Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 194 65
95 % 57 201 75 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 68 214 77
70 % 69 216 95
50 % 78 249 108
40 % 85 372 47
30 % 107 449 43

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 5V03 2 R Calmodulin 9606
17 3IF7 1 A Calmodulin 9913
18 6DAD 1 A, B Calmodulin-1 9606
19 5NIN 1 A, B Calmodulin 9606
20 1QTX 1 A PROTEIN (CALMODULIN) 562
21 4G28 2 R Calmodulin 10116
22 4G27 2 R Calmodulin 10116
23 1G4Y 2 R CALMODULIN 10116
24 4J9Z 2 R Calmodulin 10116
25 2F3Z 1 A Calmodulin 9606
26 1PRW 1 A Calmodulin 9913
27 1OSA 1 A CALMODULIN 5888
28 5JQA 1 A Calmodulin 9606
29 1MXE 1 A, B Calmodulin 7227
30 1NCX 1 A TROPONIN C 9031
31 1TOP 1 A TROPONIN C 9031
32 1YR5 1 A calmodulin residues 1-148 9606
33 5JTH 1 A Calmodulin 9606
34 1CLL 1 A CALMODULIN 9606
35 5V02 2 R Calmodulin-1 9606
36 1NCZ 1 A TROPONIN C 9031
37 2WEL 2 D CALMODULIN 9606
38 1N0Y 1 A, B Calmodulin 5888
39 3BYA 1 A Calmodulin 9606
40 1VRK 1 A CALMODULIN 32630
41 3SJQ 1 A, B Calmodulin 10116
42 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
43 1NCY 1 A TROPONIN C 9031
44 5K8Q 1 A Calmodulin 9606
45 4EHQ 1 A Calmodulin 10116
46 1CLM 1 A CALMODULIN 5888
47 5TNC 1 A TROPONIN-C 9103
48 4BW7 1 A, C CALMODULIN 9606
49 1AHR 1 A CALMODULIN 9031
50 1IQ5 1 A CALMODULIN 8355
51 5WBX 2 R Calmodulin-1 9606
52 1CM4 1 A CALMODULIN 9913
53 1ZUZ 1 A calmodulin 9606
54 4TNC 1 A TROPONIN C 9031
55 1QS7 1 A, C CALMODULIN 562
56 2Y4V 1 A CALMODULIN 9606
57 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
58 6DAE 1 A, B Calmodulin-1 9606
59 2HQW 1 A Calmodulin 10116
60 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
61 3SUI 1 A Calmodulin 9606
62 1UP5 1 A, B Calmodulin 9031
63 4BW8 1 A, B CALMODULIN 9606
64 4QNH 2 R Calmodulin 10116
65 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
66 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
67 4Q5U 1 A Calmodulin 9606
68 4AQR 1 A, B CALMODULIN-7 3702
69 2BE6 1 A, B, C Calmodulin 2 9606
70 1CDL 1 A, B, C, D CALMODULIN 9606
71 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
72 4DBP 2 C Calmodulin 7227
73 4HEX 1 A, B Calmodulin 10090
74 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
75 4M1L 1 A Calmodulin UNP residues 2-149 9606
76 2BCX 1 A Calmodulin 9031
77 1LIN 1 A CALMODULIN 9913
78 3CLN 1 A CALMODULIN 10117
79 1IWQ 1 A CALMODULIN 9606
80 2V01 1 A CALMODULIN 9606
81 1WRZ 1 A calmodulin 9606
82 2YGG 2 B CALMODULIN 10116
83 1RFJ 1 A calmodulin 4113
84 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
85 3L9I 2 C Calmodulin 7227
86 1CM1 1 A CALMODULIN 9913
87 4DS7 1 A, B, C, D Calmodulin 28985
88 1NIW 1 A, C, E, G calmodulin 10116
89 4CLN 1 A CALMODULIN 7227
90 3G43 1 A, B, C, D Calmodulin 9606
91 6CZQ 2 R Calmodulin-1 residues 5-148 10116
92 1XA5 1 A Calmodulin 9913
93 1OOJ 1 A Calmodulin CMD-1 6239
94 2X0G 2 B CALMODULIN 9606
95 1DTL 1 A CARDIAC TROPONIN C 9031
96 1TCF 1 A TROPONIN C 9986
97 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
98 6B8P 2 B, D, F, H Calmodulin-1 9606
99 4DCK 2 B Calmodulin Calmodulin 9606
100 4PJJ 2 B Calmodulin 7227
101 4L79 2 B Calmodulin 9606
102 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
103 5WC5 2 R Calmodulin-1 9606
104 2X51 2 B CALMODULIN 7227
105 6B8N 2 B, D, F, H Calmodulin-1 9606
106 6B8L 2 B, D, F, H Calmodulin-1 9606
107 3BXL 1 A Calmodulin 10116
108 2VB6 2 B CALMODULIN 9031
109 5DBR 1 A Calmodulin 9606
110 3DVE 1 A Calmodulin 9606
111 1A2X 1 A TROPONIN C 9986
112 4DBQ 2 B Calmodulin 7227
113 6DAF 1 A, B Calmodulin-1 9606
114 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
115 2BKH 2 B CALMODULIN 7227
116 2V02 1 A CALMODULIN 9606
117 6B8M 2 B, D, F, H Calmodulin-1 9606
118 1QIW 1 A, B CALMODULIN 9913
119 4ZLK 2 B Calmodulin 10090
120 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
121 3EWT 1 A Calmodulin 9606
122 2VAS 2 B CALMODULIN 7227
123 1Y6W 1 A Calmodulin 9606
124 1CTR 1 A CALMODULIN 9606
125 1L7Z 1 A CALMODULIN 9606
126 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
127 4BYF 2 B, D CALMODULIN 9606
128 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
129 6DAH 1 A, B, C, D Calmodulin-1 9606
130 3DVK 1 A Calmodulin 9606
131 3BXK 1 A, C Calmodulin 10116
132 1QIV 1 A CALMODULIN 9913
133 1A29 1 A CALMODULIN 9913
134 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
