Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 194 65
95 % 57 201 75 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 68 214 77
70 % 69 216 95
50 % 78 249 108
40 % 85 372 47
30 % 107 449 43

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 4J9Y 2 R Calmodulin 10116
14 2O60 1 A Calmodulin 9031
15 5V03 2 R Calmodulin 9606
16 3IF7 1 A Calmodulin 9913
17 6DAD 1 A, B Calmodulin-1 9606
18 5NIN 1 A, B Calmodulin 9606
19 1QTX 1 A PROTEIN (CALMODULIN) 562
20 4G28 2 R Calmodulin 10116
21 4G27 2 R Calmodulin 10116
22 1G4Y 2 R CALMODULIN 10116
23 4J9Z 2 R Calmodulin 10116
24 2F3Z 1 A Calmodulin 9606
25 1PRW 1 A Calmodulin 9913
26 1OSA 1 A CALMODULIN 5888
27 5JQA 1 A Calmodulin 9606
28 1MXE 1 A, B Calmodulin 7227
29 1YR5 1 A calmodulin residues 1-148 9606
30 5JTH 1 A Calmodulin 9606
31 1CLL 1 A CALMODULIN 9606
32 5V02 2 R Calmodulin-1 9606
33 2WEL 2 D CALMODULIN 9606
34 1N0Y 1 A, B Calmodulin 5888
35 3BYA 1 A Calmodulin 9606
36 1VRK 1 A CALMODULIN 32630
37 3SJQ 1 A, B Calmodulin 10116
38 5K8Q 1 A Calmodulin 9606
39 4EHQ 1 A Calmodulin 10116
40 1CLM 1 A CALMODULIN 5888
41 4BW7 1 A, C CALMODULIN 9606
42 1AHR 1 A CALMODULIN 9031
43 1IQ5 1 A CALMODULIN 8355
44 5WBX 2 R Calmodulin-1 9606
45 1CM4 1 A CALMODULIN 9913
46 1ZUZ 1 A calmodulin 9606
47 1QS7 1 A, C CALMODULIN 562
48 2Y4V 1 A CALMODULIN 9606
49 6DAE 1 A, B Calmodulin-1 9606
50 2HQW 1 A Calmodulin 10116
51 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
52 3SUI 1 A Calmodulin 9606
53 1UP5 1 A, B Calmodulin 9031
54 4BW8 1 A, B CALMODULIN 9606
55 4QNH 2 R Calmodulin 10116
56 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
57 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
58 4Q5U 1 A Calmodulin 9606
59 4AQR 1 A, B CALMODULIN-7 3702
60 2BE6 1 A, B, C Calmodulin 2 9606
61 1CDL 1 A, B, C, D CALMODULIN 9606
62 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
63 4DBP 2 C Calmodulin 7227
64 4HEX 1 A, B Calmodulin 10090
65 4M1L 1 A Calmodulin UNP residues 2-149 9606
66 2BCX 1 A Calmodulin 9031
67 1LIN 1 A CALMODULIN 9913
68 3CLN 1 A CALMODULIN 10117
69 1IWQ 1 A CALMODULIN 9606
70 2V01 1 A CALMODULIN 9606
71 1WRZ 1 A calmodulin 9606
72 2YGG 2 B CALMODULIN 10116
73 1RFJ 1 A calmodulin 4113
74 3L9I 2 C Calmodulin 7227
75 1CM1 1 A CALMODULIN 9913
76 1NIW 1 A, C, E, G calmodulin 10116
77 4CLN 1 A CALMODULIN 7227
78 3G43 1 A, B, C, D Calmodulin 9606
79 6CZQ 2 R Calmodulin-1 residues 5-148 10116
80 1XA5 1 A Calmodulin 9913
81 1OOJ 1 A Calmodulin CMD-1 6239
82 2X0G 2 B CALMODULIN 9606
83 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
84 6B8P 2 B, D, F, H Calmodulin-1 9606
85 4DCK 2 B Calmodulin Calmodulin 9606
86 4PJJ 2 B Calmodulin 7227
87 4L79 2 B Calmodulin 9606
88 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
89 5WC5 2 R Calmodulin-1 9606
90 2X51 2 B CALMODULIN 7227
91 6B8N 2 B, D, F, H Calmodulin-1 9606
92 6B8L 2 B, D, F, H Calmodulin-1 9606
93 3BXL 1 A Calmodulin 10116
94 2VB6 2 B CALMODULIN 9031
95 5DBR 1 A Calmodulin 9606
96 3DVE 1 A Calmodulin 9606
97 4DBQ 2 B Calmodulin 7227
98 6DAF 1 A, B Calmodulin-1 9606
99 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
100 2BKH 2 B CALMODULIN 7227
101 2V02 1 A CALMODULIN 9606
102 6B8M 2 B, D, F, H Calmodulin-1 9606
103 1QIW 1 A, B CALMODULIN 9913
104 4ZLK 2 B Calmodulin 10090
105 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
106 3EWT 1 A Calmodulin 9606
107 2VAS 2 B CALMODULIN 7227
108 1Y6W 1 A Calmodulin 9606
109 1CTR 1 A CALMODULIN 9606
110 1L7Z 1 A CALMODULIN 9606
111 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
112 4BYF 2 B, D CALMODULIN 9606
113 6DAH 1 A, B, C, D Calmodulin-1 9606
114 3DVK 1 A Calmodulin 9606
