Sequence Similarity Clusters for the Entities in PDB 3KXF

Entity #1 | Chains: A,C,I,K
HLA class I histocompatibility antigen, B-35 alpha chain protein, length: 276 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 18821
95 % 116 122 297 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 0.9
PDBFlex
90 % 224 231 148
70 % 769 816 6
50 % 771 821 8
40 % 814 865 9
30 % 831 889 12
Entity #2 | Chains: B,F,J,L
Beta-2-microglobulin protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 650 702 2
95 % 697 751 3 Flexibility: Low
Max RMSD: 22.2, Avg RMSD: 0.9
PDBFlex
90 % 713 767 3
70 % 991 1070 4
50 % 1009 1094 4
40 % 1009 1094 4
30 % 1009 1094 7
Entity #3 | Chains: D,G,M,N
SB27 T cell receptor alpha chain protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 25912
95 % 3 3 9340 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.9
PDBFlex
90 % 3 4 8569
70 % 19 23 1914
50 % 332 394 76
40 % 332 394 89
30 % 332 394 90
Entity #4 | Chains: E,H,O,P
SB27 T cell receptor beta chain protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 27919
95 % 32 33 974 Flexibility: Low
Max RMSD: 3.1, Avg RMSD: 1.2
PDBFlex
90 % 75 81 400
70 % 325 381 43
50 % 339 403 64
40 % 339 403 80
30 % 339 403 85
Entity #5 | Chains: Q,R,S,T
peptide from Trans-activator protein BZLF1 protein, length: 13 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
2 6FR4 1 A TCR 003 alpha chain 9606
3 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
4 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
5 6FR3 1 A 003 TCR Alpha Chain 9606
6 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
7 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
8 2NW2 1 A ELS4 TCR alpha chain 9606
9 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
10 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
11 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
12 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
13 1KGC 1 D T-cell receptor alpha chain 9606
14 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
15 6FUQ 1 A Human F11 T-Cell Receptor 9606
16 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
17 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
18 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
19 6BJ8 3 D TCR 55 alpha chain 9606
20 6DFV 1 A, C TCR alpha chain 10090
21 6MRA 1 A TCR alpha chain 10090
22 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
23 5TEZ 4 I TCR F50 alpha chain 9606
24 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
25 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
26 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
27 6CPH 1 D TCR alpha chain 9606
28 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
29 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
30 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
31 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
32 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
33 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
34 5D7K 1 D MAV36 TCR Alpha Chain 9606
35 3VXS 3 D H27-14 TCR alpha chain 9606
36 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
37 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
