Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 186 60
95 % 55 190 79 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.6
PDBFlex
90 % 66 203 77
70 % 67 205 93
50 % 76 238 105
40 % 83 361 40
30 % 104 432 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 5V03 2 R Calmodulin 9606
17 3IF7 1 A Calmodulin 9913
18 5NIN 1 A, B Calmodulin 9606
19 1QTX 1 A PROTEIN (CALMODULIN) 562
20 4G28 2 R Calmodulin 10116
21 4G27 2 R Calmodulin 10116
22 1M45 1 A Myosin light chain 4932
23 1G4Y 2 R CALMODULIN 10116
24 4J9Z 2 R Calmodulin 10116
25 2F3Z 1 A Calmodulin 9606
26 1PRW 1 A Calmodulin 9913
27 1OSA 1 A CALMODULIN 5888
28 5JQA 1 A Calmodulin 9606
29 1MXE 1 A, B Calmodulin 7227
30 1NCX 1 A TROPONIN C 9031
31 1TOP 1 A TROPONIN C 9031
32 1YR5 1 A calmodulin residues 1-148 9606
33 5JTH 1 A Calmodulin 9606
34 1CLL 1 A CALMODULIN 9606
35 5V02 2 R Calmodulin-1 9606
36 1NCZ 1 A TROPONIN C 9031
37 2WEL 2 D CALMODULIN 9606
38 1N0Y 1 A, B Calmodulin 5888
39 3BYA 1 A Calmodulin 9606
40 1VRK 1 A CALMODULIN 32630
41 3SJQ 1 A, B Calmodulin 10116
42 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
43 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
44 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
45 1NCY 1 A TROPONIN C 9031
46 5K8Q 1 A Calmodulin 9606
47 4EHQ 1 A Calmodulin 10116
48 1CLM 1 A CALMODULIN 5888
49 5TNC 1 A TROPONIN-C 9103
50 4BW7 1 A, C CALMODULIN 9606
51 1AHR 1 A CALMODULIN 9031
52 1IQ5 1 A CALMODULIN 8355
53 5WBX 2 R Calmodulin-1 9606
54 1CM4 1 A CALMODULIN 9913
55 1ZUZ 1 A calmodulin 9606
56 4TNC 1 A TROPONIN C 9031
57 1QS7 1 A, C CALMODULIN 562
58 2Y4V 1 A CALMODULIN 9606
59 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
60 2HQW 1 A Calmodulin 10116
61 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
62 3SUI 1 A Calmodulin 9606
63 1UP5 1 A, B Calmodulin 9031
64 4BW8 1 A, B CALMODULIN 9606
65 4QNH 2 R Calmodulin 10116
66 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
67 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
68 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
69 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
70 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
71 4Q5U 1 A Calmodulin 9606
72 4AQR 1 A, B CALMODULIN-7 3702
73 2BE6 1 A, B, C Calmodulin 2 9606
74 1N2D 1 A, B Myosin Light Chain 4932
75 1CDL 1 A, B, C, D CALMODULIN 9606
76 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
77 4DBP 2 C Calmodulin 7227
78 4HEX 1 A, B Calmodulin 10090
79 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
80 4M1L 1 A Calmodulin UNP residues 2-149 9606
81 2BCX 1 A Calmodulin 9031
82 1LIN 1 A CALMODULIN 9913
83 3CLN 1 A CALMODULIN 10117
84 1IWQ 1 A CALMODULIN 9606
85 1M46 1 A Myosin light chain 4932
86 2V01 1 A CALMODULIN 9606
87 1WRZ 1 A calmodulin 9606
88 2YGG 2 B CALMODULIN 10116
89 1RFJ 1 A calmodulin 4113
90 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
91 3L9I 2 C Calmodulin 7227
92 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
93 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
94 1CM1 1 A CALMODULIN 9913
95 4DS7 1 A, B, C, D Calmodulin 28985
96 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
97 1NIW 1 A, C, E, G calmodulin 10116
98 4QBD 2 B, D Myosin light chain alkali endogenous indirect flight muscle isoform 7227
99 4CLN 1 A CALMODULIN 7227
100 3G43 1 A, B, C, D Calmodulin 9606
101 3PN7 2 B, E Myosin regulatory light chain 6577
102 3PN7 3 C, F Myosin essential light chain 6577
103 1XA5 1 A Calmodulin 9913
104 1OOJ 1 A Calmodulin CMD-1 6239
105 2X0G 2 B CALMODULIN 9606
106 1DTL 1 A CARDIAC TROPONIN C 9031
107 1TCF 1 A TROPONIN C 9986
108 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
109 6B8P 2 B, D, F, H Calmodulin-1 9606
110 4DCK 2 B Calmodulin Calmodulin 9606
111 4PJJ 2 B Calmodulin 7227
112 4L79 2 B Calmodulin 9606
113 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
114 5WC5 2 R Calmodulin-1 9606
115 2X51 2 B CALMODULIN 7227
116 6B8N 2 B, D, F, H Calmodulin-1 9606
117 6B8L 2 B, D, F, H Calmodulin-1 9606
118 2GGM 1 A, B Centrin-2 9606
119 3BXL 1 A Calmodulin 10116
120 3TS5 2 B, E Myosin regulatory light chain 6577
121 3TS5 3 C, F Myosin essential light chain 6577
122 2VB6 2 B CALMODULIN 9031
123 5DBR 1 A Calmodulin 9606
124 3DVE 1 A Calmodulin 9606
125 1A2X 1 A TROPONIN C 9986
126 4DBQ 2 B Calmodulin 7227
127 3FWB 1 A Cell division control protein 31 4932
128 2BKH 2 B CALMODULIN 7227
129 2V02 1 A CALMODULIN 9606
130 6B8M 2 B, D, F, H Calmodulin-1 9606
131 1QIW 1 A, B CALMODULIN 9913
132 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
133 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
134 4ZLK 2 B Calmodulin 10090
135 3TUY 2 B, E Myosin regulatory light chain 6577
136 3TUY 3 C, F Myosin essential light chain 6577
137 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
138 3EWT 1 A Calmodulin 9606
139 2VAS 2 B CALMODULIN 7227
140 1Y6W 1 A Calmodulin 9606
141 1CTR 1 A CALMODULIN 9606
142 1L7Z 1 A CALMODULIN 9606
143 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
144 4BYF 2 B, D CALMODULIN 9606
145 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