115 3BXK 1 A, C Calmodulin 10116
116 1QIV 1 A CALMODULIN 9913
117 1A29 1 A CALMODULIN 9913
118 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
119 2FOT 1 A Calmodulin 9913
120 3HR4 2 B, D, F, H Calmodulin 9606
121 6B8Q 2 B, D, F, H Calmodulin-1 9606
122 3GN4 2 B, D, F, H Calmodulin 7227
123 3EWV 1 A Calmodulin 9606
124 3OXQ 1 A, B, C, D Calmodulin 9606
125 1K90 2 D, E, F CALMODULIN 9606
126 4GOW 1 D Calmodulin 9606
127 4ANJ 2 B CALMODULIN 7227
128 4OVN 1 A, B, C, D, E Calmodulin 9606
129 5HIT 1 A Calmodulin 9031
130 5V7X 2 B Calmodulin-1 9606
131 5I0I 2 C Calmodulin 9606
132 5I0I 3 E Calmodulin 9606
133 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
134 4UMO 2 C, D CALMODULIN 9606
135 4JPZ 3 C, I Calmodulin 9606
136 1DEG 1 A CALMODULIN 9913
137 3DVJ 1 A Calmodulin 9606
138 3DVM 1 A Calmodulin 9606
139 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
140 2BKI 2 B, D CALMODULIN 9031
141 1S26 2 D, E, F Calmodulin 9606
142 1SK6 2 D, E, F Calmodulin 9606
143 1K93 2 D, E, F CALMODULIN 9606
144 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
145 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
146 4R8G 2 A, B, H Calmodulin 8355
147 1PK0 2 D, E, F Calmodulin 9606
148 1QX7 1 A, B, I, M, R Calmodulin 10116
149 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
150 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
151 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
152 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
153 4JQ0 2 C Calmodulin 9606
154 1LVC 2 D, E, F calmodulin 9606
155 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
156 6E2F 2 E Calmodulin-1 9606
157 6E2G 2 E Calmodulin-1 9606
158 6DMW 2 E Calmodulin-1 10116
159 6GDK 1 A Calmodulin-1 9606
160 6GDL 1 A Calmodulin-1 9606
161 6CNM 2 E, F, G, H Calmodulin-1 9606
162 6CNN 2 E, F, G, H Calmodulin-1 9606
163 6CNO 2 E, F, G, H Calmodulin-1 9606
164 6C1D 3 R Calmodulin 32644
165 6C1G 2 R Calmodulin 32644
166 6C1H 3 R Calmodulin 32644
167 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
168 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
169 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
170 5OEO 1 A Calmodulin-1 9606
171 5VMS 2 B Calmodulin 9606
172 5TP5 1 A Calmodulin 9606
173 5TP6 1 A Calmodulin 9606
174 5T0X 1 A Calmodulin 8355
175 5SY1 1 C, D Calmodulin 7108
176 5GGM 1 A Calmodulin 9606
177 5K7L 2 B Calmodulin 9606
178 5J8H 1 A Calmodulin 9606
179 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
180 2N8J 1 A Calmodulin 9606
181 2N27 1 A Calmodulin UNP residues 2-149 9606
182 2MGU 1 A Calmodulin 10116
183 2MG5 1 A Calmodulin UNP residues 2-149 9606
184 2MES 1 A Calmodulin 8355
185 3J41 2 E, F Calmodulin 9606
186 2M55 1 A Calmodulin 9606
187 2M3S 1 A Calmodulin UNP residues 1-149 9031
188 2M0J 1 A Calmodulin 9606
189 2M0K 1 A Calmodulin 9606
190 2LV6 1 A Calmodulin 9606
191 2LL6 1 A Calmodulin 9606
192 2LL7 1 A Calmodulin 9606
193 2LGF 1 A Calmodulin sequence database residues 4-149 9606
194 2L7L 1 A Calmodulin 9606
195 2L53 1 A Calmodulin calmodulin 9606
196 2KNE 1 A Calmodulin 9606
197 2KDU 1 A Calmodulin 8355
198 2K61 1 A Calmodulin 9606
199 2K0J 1 A calmodulin 9606
200 2K0E 1 A Calmodulin 9606
201 2K0F 1 A calmodulin 9606
202 2JZI 1 A Calmodulin 9606
203 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
204 1X02 1 A calmodulin 8355
205 1SY9 1 A CALMODULIN 8355
206 1NWD 1 A Calmodulin 8355
207 1CFF 1 A CALMODULIN 8355
208 1CKK 1 A Calmodulin-1 8355
209 1MUX 1 A CALMODULIN 8355
210 1DMO 1 A CALMODULIN 8355
211 1CFD 1 A CALMODULIN 8355
212 1CFC 1 A CALMODULIN 8355
213 2BBM 1 A CALMODULIN 7227
214 2BBN 1 A CALMODULIN 7227