38 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
39 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
40 4PJE 3 E, G TCR-alpha 9606
41 6G9Q 3 G T cell receptor alpha variable 14-1,T-cell receptor alpha chain C region UNP residues 22-120,UNP residues 1-88 10090
42 6BJ3 3 D TCR 55 alpha chain 9606
43 4MS8 1 C 42F3 alpha 10090
44 4G9F 4 D beta chain C12C TCR 9606
45 6MJJ 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
46 4PJH 3 E, G TCR-alpha 9606
47 5KSA 3 C Bel602 alpha TRAV20*01 9606
48 5D7J 1 A, G M33.64 TCR Alpha Chain 9606
49 4PJ9 3 C TCR-alpha 9606
50 5U16 3 E, G MAIT T-cell receptor alpha chain 9606
51 5D7I 3 E, G M33.64 TCR Alpha Chain 9606
52 4PJ5 3 D, G TCR-alpha 9606
53 5C0C 4 D, I 1E6 TCR Alpha Chain 9606
54 5M01 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
55 6MJ4 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, chimeric protein 10090
56 4L4T 3 D, G MAIT T-cell receptor alpha chain 9606
57 5EU6 4 D Human TCR Light Chain 9606
58 5M00 3 G Protein Trav14-1,Uncharacterized protein 10090
59 2IAL 1 A, C CD4+ T cell receptor E8 alpha chain 9606
60 6DFX 3 G, I T1D3 alpha chain 9606
61 6CW9 1 C Chimeric T cell antigen receptor alpha chain. Va14,Va24,Ja18 10090
62 2F53 4 D T-cell Receptor, alpha chain 9606
63 6MIV 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain 10090
64 5ISZ 4 D TCRalpha chain 9606
65 3QJH 1 A, C 5c.c7 alpha chain 10090
66 5C0B 4 D, I 1E6 TCR Alpha Chain 9606
67 5YXN 1 A T cell receptor alpha chain 9606
68 3MFF 1 A, C T cell receptor alpha chain 9606
69 2VLM 1 D JM22 TCR ALPHA CHAIN 9606
70 2BNR 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
71 5IVX 3 E T-CELL RECEPTOR ALPHA CHAIN 10090
72 5NMD 1 A, C human T-cell Receptor alpha chain 9606
73 4NQE 3 D, G TCR alpha 9606
74 6CUH 1 A T-cell Receptor alpha variable, TRAV 9-2. BC8B TCR 9606
75 6AVF 2 A T-cell receptor alpha variable 4,TCR alpha chain 9606
76 4X6B 1 A, C TCR alpha 9606
77 4ELK 1 A, C Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
78 2P5W 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
79 4ZDH 1 A Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region 9606
80 6AMU 4 D DMF5 TCR alpha chain 9606
81 5U17 2 B, D MAIT T-cell receptor alpha chain 9606
82 5D5M 3 E, G M33.64 TCR Alpha Chain 9606
83 5C07 4 D, I 1E6 TCR Alpha Chain 9606
84 1LP9 4 E, L T-cell Receptor alpha chain 10090
85 6CXE 1 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
86 4P23 1 A J809.B5 TCR V alpha chain (Va2.8) 10090
87 3VXQ 1 A, D H27-14 TCR alpha chain 9606
88 5U2V 3 E, G MAIT T-cell receptor alpha chain 9606
89 4PJX 3 E, G TCR-alpha 9606
90 3MV7 4 D alpha chain of the TK3 TCR 9606
91 5D2N 1 C, D C25 alpha 9606
92 4G8F 1 A alpha chain clone 42 TCR 9606
93 4NQD 3 D, G TCR alpha chain 9606
94 3QEU 1 A, D DMF5 alpha chain 9606
95 3TJH 3 C 42F3 alpha 10090
96 4GRM 1 A, C A6 alpha chain 9606
97 5WLG 4 D, I T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain 10090
98 4MAY 3 C HY.1B11 TCR alpha chain 9606
99 3QUY 3 C Valpha14 (mouse variable domain, human constant domain) 10090
100 2CDF 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
101 2XNA 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
102 3QH3 1 A, C A6 alpha chain 9606