146 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
147 4MBE 1 A, D Cell division control protein 31 4932
148 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
149 3DVK 1 A Calmodulin 9606
150 3BXK 1 A, C Calmodulin 10116
151 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
152 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
153 1QIV 1 A CALMODULIN 9913
154 1A29 1 A CALMODULIN 9913
155 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
156 2FOT 1 A Calmodulin 9913
157 3HR4 2 B, D, F, H Calmodulin 9606
158 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
159 3QRX 1 A Centrin 3055
160 6B8Q 2 B, D, F, H Calmodulin-1 9606
161 3GN4 2 B, D, F, H Calmodulin 7227
162 3FWC 1 A, E, I, M Cell division control protein 31 4932
163 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
164 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
165 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
166 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
167 3EWV 1 A Calmodulin 9606
168 3OXQ 1 A, B, C, D Calmodulin 9606
169 1K90 2 D, E, F CALMODULIN 9606
170 4GOW 1 D Calmodulin 9606
171 4ANJ 2 B CALMODULIN 7227
172 4OVN 1 A, B, C, D, E Calmodulin 9606
173 5HIT 1 A Calmodulin 9031
174 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
175 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
176 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
177 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
178 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
179 5V7X 2 B Calmodulin-1 9606
180 5I0I 2 C Calmodulin 9606
181 5I0I 3 E Calmodulin 9606
182 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
183 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
184 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
185 1J1D 1 A, D Troponin C 9606
186 4UMO 2 C, D CALMODULIN 9606
187 4JPZ 3 C, I Calmodulin 9606
188 1DEG 1 A CALMODULIN 9913
189 3DVJ 1 A Calmodulin 9606
190 3DVM 1 A Calmodulin 9606
191 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
192 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
193 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
194 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
195 2BKI 2 B, D CALMODULIN 9031
196 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
197 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
198 2GV5 1 A, B, D, E Cell division control protein 31 4932
199 5D43 1 A, B Centrin-1 10090
200 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
201 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
202 2DOQ 1 A, B, C Cell division control protein 31 4932
203 1S26 2 D, E, F Calmodulin 9606
204 1SK6 2 D, E, F Calmodulin 9606
205 1K93 2 D, E, F CALMODULIN 9606
206 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
207 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
208 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
209 1J1E 1 A, D Troponin C 9606
210 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
211 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
212 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
213 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
214 2OTG 2 B Myosin regulatory light chain 6577
215 2OTG 3 C Myosin essential light chain 6577
216 1YTZ 3 C Troponin C 9031
217 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
218 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
219 4R8G 2 A, B, H Calmodulin 8355
220 1PK0 2 D, E, F Calmodulin 9606
221 1QX7 1 A, B, I, M, R Calmodulin 10116
222 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
223 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
224 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
225 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
226 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
227 2EC6 3 C Myosin essential light chain 6577
228 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
229 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
230 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
231 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
232 2OS8 3 C Myosin essential light chain Myosin ELC 6577
233 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
234 4JQ0 2 C Calmodulin 9606
235 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
236 1LVC 2 D, E, F calmodulin 9606
237 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
238 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
239 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
240 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
241 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
242 1YV0 3 C Troponin C, skeletal muscle 9031
243 6CNM 2 E, F, G, H Calmodulin-1 9606
244 6CNN 2 E, F, G, H Calmodulin-1 9606
245 6CNO 2 E, F, G, H Calmodulin-1 9606
246 6C1D 3 R Calmodulin 32644
247 6C1G 2 R Calmodulin 32644
248 6C1H 3 R Calmodulin 32644
249 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
250 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
251 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
