Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 45106
95 % 53 178 90 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.6
PDBFlex
90 % 64 191 87
70 % 65 193 103
50 % 74 226 112
40 % 81 349 43
30 % 86 376 51

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 3IF7 1 A Calmodulin 9913
17 5NIN 1 A, B Calmodulin 9606
18 1QTX 1 A PROTEIN (CALMODULIN) 562
19 4G28 2 R Calmodulin 10116
20 4G27 2 R Calmodulin 10116
21 1G4Y 2 R CALMODULIN 10116
22 4J9Z 2 R Calmodulin 10116
23 2F3Z 1 A Calmodulin 9606
24 1PRW 1 A Calmodulin 9913
25 1OSA 1 A CALMODULIN 5888
26 5JQA 1 A Calmodulin 9606
27 1MXE 1 A, B Calmodulin 7227
28 1NCX 1 A TROPONIN C 9031
29 1TOP 1 A TROPONIN C 9031
30 1YR5 1 A calmodulin residues 1-148 9606
31 5JTH 1 A Calmodulin 9606
32 1CLL 1 A CALMODULIN 9606
33 1NCZ 1 A TROPONIN C 9031
34 2WEL 2 D CALMODULIN 9606
35 1N0Y 1 A, B Calmodulin 5888
36 3BYA 1 A Calmodulin 9606
37 1VRK 1 A CALMODULIN 32630
38 3SJQ 1 A, B Calmodulin 10116
39 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
40 1NCY 1 A TROPONIN C 9031
41 5K8Q 1 A Calmodulin 9606
42 4EHQ 1 A Calmodulin 10116
43 1CLM 1 A CALMODULIN 5888
44 5TNC 1 A TROPONIN-C 9103
45 4BW7 1 A, C CALMODULIN 9606
46 1AHR 1 A CALMODULIN 9031
47 1IQ5 1 A CALMODULIN 8355
48 5WBX 2 R Calmodulin-1 9606
49 1CM4 1 A CALMODULIN 9913
50 1ZUZ 1 A calmodulin 9606
51 4TNC 1 A TROPONIN C 9031
52 1QS7 1 A, C CALMODULIN 562
53 2Y4V 1 A CALMODULIN 9606
54 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
55 2HQW 1 A Calmodulin 10116
56 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
57 3SUI 1 A Calmodulin 9606
58 1UP5 1 A, B CALMODULIN 9031
59 4BW8 1 A, B CALMODULIN 9606
60 4QNH 2 R Calmodulin 10116
61 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
62 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
63 4Q5U 1 A Calmodulin 9606
64 4AQR 1 A, B CALMODULIN-7 3702
65 2BE6 1 A, B, C Calmodulin 2 9606
66 1CDL 1 A, B, C, D CALMODULIN 9606
67 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
68 4DBP 2 C Calmodulin 7227
69 4HEX 1 A, B Calmodulin 10090
70 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
71 4M1L 1 A Calmodulin UNP residues 2-149 9606
72 2BCX 1 A Calmodulin 9031
73 1LIN 1 A CALMODULIN 9913
74 3CLN 1 A CALMODULIN 10117
75 1IWQ 1 A CALMODULIN 9606
76 2V01 1 A CALMODULIN 9606
77 1WRZ 1 A calmodulin 9606
78 2YGG 2 B CALMODULIN 10116
79 1RFJ 1 A calmodulin 4113
80 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
81 3L9I 2 C Calmodulin 7227
82 1CM1 1 A CALMODULIN 9913
83 4DS7 1 A, B, C, D Calmodulin 28985
84 1NIW 1 A, C, E, G calmodulin 10116
85 4CLN 1 A CALMODULIN 7227
86 3G43 1 A, B, C, D Calmodulin 9606
87 1XA5 1 A Calmodulin 9913
88 1OOJ 1 A Calmodulin CMD-1 6239
89 2X0G 2 B CALMODULIN 9606
90 1DTL 1 A CARDIAC TROPONIN C 9031
91 1TCF 1 A TROPONIN C 9986
92 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
93 4DCK 2 B Calmodulin Calmodulin 9606
94 4PJJ 2 B Calmodulin 7227
95 4L79 2 B Calmodulin 9606
96 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
97 5WC5 2 R Calmodulin-1 9606
98 2X51 2 B CALMODULIN 7227
99 3BXL 1 A Calmodulin 10116
100 2VB6 2 B CALMODULIN 9031
101 5DBR 1 A Calmodulin 9606
102 3DVE 1 A Calmodulin 9606
103 1A2X 1 A TROPONIN C 9986
104 4DBQ 2 B Calmodulin 7227
105 2BKH 2 B CALMODULIN 7227
106 2V02 1 A CALMODULIN 9606
107 1QIW 1 A, B CALMODULIN 9913
108 4ZLK 2 B Calmodulin 10090
109 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
110 3EWT 1 A Calmodulin 9606
111 2VAS 2 B CALMODULIN 7227
112 1Y6W 1 A Calmodulin 9606
113 1CTR 1 A CALMODULIN 9606
114 1L7Z 1 A CALMODULIN 9606
115 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
116 4BYF 2 B, D CALMODULIN 9606
117 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
118 3DVK 1 A Calmodulin 9606
119 3BXK 1 A, C Calmodulin 10116
120 1QIV 1 A CALMODULIN 9913
121 1A29 1 A CALMODULIN 9913
122 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
123 2FOT 1 A Calmodulin 9913