103 6CWE 3 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
104 4PJG 3 E, G TCR-alpha 9606
105 5EUO 3 E, G PF6 TCR alpha chain 9606
106 4LFH 1 D 9C2 TCR delta chain 9606
107 3MV8 4 D alpha chain of the TK3 TCR 9606
108 6MJI 1 C T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
109 3RUG 3 E, G Valpha10(mouse variable domain, human constant domain) 10090
110 2PYF 1 A T-Cell Receptor, Alpha Chain 9606
111 3QUZ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
112 6BGA 3 C T cell receptor 2B4 alpha chain 10090
113 4Y19 4 D FS18_alpha 9606
114 2PYE 4 D T-Cell Receptor, Alpha Chain 9606
115 2EYS 1 A NKT15 9606
116 4LCW 3 D, G MAIT T cell receptor alpha chain 9606
117 4G8G 4 D alpha chain C12C TCR 9606
118 4NQC 3 D, G TCR alpha chain 9606
119 4PJC 3 E, G TCR-alpha 9606
120 6CX9 3 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
121 4JRX 4 D CA5 TCR alpha chain 9606
122 4PJF 3 E, G TCR-alpha 9606
123 6CUG 3 D T-cell receptor alpha variable TRAV9-2 - BC8B TCR 9606
124 6MJA 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
125 4PJ7 3 E, G TCR-alpha 9606
126 5U72 2 B, D MAIT T-cell receptor alpha chain 9606
127 3REV 1 A TCR NB20 ALPHA CHAIN 9606
128 6D78 4 D DMF5 alpha chain,DMF5 alpha chain 9606
129 5C08 4 D, I 1E6 TCR Alpha Chain 9606
130 4PRP 4 D TK3 TCR alpha chain 9606
131 6MJ6 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain 10090
132 2VLJ 4 D JM22 TCR ALPHA CHAIN 9606
133 3QFJ 4 D A6 alpha chain 9606
134 3VXR 3 D H27-14 TCR alpha chain 9606
135 6AM5 4 D DMF5 TCR alpha chain 9606
136 4JFH 1 D alpha24 TCR allele 9606
137 2VLR 4 D, I JM22 TCR ALPHA CHAIN 9606
138 5C0A 4 D, I 1E6 TCR Alpha Chain 9606
139 6FR7 1 A T-Cell Receptor alpha chain 9606
140 5BS0 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
141 4G8E 1 A alpha chain clone 18 TCR 9606
142 2XN9 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
143 4PJI 3 E, G TCR-alpha 9606
144 6C61 1 A T-cell receptor alpha chain 10090
145 1J8H 4 D T-CELL RECEPTOR ALPHA CHAIN Extracellular Domain 9606
146 4WW2 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
147 3QJF 1 A, C 2B4 alpha chain 10090
148 4WO4 3 C TCR variable DELTA 1 CHAIN and TCR constant Alpha 9606
149 4PRI 4 D TK3 TCR alpha chain 9606
150 5FKA 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS 9606
151 4JFD 4 D High Affinity TCR Alpha Chain 9606
152 4PJA 3 E, G TCR-alpha 9606
153 6BNL 3 C, G NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains 9606
154 6CQN 4 D F5 alpha chain 9606
155 5JHD 4 D, I TCRalpha chain 9606
156 6CXF 3 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
157 6CX5 3 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
158 5JZI 4 D, I HCV1406 TCR alpha chain 9606
159 4JFF 4 D High Affinity TCR Alpha Chain 9606
160 5C09 4 D, I 1E6 TCR Alpha Chain 9606
161 6FR8 1 A T-Cell Receptor HA1.7 alpha Chain 9606
162 3W0W 4 D T36-5 TCR alpha chain 9606
163 6CQL 4 D F24 alpha chain 9606
164 2YPL 4 D AGA T-CELL RECEPTOR ALPHA CHAIN 9606
165 4P2O 3 C 2B4 T-cell receptor alpha chain 10090
166 5KS9 3 E, G Bel502 TCR alpha TRAV20*01 9606
167 1TCR 1 A ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) 10090
168 3QDJ 4 D DMF5 alpha chain 9606
169 5WJO 1 A, C PG90 TCR alpha chain 9606
