Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 192 62
95 % 57 199 75 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 68 212 77
70 % 69 214 93
50 % 78 247 106
40 % 85 370 43
30 % 107 443 43

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 5V03 2 R Calmodulin 9606
17 3IF7 1 A Calmodulin 9913
18 6DAD 1 A, B Calmodulin-1 9606
19 5NIN 1 A, B Calmodulin 9606
20 1QTX 1 A PROTEIN (CALMODULIN) 562
21 4G28 2 R Calmodulin 10116
22 4G27 2 R Calmodulin 10116
23 1M45 1 A Myosin light chain 4932
24 1G4Y 2 R CALMODULIN 10116
25 4J9Z 2 R Calmodulin 10116
26 2F3Z 1 A Calmodulin 9606
27 1PRW 1 A Calmodulin 9913
28 1OSA 1 A CALMODULIN 5888
29 5JQA 1 A Calmodulin 9606
30 1MXE 1 A, B Calmodulin 7227
31 1NCX 1 A TROPONIN C 9031
32 1TOP 1 A TROPONIN C 9031
33 1YR5 1 A calmodulin residues 1-148 9606
34 5JTH 1 A Calmodulin 9606
35 1CLL 1 A CALMODULIN 9606
36 5V02 2 R Calmodulin-1 9606
37 1NCZ 1 A TROPONIN C 9031
38 2WEL 2 D CALMODULIN 9606
39 1N0Y 1 A, B Calmodulin 5888
40 3BYA 1 A Calmodulin 9606
41 1VRK 1 A CALMODULIN 32630
42 3SJQ 1 A, B Calmodulin 10116
43 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
44 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
45 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
46 1NCY 1 A TROPONIN C 9031
47 5K8Q 1 A Calmodulin 9606
48 4EHQ 1 A Calmodulin 10116
49 1CLM 1 A CALMODULIN 5888
50 5TNC 1 A TROPONIN-C 9103
51 4BW7 1 A, C CALMODULIN 9606
52 1AHR 1 A CALMODULIN 9031
53 1IQ5 1 A CALMODULIN 8355
54 5WBX 2 R Calmodulin-1 9606
55 1CM4 1 A CALMODULIN 9913
56 1ZUZ 1 A calmodulin 9606
57 4TNC 1 A TROPONIN C 9031
58 1QS7 1 A, C CALMODULIN 562
59 2Y4V 1 A CALMODULIN 9606
60 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
61 6DAE 1 A, B Calmodulin-1 9606
62 2HQW 1 A Calmodulin 10116
63 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
64 3SUI 1 A Calmodulin 9606
65 1UP5 1 A, B Calmodulin 9031
66 4BW8 1 A, B CALMODULIN 9606
67 4QNH 2 R Calmodulin 10116
68 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
69 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
70 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
71 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
72 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
73 4Q5U 1 A Calmodulin 9606
74 4AQR 1 A, B CALMODULIN-7 3702
75 2BE6 1 A, B, C Calmodulin 2 9606
76 1N2D 1 A, B Myosin Light Chain 4932
77 1CDL 1 A, B, C, D CALMODULIN 9606
78 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
79 4DBP 2 C Calmodulin 7227
80 4HEX 1 A, B Calmodulin 10090
81 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
82 4M1L 1 A Calmodulin UNP residues 2-149 9606
83 2BCX 1 A Calmodulin 9031
84 1LIN 1 A CALMODULIN 9913
85 3CLN 1 A CALMODULIN 10117
86 1IWQ 1 A CALMODULIN 9606
87 1M46 1 A Myosin light chain 4932
88 2V01 1 A CALMODULIN 9606
89 1WRZ 1 A calmodulin 9606
90 2YGG 2 B CALMODULIN 10116
91 1RFJ 1 A calmodulin 4113
92 5W1A 2 B, D Myosin light chain alkali 7227
93 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
94 3L9I 2 C Calmodulin 7227
95 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
96 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
97 1CM1 1 A CALMODULIN 9913
98 4DS7 1 A, B, C, D Calmodulin 28985
99 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
100 1NIW 1 A, C, E, G calmodulin 10116
101 4CLN 1 A CALMODULIN 7227
102 3G43 1 A, B, C, D Calmodulin 9606
103 6CZQ 2 R Calmodulin-1 residues 5-148 10116
104 3PN7 2 B, E Myosin regulatory light chain 6577
105 3PN7 3 C, F Myosin essential light chain 6577
106 1XA5 1 A Calmodulin 9913
107 1OOJ 1 A Calmodulin CMD-1 6239
108 2X0G 2 B CALMODULIN 9606
109 1DTL 1 A CARDIAC TROPONIN C 9031
110 1TCF 1 A TROPONIN C 9986
111 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
112 6B8P 2 B, D, F, H Calmodulin-1 9606
113 4DCK 2 B Calmodulin Calmodulin 9606
114 4PJJ 2 B Calmodulin 7227
115 4L79 2 B Calmodulin 9606
116 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
117 5WC5 2 R Calmodulin-1 9606
118 2X51 2 B CALMODULIN 7227
119 6B8N 2 B, D, F, H Calmodulin-1 9606
120 6B8L 2 B, D, F, H Calmodulin-1 9606
121 2GGM 1 A, B Centrin-2 9606
122 3BXL 1 A Calmodulin 10116
123 3TS5 2 B, E Myosin regulatory light chain 6577
124 3TS5 3 C, F Myosin essential light chain 6577
125 2VB6 2 B CALMODULIN 9031
126 5DBR 1 A Calmodulin 9606
127 3DVE 1 A Calmodulin 9606
128 1A2X 1 A TROPONIN C 9986
129 4DBQ 2 B Calmodulin 7227
130 6DAF 1 A, B Calmodulin-1 9606
131 3FWB 1 A Cell division control protein 31 4932
132 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
133 2BKH 2 B CALMODULIN 7227
134 2V02 1 A CALMODULIN 9606
135 6B8M 2 B, D, F, H Calmodulin-1 9606
136 1QIW 1 A, B CALMODULIN 9913
137 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
138 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
139 4ZLK 2 B Calmodulin 10090
140 3TUY 2 B, E Myosin regulatory light chain 6577
141 3TUY 3 C, F Myosin essential light chain 6577
142 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
143 3EWT 1 A Calmodulin 9606
144 2VAS 2 B CALMODULIN 7227
145 1Y6W 1 A Calmodulin 9606
146 1CTR 1 A CALMODULIN 9606
147 1L7Z 1 A CALMODULIN 9606
148 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
