Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 186 60
95 % 55 190 79 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.6
PDBFlex
90 % 66 203 77
70 % 67 205 93
50 % 76 238 105
40 % 83 361 40
30 % 104 432 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 5V03 2 R Calmodulin 9606
17 3IF7 1 A Calmodulin 9913
18 5NIN 1 A, B Calmodulin 9606
19 1QTX 1 A PROTEIN (CALMODULIN) 562
20 4G28 2 R Calmodulin 10116
21 4G27 2 R Calmodulin 10116
22 1G4Y 2 R CALMODULIN 10116
23 4J9Z 2 R Calmodulin 10116
24 2F3Z 1 A Calmodulin 9606
25 1PRW 1 A Calmodulin 9913
26 1OSA 1 A CALMODULIN 5888
27 5JQA 1 A Calmodulin 9606
28 1MXE 1 A, B Calmodulin 7227
29 1NCX 1 A TROPONIN C 9031
30 1TOP 1 A TROPONIN C 9031
31 1YR5 1 A calmodulin residues 1-148 9606
32 5JTH 1 A Calmodulin 9606
33 1CLL 1 A CALMODULIN 9606
34 5V02 2 R Calmodulin-1 9606
35 1NCZ 1 A TROPONIN C 9031
36 2WEL 2 D CALMODULIN 9606
37 1N0Y 1 A, B Calmodulin 5888
38 3BYA 1 A Calmodulin 9606
39 1VRK 1 A CALMODULIN 32630
40 3SJQ 1 A, B Calmodulin 10116
41 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
42 1NCY 1 A TROPONIN C 9031
43 5K8Q 1 A Calmodulin 9606
44 4EHQ 1 A Calmodulin 10116
45 1CLM 1 A CALMODULIN 5888
46 5TNC 1 A TROPONIN-C 9103
47 4BW7 1 A, C CALMODULIN 9606
48 1AHR 1 A CALMODULIN 9031
49 1IQ5 1 A CALMODULIN 8355
50 5WBX 2 R Calmodulin-1 9606
51 1CM4 1 A CALMODULIN 9913
52 1ZUZ 1 A calmodulin 9606
53 4TNC 1 A TROPONIN C 9031
54 1QS7 1 A, C CALMODULIN 562
55 2Y4V 1 A CALMODULIN 9606
56 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
57 2HQW 1 A Calmodulin 10116
58 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
59 3SUI 1 A Calmodulin 9606
60 1UP5 1 A, B Calmodulin 9031
61 4BW8 1 A, B CALMODULIN 9606
62 4QNH 2 R Calmodulin 10116
63 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
64 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
65 4Q5U 1 A Calmodulin 9606
66 4AQR 1 A, B CALMODULIN-7 3702
67 2BE6 1 A, B, C Calmodulin 2 9606
68 1CDL 1 A, B, C, D CALMODULIN 9606
69 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
70 4DBP 2 C Calmodulin 7227
71 4HEX 1 A, B Calmodulin 10090
72 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
73 4M1L 1 A Calmodulin UNP residues 2-149 9606
74 2BCX 1 A Calmodulin 9031
75 1LIN 1 A CALMODULIN 9913
76 3CLN 1 A CALMODULIN 10117
77 1IWQ 1 A CALMODULIN 9606
78 2V01 1 A CALMODULIN 9606
79 1WRZ 1 A calmodulin 9606
80 2YGG 2 B CALMODULIN 10116
81 1RFJ 1 A calmodulin 4113
82 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
83 3L9I 2 C Calmodulin 7227
84 1CM1 1 A CALMODULIN 9913
85 4DS7 1 A, B, C, D Calmodulin 28985
86 1NIW 1 A, C, E, G calmodulin 10116
87 4CLN 1 A CALMODULIN 7227
88 3G43 1 A, B, C, D Calmodulin 9606
89 1XA5 1 A Calmodulin 9913
90 1OOJ 1 A Calmodulin CMD-1 6239
91 2X0G 2 B CALMODULIN 9606
92 1DTL 1 A CARDIAC TROPONIN C 9031
93 1TCF 1 A TROPONIN C 9986
94 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
95 6B8P 2 B, D, F, H Calmodulin-1 9606
96 4DCK 2 B Calmodulin Calmodulin 9606
97 4PJJ 2 B Calmodulin 7227
98 4L79 2 B Calmodulin 9606
99 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
100 5WC5 2 R Calmodulin-1 9606
101 2X51 2 B CALMODULIN 7227
102 6B8N 2 B, D, F, H Calmodulin-1 9606
103 6B8L 2 B, D, F, H Calmodulin-1 9606
104 3BXL 1 A Calmodulin 10116
105 2VB6 2 B CALMODULIN 9031
106 5DBR 1 A Calmodulin 9606
107 3DVE 1 A Calmodulin 9606
108 1A2X 1 A TROPONIN C 9986
109 4DBQ 2 B Calmodulin 7227
110 2BKH 2 B CALMODULIN 7227
111 2V02 1 A CALMODULIN 9606
112 6B8M 2 B, D, F, H Calmodulin-1 9606
113 1QIW 1 A, B CALMODULIN 9913
114 4ZLK 2 B Calmodulin 10090
115 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
116 3EWT 1 A Calmodulin 9606
117 2VAS 2 B CALMODULIN 7227
118 1Y6W 1 A Calmodulin 9606
119 1CTR 1 A CALMODULIN 9606
120 1L7Z 1 A CALMODULIN 9606
121 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
122 4BYF 2 B, D CALMODULIN 9606
123 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
124 3DVK 1 A Calmodulin 9606
125 3BXK 1 A, C Calmodulin 10116
126 1QIV 1 A CALMODULIN 9913
127 1A29 1 A CALMODULIN 9913
128 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
129 2FOT 1 A Calmodulin 9913