170 4Z7U 3 E, G T-CELL RECEPTOR, S13 ALPHA CHAIN 9606
171 4PJD 3 E, G TCR-alpha 9606
172 6AVG 2 B, C T-cell receptor alpha variable 4,TCR alpha chain 9606
173 2GJ6 4 D A6-Tcr 9606
174 4Z7V 3 E, G T-CELL RECEPTOR, L3-12 ALPHA CHAIN 9606
175 3VXM 4 D C1-28 TCR alpha chain 9606
176 3QI9 3 C NKT TCR V alpha 14 chimera of Mouse variable domain and human constant domain 10090
177 3UTT 4 D, I 1E6 TCR Alpha Chain 9606
178 4PRH 4 D TK3 TCR alpha chain 9606
179 2EYR 1 A NKT12 9606
180 5BRZ 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
181 4OZF 3 G T-CELL RECEPTOR, JR5.1 ALPHA CHAIN 9606
182 4E41 4 D, I T cell receptor G4 alpha chain 9606
183 4PJB 3 E, G TCR-alpha 9606
184 6C68 1 A, C T-cell receptor alpha chain 10090
185 3HUJ 3 E, G NKT15 T cell receptor alpha-chain 9606
186 5U1R 2 B, D MAIT T-cell receptor alpha chain 9606
187 5HHM 4 D, I JM22 TCR alpha chain 9606
188 6CXA 3 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
189 2VLK 4 D JM22 TCR ALPHA CHAIN 9606
190 4X6C 3 E, G TCR alpha 9606
191 4EN3 2 A HUMAN NKT TCR ALPHA CHAIN 9606
192 6CX7 1 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
193 2EYT 1 A, C NKT15 9606
194 1MI5 4 D TcR alpha chain extracellular domain 9606
195 2UWE 4 E, L AHIII TCR ALPHA CHAIN 10090
196 3KPS 4 D LC13 TCR alpha chain 9606
197 4MXQ 1 C 42F3 alpha VmVh chimera 10090
198 4Y16 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
199 6EH8 1 A Human T Cell Receptor Alpha Chain 9606
200 3PWP 4 D A6 TCR alpha chain 9606
201 3VXT 1 A, C T36-5 TCR alpha chain 9606
202 6EQB 4 D High Affinity Mel5 TCR, alpha chain 9606
203 6MIY 1 C, G T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
204 3O4L 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
205 6Q3S 4 D T cell receptor alpha variable 21,T-cell receptor, sp3.4 alpha chain 9606
206 3QEQ 4 D DMF4 alpha chain 9606
207 5XOV 4 G, I V-delta chain of T cell receptor 9606
208 4GKZ 1 A Alpha chain of Class II TCR 9606
209 3O8X 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
210 4E42 1 A, C T cell receptor G4 alpha chain 9606
211 2ESV 4 D KK50.4 T cell receptor alpha chain Extracellular domain 9606
212 6EH9 1 A Human T Cell Receptor Alpha Chain 9606
213 4P46 3 A J809.B5 TCR Y31A alpha chain (Va2.8) 10090
214 4JFE 4 D High Affinity TCR Alpha Chain 9606
215 5NMG 4 D, I Human T-cell receptor alpha chain 9606
216 4IRS 3 C Valpha14 (mouse variable domain, human constant domain) 10090
217 3UTS 4 D, I 1E6 TCR Alpha Chain 9606
218 1FYT 4 D T-CELL RECEPTOR ALPHA CHAIN EXTRACELLULAR DOMAIN 9606
219 6DFQ 1 A, C, E, G TCR alpha chain 10090
220 6C09 3 C 3C8 T cell receptor alpha-chain 9606
221 5MEN 4 D Protein TRAV22,Human nkt tcr alpha chain 9606
222 3TA3 3 C Valpha14 chimera (mouse variable domain, human constant domain) 10090
223 3KPR 4 D, I LC13 TCR alpha chain 9606
224 2CDG 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
225 3RDT 3 A TCR 809.B5 alpha chain 10090
226 1BD2 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 210 9606
227 4L3E 4 D DMF5 alpha chain 9606
228 3PL6 3 C T-cell receptor alpha chain 9606
229 3O9W 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
230 4JRY 4 D SB47 TCR alpha chain 9606
231 5XOT 4 D The Delta chain of TU55 TCR 9606