149 4BYF 2 B, D CALMODULIN 9606
150 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
151 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
152 4MBE 1 A, D Cell division control protein 31 4932
153 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
154 6DAH 1 A, B, C, D Calmodulin-1 9606
155 3DVK 1 A Calmodulin 9606
156 3BXK 1 A, C Calmodulin 10116
157 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
158 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
159 1QIV 1 A CALMODULIN 9913
160 1A29 1 A CALMODULIN 9913
161 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
162 2FOT 1 A Calmodulin 9913
163 3HR4 2 B, D, F, H Calmodulin 9606
164 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
165 3QRX 1 A Centrin 3055
166 6B8Q 2 B, D, F, H Calmodulin-1 9606
167 3GN4 2 B, D, F, H Calmodulin 7227
168 3FWC 1 A, E, I, M Cell division control protein 31 4932
169 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
170 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
171 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
172 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
173 3EWV 1 A Calmodulin 9606
174 3OXQ 1 A, B, C, D Calmodulin 9606
175 1K90 2 D, E, F CALMODULIN 9606
176 4GOW 1 D Calmodulin 9606
177 4ANJ 2 B CALMODULIN 7227
178 4OVN 1 A, B, C, D, E Calmodulin 9606
179 5HIT 1 A Calmodulin 9031
180 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
181 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
182 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
183 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
184 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
185 5V7X 2 B Calmodulin-1 9606
186 5I0I 2 C Calmodulin 9606
187 5I0I 3 E Calmodulin 9606
188 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
189 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
190 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
191 1J1D 1 A, D Troponin C 9606
192 4UMO 2 C, D CALMODULIN 9606
193 4JPZ 3 C, I Calmodulin 9606
194 1DEG 1 A CALMODULIN 9913
195 3DVJ 1 A Calmodulin 9606
196 3DVM 1 A Calmodulin 9606
197 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
198 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
199 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
200 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
201 2BKI 2 B, D CALMODULIN 9031
202 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
203 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
204 2GV5 1 A, B, D, E Cell division control protein 31 4932
205 5D43 1 A, B Centrin-1 10090
206 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
207 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
208 2DOQ 1 A, B, C Cell division control protein 31 4932
209 1S26 2 D, E, F Calmodulin 9606
210 1SK6 2 D, E, F Calmodulin 9606
211 1K93 2 D, E, F CALMODULIN 9606
212 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
213 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
214 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
215 1J1E 1 A, D Troponin C 9606
216 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
217 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
218 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
219 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
220 2OTG 2 B Myosin regulatory light chain 6577
221 2OTG 3 C Myosin essential light chain 6577
222 1YTZ 3 C Troponin C 9031
223 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
224 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
225 4R8G 2 A, B, H Calmodulin 8355
226 1PK0 2 D, E, F Calmodulin 9606
227 1QX7 1 A, B, I, M, R Calmodulin 10116
228 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
229 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
230 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
231 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
232 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
233 2EC6 3 C Myosin essential light chain 6577
234 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
235 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
236 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
237 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
238 2OS8 3 C Myosin essential light chain Myosin ELC 6577
239 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
240 4JQ0 2 C Calmodulin 9606
241 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
242 1LVC 2 D, E, F calmodulin 9606
243 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
244 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
245 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
246 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
247 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
248 1YV0 3 C Troponin C, skeletal muscle 9031
249 6E2F 2 E Calmodulin-1 9606
250 6E2G 2 E Calmodulin-1 9606
251 6GDK 1 A Calmodulin-1 9606
252 6CNM 2 E, F, G, H Calmodulin-1 9606
253 6CNN 2 E, F, G, H Calmodulin-1 9606
254 6CNO 2 E, F, G, H Calmodulin-1 9606
255 6C1D 3 R Calmodulin 32644
256 6C1G 2 R Calmodulin 32644
257 6C1H 3 R Calmodulin 32644
258 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