130 3HR4 2 B, D, F, H Calmodulin 9606
131 6B8Q 2 B, D, F, H Calmodulin-1 9606
132 3GN4 2 B, D, F, H Calmodulin 7227
133 3EWV 1 A Calmodulin 9606
134 3OXQ 1 A, B, C, D Calmodulin 9606
135 1K90 2 D, E, F CALMODULIN 9606
136 4GOW 1 D Calmodulin 9606
137 4ANJ 2 B CALMODULIN 7227
138 4OVN 1 A, B, C, D, E Calmodulin 9606
139 5HIT 1 A Calmodulin 9031
140 5V7X 2 B Calmodulin-1 9606
141 5I0I 2 C Calmodulin 9606
142 5I0I 3 E Calmodulin 9606
143 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
144 1J1D 1 A, D Troponin C 9606
145 4UMO 2 C, D CALMODULIN 9606
146 4JPZ 3 C, I Calmodulin 9606
147 1DEG 1 A CALMODULIN 9913
148 3DVJ 1 A Calmodulin 9606
149 3DVM 1 A Calmodulin 9606
150 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
151 2BKI 2 B, D CALMODULIN 9031
152 1S26 2 D, E, F Calmodulin 9606
153 1SK6 2 D, E, F Calmodulin 9606
154 1K93 2 D, E, F CALMODULIN 9606
155 1J1E 1 A, D Troponin C 9606
156 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
157 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
158 1YTZ 3 C Troponin C 9031
159 4R8G 2 A, B, H Calmodulin 8355
160 1PK0 2 D, E, F Calmodulin 9606
161 1QX7 1 A, B, I, M, R Calmodulin 10116
162 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
163 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
164 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
165 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
166 4JQ0 2 C Calmodulin 9606
167 1LVC 2 D, E, F calmodulin 9606
168 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
169 1YV0 3 C Troponin C, skeletal muscle 9031
170 6CNM 2 E, F, G, H Calmodulin-1 9606
171 6CNN 2 E, F, G, H Calmodulin-1 9606
172 6CNO 2 E, F, G, H Calmodulin-1 9606
173 6C1D 3 R Calmodulin 32644
174 6C1G 2 R Calmodulin 32644
175 6C1H 3 R Calmodulin 32644
176 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
177 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
178 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
179 5OEO 1 A Calmodulin-1 9606
180 5VMS 2 B Calmodulin 9606
181 5TP5 1 A Calmodulin 9606
182 5TP6 1 A Calmodulin 9606
183 5T0X 1 A Calmodulin 8355
184 5SY1 1 C, D Calmodulin 7108
185 5GGM 1 A Calmodulin 9606
186 5K7L 2 B Calmodulin 9606
187 5J8H 1 A Calmodulin 9606
188 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
189 2N8J 1 A Calmodulin 9606
190 2N27 1 A Calmodulin UNP residues 2-149 9606
191 2MGU 1 A Calmodulin 10116
192 2MG5 1 A Calmodulin UNP residues 2-149 9606
193 2MES 1 A Calmodulin 8355
194 3J41 2 E, F Calmodulin 9606
195 2M55 1 A Calmodulin 9606
196 2M3S 1 A Calmodulin UNP residues 1-149 9031
197 2M0J 1 A Calmodulin 9606
198 2M0K 1 A Calmodulin 9606
199 2LV6 1 A Calmodulin 9606
200 2LMT 1 A Calmodulin-related protein 97A 7227
201 2LMU 1 A Calmodulin-related protein 97A 7227
202 2LMV 1 A Calmodulin-related protein 97A 7227
203 2LL6 1 A Calmodulin 9606
204 2LL7 1 A Calmodulin 9606
205 2LGF 1 A Calmodulin sequence database residues 4-149 9606
206 2L7L 1 A Calmodulin 9606
207 2L53 1 A Calmodulin calmodulin 9606
208 2L1W 1 A Calmodulin 3847
209 2KNE 1 A Calmodulin 9606
210 2KDU 1 A Calmodulin 8355
211 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
212 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
213 2K61 1 A Calmodulin 9606
214 2K0J 1 A calmodulin 9606
215 2K0E 1 A Calmodulin 9606
216 2K0F 1 A calmodulin 9606
217 2JZI 1 A Calmodulin 9606
218 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
219 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
220 2JT3 1 A Troponin C 9606
221 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
222 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
223 1X02 1 A calmodulin 8355
224 1SY9 1 A CALMODULIN 8355
225 1NWD 1 A Calmodulin 8355
226 1LKJ 1 A Calmodulin 4932
227 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
228 1CFF 1 A PROTEIN (CALMODULIN) 8355
229 1CKK 1 A PROTEIN (CALMODULIN) 8355
230 1MUX 1 A CALMODULIN 8355
231 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
232 1DMO 1 A CALMODULIN 8355
233 1CFD 1 A CALMODULIN 8355
234 1TNW 1 A TROPONIN C 9031
235 1TNX 1 A TROPONIN C 9031
236 1CFC 1 A CALMODULIN 8355
237 2BBM 1 A CALMODULIN 7227
238 2BBN 1 A CALMODULIN 7227