232 3DX9 1 A, C DM1 T cell receptor alpha chain 9606
233 2JCC 4 E, L TCR ALPHA 10090
234 3UTP 1 D, K 1E6 TCR alpha chain 9606
235 4X6D 3 E, G TCR alpha 9606
236 3D39 4 D A6 TCR alpha chain 9606
237 3ARB 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
238 3QIU 3 C TCR 226 alpha chain 10090
239 4UDU 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
240 4APQ 3 C MOUSE NKT TCR VALPHA14, HUMAN NKT TCR VALPHA14 MOUSE VARIABLE DOMAIN, RESIDUES 1-121, HUMAN CONSTANT DOMAIN, RESIDUES 122-212 10090
241 2AK4 4 D, I, N, T SB27 T cell receptor alpha chain Extracellular Domain 9606
242 6D7G 2 D TRA@ protein 9606
243 3QDG 4 D DMF5 alpha chain 9606
244 4P4K 3 C, G hTCRav22 alpha chain 9606
245 5SWZ 4 D, I, N, S NP1-B17 TCR alpha chain 10090
246 5NMF 4 D HUman T-cell receptor Alpha chain 9606
247 5NMF 6 I HUman T-cell receptor Alpha chain 9606
248 5WKI 3 D T-cell receptor alpha variable 26-1,TRA@ protein 9606
249 4N0C 3 C, G 42F3 VmCh alpha 10090
250 3H9S 4 D A6 TCR alpha chain 9606
251 3QIB 3 C T-cell receptor alpha chain C region 9606
252 6CQQ 4 D, I F24 alpha chain 9606
253 6MSS 1 A A11B8.2 NKT TCR alpha-chain 10090
254 4MNQ 4 D Uncharacterized protein, T-cell receptor, sp3.4 alpha chain 9606
255 4FTV 4 D A6 alpha chain 9606
256 3VWK 3 C NKT15 T cell receptor alpha-chain 9606
257 2IAM 4 C CD4+ T cell receptor E8 alpha chain 9606
258 3C5Z 1 A, E TCR B3K506 Alpha Chain 10090
259 5WKF 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain Chimera 9606
260 3SKN 1 A, C, E, G RL42 T cell receptor, alpha chain 9606
261 2F54 4 D, K T-cell receptor alpha chain 9606
262 4IRJ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
263 4GRL 3 C TCR Hy.1B11 alpha chain 9606
264 6MNG 3 A 4738 TCR alpha chain 10090
265 3QDM 4 D DMF4 alpha chain 9606
266 1QRN 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
267 4LHU 3 D 9C2 TCR delta chain 9606
268 6CW6 3 C Chimeric T cell antigen receptor alpha chain 10090
269 5NME 4 D, I T-cell receptor Alpha chain 9606
270 3RGV 1 A Yae62 TCR a chain 10090
271 1AO7 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 212 9606
272 4PJ8 3 C TCR-alpha 9606
273 3D3V 4 D A6 TCR alpha chain 9606
274 3TYF 1 A, C iNKT Cell Receptor Alpha Chain 562
275 4QRP 4 D, J, K DD31 TCR alpha chain 9606
276 4ZAK 3 C Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain 10090
277 4Y4K 3 C chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain) 10090
278 3ARE 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
279 3FFC 4 D, I CF34 alpha chain 9606
280 3QUX 3 C Valpha14 (mouse variable domain, human constant domain) 10090
281 4IIQ 1 A Human Mucosal Associated Invariant T cell receptor alpha chain 9606
282 6CWB 3 C Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18 10090
283 5WKH 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain 9606
284 5YXU 1 A, F T cell receptor alpha chain 9606
285 3MV9 4 D alpha chain of the TK3 TCR 9606
286 2IAN 4 D, I, N, S CD4+ T cell receptor E8 alpha chain 9606
287 6MNN 3 A 6236 TCR alpha chain 10090
288 4N5E 1 C 42F3 alpha VmCh 10090
289 1MWA 1 A, C 2C T CELL RECEPTOR ALPHA CHAIN 10090
290 5TIL 4 G alpha chain of P14 T cell receptor 10090
291 3HE7 3 C Valpha14(mouse variable domain, human constant domain) 10090
