Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 45106
95 % 53 178 90 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.6
PDBFlex
90 % 64 191 87
70 % 65 193 103
50 % 74 226 112
40 % 81 349 43
30 % 86 376 51

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 4J9Y 2 R Calmodulin 10116
14 2O60 1 A Calmodulin 9031
15 3IF7 1 A Calmodulin 9913
16 5NIN 1 A, B Calmodulin 9606
17 1QTX 1 A PROTEIN (CALMODULIN) 562
18 4G28 2 R Calmodulin 10116
19 4G27 2 R Calmodulin 10116
20 1G4Y 2 R CALMODULIN 10116
21 4J9Z 2 R Calmodulin 10116
22 2F3Z 1 A Calmodulin 9606
23 1PRW 1 A Calmodulin 9913
24 1OSA 1 A CALMODULIN 5888
25 5JQA 1 A Calmodulin 9606
26 1MXE 1 A, B Calmodulin 7227
27 1YR5 1 A calmodulin residues 1-148 9606
28 5JTH 1 A Calmodulin 9606
29 1CLL 1 A CALMODULIN 9606
30 2WEL 2 D CALMODULIN 9606
31 1N0Y 1 A, B Calmodulin 5888
32 3BYA 1 A Calmodulin 9606
33 1VRK 1 A CALMODULIN 32630
34 3SJQ 1 A, B Calmodulin 10116
35 5K8Q 1 A Calmodulin 9606
36 4EHQ 1 A Calmodulin 10116
37 1CLM 1 A CALMODULIN 5888
38 4BW7 1 A, C CALMODULIN 9606
39 1AHR 1 A CALMODULIN 9031
40 1IQ5 1 A CALMODULIN 8355
41 5WBX 2 R Calmodulin-1 9606
42 1CM4 1 A CALMODULIN 9913
43 1ZUZ 1 A calmodulin 9606
44 1QS7 1 A, C CALMODULIN 562
45 2Y4V 1 A CALMODULIN 9606
46 2HQW 1 A Calmodulin 10116
47 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
48 3SUI 1 A Calmodulin 9606
49 1UP5 1 A, B CALMODULIN 9031
50 4BW8 1 A, B CALMODULIN 9606
51 4QNH 2 R Calmodulin 10116
52 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
53 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
54 4Q5U 1 A Calmodulin 9606
55 4AQR 1 A, B CALMODULIN-7 3702
56 2BE6 1 A, B, C Calmodulin 2 9606
57 1CDL 1 A, B, C, D CALMODULIN 9606
58 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
59 4DBP 2 C Calmodulin 7227
60 4HEX 1 A, B Calmodulin 10090
61 4M1L 1 A Calmodulin UNP residues 2-149 9606
62 2BCX 1 A Calmodulin 9031
63 1LIN 1 A CALMODULIN 9913
64 3CLN 1 A CALMODULIN 10117
65 1IWQ 1 A CALMODULIN 9606
66 2V01 1 A CALMODULIN 9606
67 1WRZ 1 A calmodulin 9606
68 2YGG 2 B CALMODULIN 10116
69 1RFJ 1 A calmodulin 4113
70 3L9I 2 C Calmodulin 7227
71 1CM1 1 A CALMODULIN 9913
72 1NIW 1 A, C, E, G calmodulin 10116
73 4CLN 1 A CALMODULIN 7227
74 3G43 1 A, B, C, D Calmodulin 9606
75 1XA5 1 A Calmodulin 9913
76 1OOJ 1 A Calmodulin CMD-1 6239
77 2X0G 2 B CALMODULIN 9606
78 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
79 4DCK 2 B Calmodulin Calmodulin 9606
80 4PJJ 2 B Calmodulin 7227
81 4L79 2 B Calmodulin 9606
82 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
83 5WC5 2 R Calmodulin-1 9606
84 2X51 2 B CALMODULIN 7227
85 3BXL 1 A Calmodulin 10116
86 2VB6 2 B CALMODULIN 9031
87 5DBR 1 A Calmodulin 9606
88 3DVE 1 A Calmodulin 9606
89 4DBQ 2 B Calmodulin 7227
90 2BKH 2 B CALMODULIN 7227
91 2V02 1 A CALMODULIN 9606
92 1QIW 1 A, B CALMODULIN 9913
93 4ZLK 2 B Calmodulin 10090
94 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
95 3EWT 1 A Calmodulin 9606
96 2VAS 2 B CALMODULIN 7227
97 1Y6W 1 A Calmodulin 9606
98 1CTR 1 A CALMODULIN 9606
99 1L7Z 1 A CALMODULIN 9606
100 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
101 4BYF 2 B, D CALMODULIN 9606
102 3DVK 1 A Calmodulin 9606
103 3BXK 1 A, C Calmodulin 10116
