Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 188 62
95 % 55 192 80 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 66 205 77
70 % 67 207 93
50 % 76 240 107
40 % 83 363 44
30 % 104 434 44

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 5V03 2 R Calmodulin 9606
17 3IF7 1 A Calmodulin 9913
18 5NIN 1 A, B Calmodulin 9606
19 1QTX 1 A PROTEIN (CALMODULIN) 562
20 4G28 2 R Calmodulin 10116
21 4G27 2 R Calmodulin 10116
22 1M45 1 A Myosin light chain 4932
23 1G4Y 2 R CALMODULIN 10116
24 4J9Z 2 R Calmodulin 10116
25 2F3Z 1 A Calmodulin 9606
26 1PRW 1 A Calmodulin 9913
27 1OSA 1 A CALMODULIN 5888
28 5JQA 1 A Calmodulin 9606
29 1MXE 1 A, B Calmodulin 7227
30 1NCX 1 A TROPONIN C 9031
31 1TOP 1 A TROPONIN C 9031
32 1YR5 1 A calmodulin residues 1-148 9606
33 5JTH 1 A Calmodulin 9606
34 1CLL 1 A CALMODULIN 9606
35 5V02 2 R Calmodulin-1 9606
36 1NCZ 1 A TROPONIN C 9031
37 2WEL 2 D CALMODULIN 9606
38 1N0Y 1 A, B Calmodulin 5888
39 3BYA 1 A Calmodulin 9606
40 1VRK 1 A CALMODULIN 32630
41 3SJQ 1 A, B Calmodulin 10116
42 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
43 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
44 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
45 1NCY 1 A TROPONIN C 9031
46 5K8Q 1 A Calmodulin 9606
47 4EHQ 1 A Calmodulin 10116
48 1CLM 1 A CALMODULIN 5888
49 5TNC 1 A TROPONIN-C 9103
50 4BW7 1 A, C CALMODULIN 9606
51 1AHR 1 A CALMODULIN 9031
52 1IQ5 1 A CALMODULIN 8355
53 5WBX 2 R Calmodulin-1 9606
54 1CM4 1 A CALMODULIN 9913
55 1ZUZ 1 A calmodulin 9606
56 4TNC 1 A TROPONIN C 9031
57 1QS7 1 A, C CALMODULIN 562
58 2Y4V 1 A CALMODULIN 9606
59 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
60 2HQW 1 A Calmodulin 10116
61 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
62 3SUI 1 A Calmodulin 9606
63 1UP5 1 A, B Calmodulin 9031
64 4BW8 1 A, B CALMODULIN 9606
65 4QNH 2 R Calmodulin 10116
66 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
67 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
68 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
69 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
70 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
71 4Q5U 1 A Calmodulin 9606
72 4AQR 1 A, B CALMODULIN-7 3702
73 2BE6 1 A, B, C Calmodulin 2 9606
74 1N2D 1 A, B Myosin Light Chain 4932
75 1CDL 1 A, B, C, D CALMODULIN 9606
76 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
77 4DBP 2 C Calmodulin 7227
78 4HEX 1 A, B Calmodulin 10090
79 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
80 4M1L 1 A Calmodulin UNP residues 2-149 9606
81 2BCX 1 A Calmodulin 9031
82 1LIN 1 A CALMODULIN 9913
83 3CLN 1 A CALMODULIN 10117
84 1IWQ 1 A CALMODULIN 9606
85 1M46 1 A Myosin light chain 4932
86 2V01 1 A CALMODULIN 9606
87 1WRZ 1 A calmodulin 9606
88 2YGG 2 B CALMODULIN 10116
89 1RFJ 1 A calmodulin 4113
90 5W1A 2 B, D Myosin light chain alkali 7227
91 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
92 3L9I 2 C Calmodulin 7227
93 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
94 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
95 1CM1 1 A CALMODULIN 9913
96 4DS7 1 A, B, C, D Calmodulin 28985
97 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
98 1NIW 1 A, C, E, G calmodulin 10116
99 4CLN 1 A CALMODULIN 7227
100 3G43 1 A, B, C, D Calmodulin 9606
101 6CZQ 2 R Calmodulin-1 residues 5-148 10116
102 3PN7 2 B, E Myosin regulatory light chain 6577
103 3PN7 3 C, F Myosin essential light chain 6577
104 1XA5 1 A Calmodulin 9913
105 1OOJ 1 A Calmodulin CMD-1 6239
106 2X0G 2 B CALMODULIN 9606
107 1DTL 1 A CARDIAC TROPONIN C 9031
108 1TCF 1 A TROPONIN C 9986
109 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
110 6B8P 2 B, D, F, H Calmodulin-1 9606
111 4DCK 2 B Calmodulin Calmodulin 9606
112 4PJJ 2 B Calmodulin 7227
113 4L79 2 B Calmodulin 9606
114 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
115 5WC5 2 R Calmodulin-1 9606
116 2X51 2 B CALMODULIN 7227
117 6B8N 2 B, D, F, H Calmodulin-1 9606
118 6B8L 2 B, D, F, H Calmodulin-1 9606
119 2GGM 1 A, B Centrin-2 9606
120 3BXL 1 A Calmodulin 10116
121 3TS5 2 B, E Myosin regulatory light chain 6577
122 3TS5 3 C, F Myosin essential light chain 6577
123 2VB6 2 B CALMODULIN 9031
124 5DBR 1 A Calmodulin 9606
125 3DVE 1 A Calmodulin 9606
126 1A2X 1 A TROPONIN C 9986
127 4DBQ 2 B Calmodulin 7227
128 3FWB 1 A Cell division control protein 31 4932
129 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
130 2BKH 2 B CALMODULIN 7227
131 2V02 1 A CALMODULIN 9606
132 6B8M 2 B, D, F, H Calmodulin-1 9606
133 1QIW 1 A, B CALMODULIN 9913
134 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
135 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
136 4ZLK 2 B Calmodulin 10090
137 3TUY 2 B, E Myosin regulatory light chain 6577
138 3TUY 3 C, F Myosin essential light chain 6577
139 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
140 3EWT 1 A Calmodulin 9606
141 2VAS 2 B CALMODULIN 7227
142 1Y6W 1 A Calmodulin 9606
143 1CTR 1 A CALMODULIN 9606
144 1L7Z 1 A CALMODULIN 9606
145 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
146 4BYF 2 B, D CALMODULIN 9606