124 3HR4 2 B, D, F, H Calmodulin 9606
125 3GN4 2 B, D, F, H Calmodulin 7227
126 3EWV 1 A Calmodulin 9606
127 3OXQ 1 A, B, C, D Calmodulin 9606
128 1K90 2 D, E, F CALMODULIN 9606
129 4GOW 1 D Calmodulin 9606
130 4ANJ 2 B CALMODULIN 7227
131 4OVN 1 A, B, C, D, E Calmodulin 9606
132 5HIT 1 A Calmodulin 9031
133 5I0I 2 C Calmodulin 9606
134 5I0I 3 E Calmodulin 9606
135 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
136 1J1D 1 A, D Troponin C 9606
137 4UMO 2 C, D CALMODULIN 9606
138 4JPZ 3 C, I Calmodulin 9606
139 1DEG 1 A CALMODULIN 9913
140 3DVJ 1 A Calmodulin 9606
141 3DVM 1 A Calmodulin 9606
142 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
143 2BKI 2 B, D CALMODULIN 9031
144 1S26 2 D, E, F Calmodulin 9606
145 1SK6 2 D, E, F Calmodulin 9606
146 1K93 2 D, E, F CALMODULIN 9606
147 1J1E 1 A, D Troponin C 9606
148 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
149 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
150 1YTZ 3 C Troponin C 9031
151 4R8G 2 A, B, H Calmodulin 8355
152 1PK0 2 D, E, F Calmodulin 9606
153 1QX7 1 A, B, I, M, R Calmodulin 10116
154 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
155 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
156 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
157 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
158 4JQ0 2 C Calmodulin 9606
159 1LVC 2 D, E, F calmodulin 9606
160 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
161 1YV0 3 C Troponin C, skeletal muscle 9031
162 6C1D 3 R Calmodulin 32644
163 6C1G 2 R Calmodulin 32644
164 6C1H 3 R Calmodulin 32644
165 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
166 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
167 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
168 5VMS 2 B Calmodulin 9606
169 5TP5 1 A Calmodulin 9606
170 5TP6 1 A Calmodulin 9606
171 5T0X 1 A Calmodulin 8355
172 5SY1 1 C, D Calmodulin 7108
173 5GGM 1 A Calmodulin 9606
174 5K7L 2 B Calmodulin 9606
175 5J8H 1 A Calmodulin 9606
176 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
177 2N8J 1 A Calmodulin 9606
178 2N27 1 A Calmodulin UNP residues 2-149 9606
179 2MGU 1 A Calmodulin 10116
180 2MG5 1 A Calmodulin UNP residues 2-149 9606
181 2MES 1 A Calmodulin 8355
182 3J41 2 E, F Calmodulin 9606
183 2M55 1 A Calmodulin 9606
184 2M3S 1 A Calmodulin UNP residues 1-149 9031
185 2M0J 1 A Calmodulin 9606
186 2M0K 1 A Calmodulin 9606
187 2LV6 1 A Calmodulin 9606
188 2LMT 1 A Calmodulin-related protein 97A 7227
189 2LMU 1 A Calmodulin-related protein 97A 7227
190 2LMV 1 A Calmodulin-related protein 97A 7227
191 2LL6 1 A Calmodulin 9606
192 2LL7 1 A Calmodulin 9606
193 2LGF 1 A Calmodulin sequence database residues 4-149 9606
194 2L7L 1 A Calmodulin 9606
195 2L53 1 A Calmodulin calmodulin 9606
196 2L1W 1 A Calmodulin 3847
197 2KNE 1 A Calmodulin 9606
198 2KDU 1 A Calmodulin 8355
199 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
200 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
201 2K61 1 A Calmodulin 9606
202 2K0J 1 A calmodulin 9606
203 2K0E 1 A Calmodulin 9606
204 2K0F 1 A calmodulin 9606
205 2JZI 1 A Calmodulin 9606
206 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
207 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
208 2JT3 1 A Troponin C 9606
209 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
210 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
211 1X02 1 A calmodulin 8355
212 1SY9 1 A CALMODULIN 8355
213 1NWD 1 A Calmodulin 8355
214 1LKJ 1 A Calmodulin 4932
215 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
216 1CFF 1 A PROTEIN (CALMODULIN) 8355
217 1CKK 1 A PROTEIN (CALMODULIN) 8355
218 1MUX 1 A CALMODULIN 8355
219 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
220 1DMO 1 A CALMODULIN 8355
221 1CFD 1 A CALMODULIN 8355
222 1TNW 1 A TROPONIN C 9031
223 1TNX 1 A TROPONIN C 9031
224 1CFC 1 A CALMODULIN 8355
225 2BBM 1 A CALMODULIN 7227
226 2BBN 1 A CALMODULIN 7227