259 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
260 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
261 5OEO 1 A Calmodulin-1 9606
262 5VMS 2 B Calmodulin 9606
263 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
264 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
265 5TP5 1 A Calmodulin 9606
266 5TP6 1 A Calmodulin 9606
267 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
268 5T0X 1 A Calmodulin 8355
269 5SY1 1 C, D Calmodulin 7108
270 5GGM 1 A Calmodulin 9606
271 5K7L 2 B Calmodulin 9606
272 5J8H 1 A Calmodulin 9606
273 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
274 2N8J 1 A Calmodulin 9606
275 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
276 3JAX 2 C, D smooth muscle myosin essential light chain 6183
277 2N27 1 A Calmodulin UNP residues 2-149 9606
278 2MGU 1 A Calmodulin 10116
279 2MG5 1 A Calmodulin UNP residues 2-149 9606
280 2MES 1 A Calmodulin 8355
281 3J41 2 E, F Calmodulin 9606
282 2M55 1 A Calmodulin 9606
283 2M3S 1 A Calmodulin UNP residues 1-149 9031
284 2M28 1 A Calcium-binding protein 4 10090
285 2M29 1 A Calcium-binding protein 4 10090
286 2M0J 1 A Calmodulin 9606
287 2M0K 1 A Calmodulin 9606
288 2LV6 1 A Calmodulin 9606
289 2LMT 1 A Calmodulin-related protein 97A 7227
290 2LMU 1 A Calmodulin-related protein 97A 7227
291 2LMV 1 A Calmodulin-related protein 97A 7227
292 2LL6 1 A Calmodulin 9606
293 2LL7 1 A Calmodulin 9606
294 2LGF 1 A Calmodulin sequence database residues 4-149 9606
295 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
296 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
297 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
298 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
299 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
300 2L7L 1 A Calmodulin 9606
301 2L53 1 A Calmodulin calmodulin 9606
302 2L1W 1 A Calmodulin 3847
303 2KNE 1 A Calmodulin 9606
304 2KDU 1 A Calmodulin 8355
305 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
306 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
307 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
308 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
309 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
310 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
311 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
312 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
313 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
314 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
315 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
316 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
317 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
318 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
319 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
320 2K61 1 A Calmodulin 9606
321 2K0J 1 A calmodulin 9606
322 2K0E 1 A Calmodulin 9606
323 2K0F 1 A calmodulin 9606
324 2JZI 1 A Calmodulin 9606
325 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
326 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
327 2JT3 1 A Troponin C 9606
328 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
329 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
330 1X02 1 A calmodulin 8355
331 1SY9 1 A CALMODULIN 8355
332 1NWD 1 A Calmodulin 8355
333 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
334 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
335 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
336 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
337 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
338 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
339 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
340 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
341 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
342 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
343 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
344 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
345 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
346 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
347 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
348 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
349 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
350 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
351 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
352 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
353 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
354 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
355 1LKJ 1 A Calmodulin 4932
356 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
357 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
358 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
359 1GGW 1 A PROTEIN (CDC4P) 4896
360 1CFF 1 A CALMODULIN 8355
361 1CKK 1 A Calmodulin-1 8355
362 1MUX 1 A CALMODULIN 8355
363 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
364 1DMO 1 A CALMODULIN 8355
365 1CFD 1 A CALMODULIN 8355
366 1TNW 1 A TROPONIN C 9031
367 1TNX 1 A TROPONIN C 9031
368 1CFC 1 A CALMODULIN 8355
369 2BBM 1 A CALMODULIN 7227
370 2BBN 1 A CALMODULIN 7227