA 6 T, U, V ATP synthase subunit alpha 37502
85 6REB 17 T, U, V ATP synthase subunit alpha 37502
86 6REC 17 T, U, V ATP synthase subunit alpha 37502
87 6RED 6 T, U, V ATP synthase subunit alpha 37502
88 6REE 17 T, U, V ATP synthase subunit alpha 37502
89 6REF 17 T, U, V ATP synthase subunit alpha 37502
90 6REP 17 T, U, V ATP synthase subunit alpha 37502
91 6RER 6 T, U, V ATP synthase subunit alpha 37502
92 6RES 17 T, U, V ATP synthase subunit alpha 37502
93 6RET 17 T, U, V ATP synthase subunit alpha 37502
94 6REU 6 T, U, V ATP synthase subunit alpha 37502
95 6J5I 1 A, B, C ATP synthase subunit alpha, mitochondrial 9823
96 6J5J 1 A, B, C ATP synthase subunit alpha, mitochondrial 9823
97 6J5K 1 A, AA, AB, AC, B, BA, BB, BC, C, CA, CB, CC ATP synthase F1 subunit alpha 9823
98 6CP3 3 A, B, C ATP synthase subunit alpha, mitochondrial 4932
99 6CP6 3 A, B, C ATP synthase subunit alpha, mitochondrial 4932
100 6B8H 11 B, C, K, W, X, n ATP synthase subunit alpha, mitochondrial 4932
101 5LQX 5 A, B, C ATP synthase alpha subunit 870730
102 5LQY 5 A, B, C ATP synthase alpha subunit 870730
103 5LQZ 5 A, B, C ATP synthase alpha subunit 870730
104 5FIJ 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
105 5FIK 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
106 5FIL 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
107 5ARA 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
108 5ARE 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
109 5ARH 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
110 5ARI 1 A, B, C ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL UNP RESIDUES 44-553 9913
111 4B2Q 1 A, C, a, c ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL RESIDUES 61-545 4932
112 4B2Q 2 B, b ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL RESIDUES 60-545 4932
113 1QO1 1 A, B, C ATP SYNTHASE ALPHA CHAIN THE BOS TAURUS (BOVINE) ATP SYNTHASE ALPHA CHAIN HEART ISOFORM SEQUENCE (SWISSPROT P19483) AND MODEL (PDB ENTRY 1BMF) ARE GIVEN IN THE COORDINATES OF THIS ENTRY 4932 7.1.2.2 | Details
114 1BMF 1 A, B, C BOVINE MITOCHONDRIAL F1-ATPASE 9913 7.1.2.2 | Details