147 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
148 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
149 4MBE 1 A, D Cell division control protein 31 4932
150 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
151 3DVK 1 A Calmodulin 9606
152 3BXK 1 A, C Calmodulin 10116
153 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
154 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
155 1QIV 1 A CALMODULIN 9913
156 1A29 1 A CALMODULIN 9913
157 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
158 2FOT 1 A Calmodulin 9913
159 3HR4 2 B, D, F, H Calmodulin 9606
160 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
161 3QRX 1 A Centrin 3055
162 6B8Q 2 B, D, F, H Calmodulin-1 9606
163 3GN4 2 B, D, F, H Calmodulin 7227
164 3FWC 1 A, E, I, M Cell division control protein 31 4932
165 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
166 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
167 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
168 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
169 3EWV 1 A Calmodulin 9606
170 3OXQ 1 A, B, C, D Calmodulin 9606
171 1K90 2 D, E, F CALMODULIN 9606
172 4GOW 1 D Calmodulin 9606
173 4ANJ 2 B CALMODULIN 7227
174 4OVN 1 A, B, C, D, E Calmodulin 9606
175 5HIT 1 A Calmodulin 9031
176 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
177 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
178 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
179 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
180 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
181 5V7X 2 B Calmodulin-1 9606
182 5I0I 2 C Calmodulin 9606
183 5I0I 3 E Calmodulin 9606
184 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
185 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
186 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
187 1J1D 1 A, D Troponin C 9606
188 4UMO 2 C, D CALMODULIN 9606
189 4JPZ 3 C, I Calmodulin 9606
190 1DEG 1 A CALMODULIN 9913
191 3DVJ 1 A Calmodulin 9606
192 3DVM 1 A Calmodulin 9606
193 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
194 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
195 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
196 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
197 2BKI 2 B, D CALMODULIN 9031
198 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
199 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
200 2GV5 1 A, B, D, E Cell division control protein 31 4932
201 5D43 1 A, B Centrin-1 10090
202 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
203 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
204 2DOQ 1 A, B, C Cell division control protein 31 4932
205 1S26 2 D, E, F Calmodulin 9606
206 1SK6 2 D, E, F Calmodulin 9606
207 1K93 2 D, E, F CALMODULIN 9606
208 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
209 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
210 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
211 1J1E 1 A, D Troponin C 9606
212 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
213 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
214 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
215 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
216 2OTG 2 B Myosin regulatory light chain 6577
217 2OTG 3 C Myosin essential light chain 6577
218 1YTZ 3 C Troponin C 9031
219 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
220 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
221 4R8G 2 A, B, H Calmodulin 8355
222 1PK0 2 D, E, F Calmodulin 9606
223 1QX7 1 A, B, I, M, R Calmodulin 10116
224 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
225 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
226 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
227 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
228 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
229 2EC6 3 C Myosin essential light chain 6577
230 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
231 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
232 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
233 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
234 2OS8 3 C Myosin essential light chain Myosin ELC 6577
235 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
236 4JQ0 2 C Calmodulin 9606
237 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
238 1LVC 2 D, E, F calmodulin 9606
239 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
240 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
241 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
242 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
243 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
244 1YV0 3 C Troponin C, skeletal muscle 9031
245 6CNM 2 E, F, G, H Calmodulin-1 9606
246 6CNN 2 E, F, G, H Calmodulin-1 9606
247 6CNO 2 E, F, G, H Calmodulin-1 9606
248 6C1D 3 R Calmodulin 32644
249 6C1G 2 R Calmodulin 32644
250 6C1H 3 R Calmodulin 32644
251 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
252 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
253 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