292 3TVM 3 C, G Valpha14 (mouse variable domain, human constant domain) 10090
293 6FR6 1 A Human T-Cell Receptor Alpha Chain 9606
294 4OZH 3 E, G T-cell receptor, s16, alpha chain 9606
295 4OZG 3 E, G T-cell receptor, d2, alpha chain 9606
296 3RTQ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
297 4QOK 4 D Mel5 TCR chain alpha 9606
298 6EQA 4 D Mel5 TCR, alpha chain 9606
299 3SCM 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
300 6MNO 3 A 6235 TCR alpha chain 10090
301 5VCJ 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) UNP A0A0B4J1J9 residues 22-114,UNP K7N5M3 residues 116-210 10090
302 4WWK 1 A TCR Alpha Chain-TRAV12-3 9606
303 5KSB 3 E, G T15 TCR alpha TRAV20*02 9606
304 4EI5 3 C, G Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
305 4QRR 3 D clone12 TCR beta chain 9606
306 3GSN 4 A RA14 TCR alpha chain (TRAV24, TRAJ49) 9606
307 3RZC 3 C Valpha14 mouse variable domain, human constant domain 10090
308 3O6F 3 C, G T-cell receptor alpha chain C region unp residues 1-92 9606
309 4P5T 1 A, E TRA protein 9606
310 3ARF 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
311 4Z7W 3 E, G T-CELL RECEPTOR, T316 ALPHA CHAIN 9606
312 5SWS 4 D NP1-B17 TCR alpha chain 10090
313 6MJQ 1 C, G T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, chimeric protein 10090
314 3ARD 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
315 4L8S 1 A Muccosal Associated Invariant T Cell Receptor alpha chain 9606
316 4NHU 1 A, C 2C m33 alpha VmCh chimera 10090
317 1QSE 4 D PROTEIN (human T-Cell receptor) 9606
318 1NFD 1 A, C N15 ALPHA-BETA T-CELL RECEPTOR 10090
319 3TFK 3 C 42F3 alpha Mouse-human chimera alpha chain 10090
320 4P2Q 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
321 2CKB 1 A, C ALPHA, BETA T CELL RECEPTOR VB8.2DB2JB2.4CB2\;VA3JA58CA EXTRACELLULAR DOMAINS 10090
322 1QSF 4 D HUMAN T-CELL RECEPTOR 9606
323 4C56 1 A, G T CELL RECEPTOR ALPHA CHAIN 9606
324 5HYJ 4 D, I Human T-cell Receptor, Class I, Light alpha Chain 9606
325 6BNK 3 C, G Human nkt tcr alpha chain 9606
326 6MTM 4 D EM2 TCR alpha chain 9606
327 4Y2D 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
328 4EUP 4 G, I JKF6 alpha chain 9606
329 3HE6 3 C Valpha14(mouse variable domain, human constant domain) 10090
330 6DKP 4 D DMF5 T-cell Receptor Alpha Chain fusion 9606
331 5W1W 4 D, I, N, S GF4 T cell receptor alpha chain 9606
332 3KXF 3 D, G, M, N SB27 T cell receptor alpha chain 9606
333 6CQR 4 D, I F24 alpha chain 9606
334 3HG1 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
335 3TO4 3 C NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-207 IS HUMAN CONSTANT DOMAIN 10090
336 1HXM 1 A, C, E, G GAMMA-DELTA T-CELL RECEPTOR 9606
337 5HHO 3 D JM22 TCR alpha chain 9606
338 6MNM 3 A 6256 TCR alpha chain 10090
339 2NX5 4 D, I, N, T ELS4 TCR alpha chain 9606
340 4OZI 3 E, G T-cell receptor, s2, alpha chain 9606
341 3VXU 4 D, I T36-5 TCR alpha chain 9606
342 3ARG 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
343 5NHT 4 A T-cell receptor alpha variable 12-2,T-cell receptor, sp3.4 alpha chain Numbering: residue 1 match first residue of TRAV12-2 defined in IMGT. Additional sequence in C-ter (ENDGGGCK) to enhance alpha-beta chain pairing. 9606