252 5OEO 1 A Calmodulin-1 9606
253 5VMS 2 B Calmodulin 9606
254 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
255 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
256 5TP5 1 A Calmodulin 9606
257 5TP6 1 A Calmodulin 9606
258 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
259 5T0X 1 A Calmodulin 8355
260 5SY1 1 C, D Calmodulin 7108
261 5GGM 1 A Calmodulin 9606
262 5K7L 2 B Calmodulin 9606
263 5J8H 1 A Calmodulin 9606
264 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
265 2N8J 1 A Calmodulin 9606
266 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
267 3JAX 2 C, D smooth muscle myosin essential light chain 6183
268 2N27 1 A Calmodulin UNP residues 2-149 9606
269 2MGU 1 A Calmodulin 10116
270 2MG5 1 A Calmodulin UNP residues 2-149 9606
271 2MES 1 A Calmodulin 8355
272 3J41 2 E, F Calmodulin 9606
273 2M55 1 A Calmodulin 9606
274 2M3S 1 A Calmodulin UNP residues 1-149 9031
275 2M28 1 A Calcium-binding protein 4 10090
276 2M29 1 A Calcium-binding protein 4 10090
277 2M0J 1 A Calmodulin 9606
278 2M0K 1 A Calmodulin 9606
279 2LV6 1 A Calmodulin 9606
280 2LMT 1 A Calmodulin-related protein 97A 7227
281 2LMU 1 A Calmodulin-related protein 97A 7227
282 2LMV 1 A Calmodulin-related protein 97A 7227
283 2LL6 1 A Calmodulin 9606
284 2LL7 1 A Calmodulin 9606
285 2LGF 1 A Calmodulin sequence database residues 4-149 9606
286 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
287 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
288 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
289 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
290 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
291 2L7L 1 A Calmodulin 9606
292 2L53 1 A Calmodulin calmodulin 9606
293 2L1W 1 A Calmodulin 3847
294 2KNE 1 A Calmodulin 9606
295 2KDU 1 A Calmodulin 8355
296 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
297 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
298 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
299 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
300 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
301 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
302 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
303 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
304 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
305 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
306 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
307 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
308 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
309 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
310 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
311 2K61 1 A Calmodulin 9606
312 2K0J 1 A calmodulin 9606
313 2K0E 1 A Calmodulin 9606
314 2K0F 1 A calmodulin 9606
315 2JZI 1 A Calmodulin 9606
316 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
317 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
318 2JT3 1 A Troponin C 9606
319 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
320 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
321 1X02 1 A calmodulin 8355
322 1SY9 1 A CALMODULIN 8355
323 1NWD 1 A Calmodulin 8355
324 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
325 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
326 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
327 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
328 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
329 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
330 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
331 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
332 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
333 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
334 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
335 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
336 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
337 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
338 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
339 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
340 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
341 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
342 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
343 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
344 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
345 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
346 1LKJ 1 A Calmodulin 4932
347 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
348 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
349 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
350 1GGW 1 A PROTEIN (CDC4P) 4896
351 1CFF 1 A PROTEIN (CALMODULIN) 8355
352 1CKK 1 A PROTEIN (CALMODULIN) 8355
353 1MUX 1 A CALMODULIN 8355
354 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
355 1DMO 1 A CALMODULIN 8355
356 1CFD 1 A CALMODULIN 8355
357 1TNW 1 A TROPONIN C 9031
358 1TNX 1 A TROPONIN C 9031
359 1CFC 1 A CALMODULIN 8355
360 2BBM 1 A CALMODULIN 7227
361 2BBN 1 A CALMODULIN 7227