104 1QIV 1 A CALMODULIN 9913
105 1A29 1 A CALMODULIN 9913
106 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
107 2FOT 1 A Calmodulin 9913
108 3HR4 2 B, D, F, H Calmodulin 9606
109 3GN4 2 B, D, F, H Calmodulin 7227
110 3EWV 1 A Calmodulin 9606
111 3OXQ 1 A, B, C, D Calmodulin 9606
112 1K90 2 D, E, F CALMODULIN 9606
113 4GOW 1 D Calmodulin 9606
114 4ANJ 2 B CALMODULIN 7227
115 4OVN 1 A, B, C, D, E Calmodulin 9606
116 5HIT 1 A Calmodulin 9031
117 5I0I 2 C Calmodulin 9606
118 5I0I 3 E Calmodulin 9606
119 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
120 4UMO 2 C, D CALMODULIN 9606
121 4JPZ 3 C, I Calmodulin 9606
122 1DEG 1 A CALMODULIN 9913
123 3DVJ 1 A Calmodulin 9606
124 3DVM 1 A Calmodulin 9606
125 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
126 2BKI 2 B, D CALMODULIN 9031
127 1S26 2 D, E, F Calmodulin 9606
128 1SK6 2 D, E, F Calmodulin 9606
129 1K93 2 D, E, F CALMODULIN 9606
130 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
131 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
132 4R8G 2 A, B, H Calmodulin 8355
133 1PK0 2 D, E, F Calmodulin 9606
134 1QX7 1 A, B, I, M, R Calmodulin 10116
135 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
136 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
137 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
138 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
139 4JQ0 2 C Calmodulin 9606
140 1LVC 2 D, E, F calmodulin 9606
141 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
142 6C1D 3 R Calmodulin 32644
143 6C1G 2 R Calmodulin 32644
144 6C1H 3 R Calmodulin 32644
145 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
146 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
147 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
148 5VMS 2 B Calmodulin 9606
149 5TP5 1 A Calmodulin 9606
150 5TP6 1 A Calmodulin 9606
151 5T0X 1 A Calmodulin 8355
152 5SY1 1 C, D Calmodulin 7108
153 5GGM 1 A Calmodulin 9606
154 5K7L 2 B Calmodulin 9606
155 5J8H 1 A Calmodulin 9606
156 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
157 2N8J 1 A Calmodulin 9606
158 2N27 1 A Calmodulin UNP residues 2-149 9606
159 2MGU 1 A Calmodulin 10116
160 2MG5 1 A Calmodulin UNP residues 2-149 9606
161 2MES 1 A Calmodulin 8355
162 3J41 2 E, F Calmodulin 9606
163 2M55 1 A Calmodulin 9606
164 2M3S 1 A Calmodulin UNP residues 1-149 9031
165 2M0J 1 A Calmodulin 9606
166 2M0K 1 A Calmodulin 9606
167 2LV6 1 A Calmodulin 9606
168 2LL6 1 A Calmodulin 9606
169 2LL7 1 A Calmodulin 9606
170 2LGF 1 A Calmodulin sequence database residues 4-149 9606
171 2L7L 1 A Calmodulin 9606
172 2L53 1 A Calmodulin calmodulin 9606
173 2KNE 1 A Calmodulin 9606
174 2KDU 1 A Calmodulin 8355
175 2K61 1 A Calmodulin 9606
176 2K0J 1 A calmodulin 9606
177 2K0E 1 A Calmodulin 9606
178 2K0F 1 A calmodulin 9606
179 2JZI 1 A Calmodulin 9606
180 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
181 1X02 1 A calmodulin 8355
182 1SY9 1 A CALMODULIN 8355
183 1NWD 1 A Calmodulin 8355
184 1CFF 1 A PROTEIN (CALMODULIN) 8355
185 1CKK 1 A PROTEIN (CALMODULIN) 8355
186 1MUX 1 A CALMODULIN 8355
187 1DMO 1 A CALMODULIN 8355
188 1CFD 1 A CALMODULIN 8355
189 1CFC 1 A CALMODULIN 8355
190 2BBM 1 A CALMODULIN 7227
191 2BBN 1 A CALMODULIN 7227