344 4Y4F 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
345 5L2K 3 D GEM42 TCR alpha chain 9606
346 3VWJ 3 C NKT15 T cell receptor alpha-chain 9606
347 4MVB 1 C 42F3 alpha VmCh 10090
348 3TPU 1 A, C, G, M 42F3 alpha 10090
349 5IW1 1 A, C, E T-CELL RECEPTOR ALPHA CHAIN 10090
350 4P2R 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
351 4MJI 4 D, I T-Cell Receptor Chain alpha 9606
352 4NDM 2 B Human nkt tcr alpha chain AB18.1 TCR delta chain 9606
353 3TZV 1 A, G Invariant Natural Killer T Cell Receptor chain A 9606
354 3QIW 3 C TCR 226 alpha chain unp residues 97-108 7130
355 3AXL 1 A, G Valpha 10 10090
356 3SDX 3 E, G NKT TCR Valpha24 chain 9606
357 2WBJ 3 C, G OB TCR E. COLI ENGA PEPTIDE COVALENTLY BOUND 9606
358 3TN0 3 C mouse NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-210 IS HUMAN CONSTANT DOMAIN 10090
359 2PO6 3 C, G NKT15 alpha-chain 9606
360 3SDA 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
361 6DFS 1 A mouse TCR alpha chain 10090
362 5TJE 3 E, G ALPHA CHAIN OF MURINE T CELL RECEPTOR p14 10090
363 3SDC 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
364 5NQK 4 A T-cell receptor alpha variable 12-2,T-cell receptor alpha joining 45,T-cell receptor alpha chain C region NUMBERING: RESIDUE 1 MATCH FIRST RESIDUE OF TRAV 12-2 DEFINED IN IMGT. ADDITIONAL SEQUENCE IN C-TER (ENDGGGCK) TO ENHANCE ALPHA-BETA CHAIN PAIRING. 9606
365 4Y4H 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
366 2J8U 4 E, L AHIII TCR ALPHA CHAIN ECTODOMAIN 10090
367 6MKD 3 A 4699 TCR alpha chain 10090
368 1ZGL 4 M, Q, S, U T cell receptor alpha chain 9606
369 6DFW 3 E, G 8F10 alpha chain 10090
370 4ELM 3 E, G Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
371 5W1V 4 D, I, N, S GF4 T cell receptor alpha chain 9606
372 4ONH 2 A T-cell receptor beta 9606
373 3SDD 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
374 4MNH 2 B, D Human nkt tcr alpha chain DP10.7 TCR delta variable domain fused with human TCR alpha constant domain 9606
375 6MKR 3 A 5287 TCR alpha chain 10090
376 3SJV 4 D, I, N, S RL42 T cell receptor, alpha chain 9606
377 4GG6 3 E, G T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
378 3PQY 4 D, I, N, S alpha chain of the 6218-TCR chimeric construct with mouse variable domain and human constant domain 10090
379 5FK9 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS, RESIDUES 1-206 9606
380 3C60 1 A, E TCR YAe62 alpha chain 10090
381 1G6R 1 A, C ALPHA T CELL RECEPTOR EXTRACELLULAR DOMAIN 10090
382 6BJ2 1 D TCR 589 alpha chain 9606
383 4GG8 1 A, E T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
384 4LCC 2 A Human MAIT TCR alpha chain 9606
385 4L9L 2 A Human MAIT TCR alpha chain 9606
386 3C6L 1 A, E TCR 2W20 alpha chain 10090
387 4Y1A 4 D FS17_alpha 9606
388 5D7L 3 D, G MAV36 TCR Alpha Chain 9606
389 5D2L 3 E, I, K, O C7 TCR alpha chain 9606
390 1YMM 4 D T cell receptor alpha chain 9606
391 3T0E 3 C T-cell receptor alpha chain 9606
392 2CDE 1 A, C, E INKT-TCR HUMAN INVARIANT NATURAL KILLER T CELL RECEPTOR VALPHA 24 AND VBETA11 9606
393 3DXA 4 D, I, N DM1 T cell receptor alpha chain 9606
394 5E6I 1 A, F, G, P TCR alpha chain,Human nkt tcr alpha chain 9606