254 5OEO 1 A Calmodulin-1 9606
255 5VMS 2 B Calmodulin 9606
256 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
257 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
258 5TP5 1 A Calmodulin 9606
259 5TP6 1 A Calmodulin 9606
260 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
261 5T0X 1 A Calmodulin 8355
262 5SY1 1 C, D Calmodulin 7108
263 5GGM 1 A Calmodulin 9606
264 5K7L 2 B Calmodulin 9606
265 5J8H 1 A Calmodulin 9606
266 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
267 2N8J 1 A Calmodulin 9606
268 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
269 3JAX 2 C, D smooth muscle myosin essential light chain 6183
270 2N27 1 A Calmodulin UNP residues 2-149 9606
271 2MGU 1 A Calmodulin 10116
272 2MG5 1 A Calmodulin UNP residues 2-149 9606
273 2MES 1 A Calmodulin 8355
274 3J41 2 E, F Calmodulin 9606
275 2M55 1 A Calmodulin 9606
276 2M3S 1 A Calmodulin UNP residues 1-149 9031
277 2M28 1 A Calcium-binding protein 4 10090
278 2M29 1 A Calcium-binding protein 4 10090
279 2M0J 1 A Calmodulin 9606
280 2M0K 1 A Calmodulin 9606
281 2LV6 1 A Calmodulin 9606
282 2LMT 1 A Calmodulin-related protein 97A 7227
283 2LMU 1 A Calmodulin-related protein 97A 7227
284 2LMV 1 A Calmodulin-related protein 97A 7227
285 2LL6 1 A Calmodulin 9606
286 2LL7 1 A Calmodulin 9606
287 2LGF 1 A Calmodulin sequence database residues 4-149 9606
288 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
289 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
290 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
291 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
292 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
293 2L7L 1 A Calmodulin 9606
294 2L53 1 A Calmodulin calmodulin 9606
295 2L1W 1 A Calmodulin 3847
296 2KNE 1 A Calmodulin 9606
297 2KDU 1 A Calmodulin 8355
298 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
299 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
300 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
301 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
302 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
303 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
304 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
305 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
306 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
307 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
308 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
309 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
310 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
311 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
312 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
313 2K61 1 A Calmodulin 9606
314 2K0J 1 A calmodulin 9606
315 2K0E 1 A Calmodulin 9606
316 2K0F 1 A calmodulin 9606
317 2JZI 1 A Calmodulin 9606
318 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
319 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
320 2JT3 1 A Troponin C 9606
321 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
322 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
323 1X02 1 A calmodulin 8355
324 1SY9 1 A CALMODULIN 8355
325 1NWD 1 A Calmodulin 8355
326 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
327 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
328 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
329 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
330 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
331 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
332 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
333 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
334 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
335 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
336 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
337 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
338 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
339 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
340 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
341 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
342 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
343 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
344 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
345 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
346 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
347 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
348 1LKJ 1 A Calmodulin 4932
349 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
350 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
351 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
352 1GGW 1 A PROTEIN (CDC4P) 4896
353 1CFF 1 A PROTEIN (CALMODULIN) 8355
354 1CKK 1 A Calmodulin-1 8355
355 1MUX 1 A CALMODULIN 8355
356 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
357 1DMO 1 A CALMODULIN 8355
358 1CFD 1 A CALMODULIN 8355
359 1TNW 1 A TROPONIN C 9031
360 1TNX 1 A TROPONIN C 9031
361 1CFC 1 A CALMODULIN 8355
362 2BBM 1 A CALMODULIN 7227
363 2BBN 1 A CALMODULIN 7227