135 2FOT 1 A Calmodulin 9913
136 3HR4 2 B, D, F, H Calmodulin 9606
137 6B8Q 2 B, D, F, H Calmodulin-1 9606
138 3GN4 2 B, D, F, H Calmodulin 7227
139 3EWV 1 A Calmodulin 9606
140 3OXQ 1 A, B, C, D Calmodulin 9606
141 1K90 2 D, E, F CALMODULIN 9606
142 4GOW 1 D Calmodulin 9606
143 4ANJ 2 B CALMODULIN 7227
144 4OVN 1 A, B, C, D, E Calmodulin 9606
145 5HIT 1 A Calmodulin 9031
146 5V7X 2 B Calmodulin-1 9606
147 5I0I 2 C Calmodulin 9606
148 5I0I 3 E Calmodulin 9606
149 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
150 1J1D 1 A, D Troponin C 9606
151 4UMO 2 C, D CALMODULIN 9606
152 4JPZ 3 C, I Calmodulin 9606
153 1DEG 1 A CALMODULIN 9913
154 3DVJ 1 A Calmodulin 9606
155 3DVM 1 A Calmodulin 9606
156 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
157 2BKI 2 B, D CALMODULIN 9031
158 1S26 2 D, E, F Calmodulin 9606
159 1SK6 2 D, E, F Calmodulin 9606
160 1K93 2 D, E, F CALMODULIN 9606
161 1J1E 1 A, D Troponin C 9606
162 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
163 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
164 1YTZ 3 C Troponin C 9031
165 4R8G 2 A, B, H Calmodulin 8355
166 1PK0 2 D, E, F Calmodulin 9606
167 1QX7 1 A, B, I, M, R Calmodulin 10116
168 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
169 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
170 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
171 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
172 4JQ0 2 C Calmodulin 9606
173 1LVC 2 D, E, F calmodulin 9606
174 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
175 1YV0 3 C Troponin C, skeletal muscle 9031
176 6E2F 2 E Calmodulin-1 9606
177 6E2G 2 E Calmodulin-1 9606
178 6DMW 2 E Calmodulin-1 10116
179 6GDK 1 A Calmodulin-1 9606
180 6GDL 1 A Calmodulin-1 9606
181 6CNM 2 E, F, G, H Calmodulin-1 9606
182 6CNN 2 E, F, G, H Calmodulin-1 9606
183 6CNO 2 E, F, G, H Calmodulin-1 9606
184 6C1D 3 R Calmodulin 32644
185 6C1G 2 R Calmodulin 32644
186 6C1H 3 R Calmodulin 32644
187 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
188 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
189 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
190 5OEO 1 A Calmodulin-1 9606
191 5VMS 2 B Calmodulin 9606
192 5TP5 1 A Calmodulin 9606
193 5TP6 1 A Calmodulin 9606
194 5T0X 1 A Calmodulin 8355
195 5SY1 1 C, D Calmodulin 7108
196 5GGM 1 A Calmodulin 9606
197 5K7L 2 B Calmodulin 9606
198 5J8H 1 A Calmodulin 9606
199 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
200 2N8J 1 A Calmodulin 9606
201 2N27 1 A Calmodulin UNP residues 2-149 9606
202 2MGU 1 A Calmodulin 10116
203 2MG5 1 A Calmodulin UNP residues 2-149 9606
204 2MES 1 A Calmodulin 8355
205 3J41 2 E, F Calmodulin 9606
206 2M55 1 A Calmodulin 9606
207 2M3S 1 A Calmodulin UNP residues 1-149 9031
208 2M0J 1 A Calmodulin 9606
209 2M0K 1 A Calmodulin 9606
210 2LV6 1 A Calmodulin 9606
211 2LMT 1 A Calmodulin-related protein 97A 7227
212 2LMU 1 A Calmodulin-related protein 97A 7227
213 2LMV 1 A Calmodulin-related protein 97A 7227
214 2LL6 1 A Calmodulin 9606
215 2LL7 1 A Calmodulin 9606
216 2LGF 1 A Calmodulin sequence database residues 4-149 9606
217 2L7L 1 A Calmodulin 9606
218 2L53 1 A Calmodulin calmodulin 9606
219 2L1W 1 A Calmodulin 3847
220 2KNE 1 A Calmodulin 9606
221 2KDU 1 A Calmodulin 8355
222 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
223 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
224 2K61 1 A Calmodulin 9606
225 2K0J 1 A calmodulin 9606
226 2K0E 1 A Calmodulin 9606
227 2K0F 1 A calmodulin 9606
228 2JZI 1 A Calmodulin 9606
229 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
230 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
231 2JT3 1 A Troponin C 9606
232 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
233 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
234 1X02 1 A calmodulin 8355
235 1SY9 1 A CALMODULIN 8355
236 1NWD 1 A Calmodulin 8355
237 1LKJ 1 A Calmodulin 4932
238 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
239 1CFF 1 A CALMODULIN 8355
240 1CKK 1 A Calmodulin-1 8355
241 1MUX 1 A CALMODULIN 8355
242 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
243 1DMO 1 A CALMODULIN 8355
244 1CFD 1 A CALMODULIN 8355
245 1TNW 1 A TROPONIN C 9031
246 1TNX 1 A TROPONIN C 9031
247 1CFC 1 A CALMODULIN 8355
248 2BBM 1 A CALMODULIN 7227
249 2BBN 1 A CALMODULIN 7227