Sequence Similarity Clusters for the Entities in PDB 3CLN

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 54 188 62
95 % 55 192 80 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 66 205 77
70 % 67 207 93
50 % 76 240 107
40 % 83 363 44
30 % 104 434 44

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4YI8 1 A Recoverin 9913
7 4YI9 1 A Recoverin 9913
8 4DJC 1 A Calmodulin 9606
9 3GOF 1 A, B Calmodulin 9031
10 3GP2 1 A Calmodulin 9031
11 4LZX 1 A Calmodulin UNP residues 2-149 9606
12 2W73 1 A, B, E, F CALMODULIN 9606
13 2F3Y 1 A Calmodulin 9606
14 4MLW 1 A Recoverin 9913
15 5DOW 1 A, C, E, G Calmodulin 9606
16 4M2P 1 A Recoverin 9913
17 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
18 4M2O 1 A Recoverin 9913
19 4J9Y 2 R Calmodulin 10116
20 5G08 1 A FREQUENIN 2 7227
21 2O60 1 A Calmodulin 9031
22 5AAN 1 A CG5907-PA, ISOFORM A 7227
23 5V03 2 R Calmodulin 9606
24 3IF7 1 A Calmodulin 9913
25 4F0Z 2 B Calcineurin subunit B type 1 Calcineurin B Subunit 9606 3.1.3.16 | Details
26 5NIN 1 A, B Calmodulin 9606
27 1QTX 1 A PROTEIN (CALMODULIN) 562
28 4G28 2 R Calmodulin 10116
29 1OMR 1 A recoverin 9913
30 4G27 2 R Calmodulin 10116
31 1M45 1 A Myosin light chain 4932
32 1G4Y 2 R CALMODULIN 10116
33 4J9Z 2 R Calmodulin 10116
34 2F3Z 1 A Calmodulin 9606
35 1PRW 1 A Calmodulin 9913
36 1OSA 1 A CALMODULIN 5888
37 5JQA 1 A Calmodulin 9606
38 1MXE 1 A, B Calmodulin 7227
39 1NCX 1 A TROPONIN C 9031
40 1TOP 1 A TROPONIN C 9031
41 5B8I 2 B Calcineurin subunit B, variant 5501
42 1YR5 1 A calmodulin residues 1-148 9606
43 5JTH 1 A Calmodulin 9606
44 1CLL 1 A CALMODULIN 9606
45 4GUK 1 A, B, C, D Neuronal calcium sensor 1 9606
46 5V02 2 R Calmodulin-1 9606
47 1NCZ 1 A TROPONIN C 9031
48 2WEL 2 D CALMODULIN 9606
49 1N0Y 1 A, B Calmodulin 5888
50 3BYA 1 A Calmodulin 9606
51 1VRK 1 A CALMODULIN 32630
52 3SJQ 1 A, B Calmodulin 10116
53 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
54 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
55 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
56 1NCY 1 A TROPONIN C 9031
57 5K8Q 1 A Calmodulin 9606
58 4EHQ 1 A Calmodulin 10116
59 1CLM 1 A CALMODULIN 5888
60 5TNC 1 A TROPONIN-C 9103
61 4BW7 1 A, C CALMODULIN 9606
62 1AHR 1 A CALMODULIN 9031
63 1IQ5 1 A CALMODULIN 8355
64 5WBX 2 R Calmodulin-1 9606
65 4M2Q 1 A Recoverin 9913
66 1REC 1 A RECOVERIN 9913
67 1CM4 1 A CALMODULIN 9913
68 1ZUZ 1 A calmodulin 9606
69 4TNC 1 A TROPONIN C 9031
70 1QS7 1 A, C CALMODULIN 562
71 5FYX 1 A FREQUENIN 2 7227
72 2Y4V 1 A CALMODULIN 9606
73 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
74 3LL8 3 B, D Calcineurin subunit B type 1 UNP residues 16-170 9606
75 2HQW 1 A Calmodulin 10116
76 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
77 3SUI 1 A Calmodulin 9606
78 1UP5 1 A, B Calmodulin 9031
79 4BW8 1 A, B CALMODULIN 9606
80 3WFN 1 B, C, D, E Calmodulin, Sodium channel protein type 8 subunit alpha CHIMERA PROTEIN OF CALMODULIN (UNIPROT P62204 CALM_MOUSE) AND NAV1.6 IQ MOTIF FROM SODIUM CHANNEL PROTEIN TYPE 8 SUBUNIT ALPHA (UNIPROT Q9WTU3 SCN8A_MOUSE, RESIDUES 1893-1914) 10090
81 4QNH 2 R Calmodulin 10116
82 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
83 1G8I 1 A, B NEURONAL CALCIUM SENSOR 1 9606
84 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
85 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
86 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
87 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
88 4Q5U 1 A Calmodulin 9606
89 4AQR 1 A, B CALMODULIN-7 3702
90 2BE6 1 A, B, C Calmodulin 2 9606
91 1S6C 1 A Kv4 potassium channel-interacting protein KChIP1b Core domain (Residues 34-216) 10116
92 1N2D 1 A, B Myosin Light Chain 4932
93 1CDL 1 A, B, C, D CALMODULIN 9606
94 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
95 4DBP 2 C Calmodulin 7227
96 1AUI 2 B SERINE/THREONINE PHOSPHATASE 2B 9606 3.1.3.16 | Details
97 4HEX 1 A, B Calmodulin 10090
98 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
99 4M1L 1 A Calmodulin UNP residues 2-149 9606
100 5AEQ 1 A, B NEURONAL CALCIUM SENSOR 1 10116
101 1OMV 1 A recoverin 9913
102 2BCX 1 A Calmodulin 9031
103 1LIN 1 A CALMODULIN 9913
104 3CLN 1 A CALMODULIN 10117
105 1IWQ 1 A CALMODULIN 9606
106 1M46 1 A Myosin light chain 4932
107 2V01 1 A CALMODULIN 9606
108 1WRZ 1 A calmodulin 9606
109 2YGG 2 B CALMODULIN 10116
110 1UHN 1 A calcineurin B-like protein 2 residues 32-220 3702
111 1RFJ 1 A calmodulin 4113
112 5W1A 2 B, D Myosin light chain alkali 7227
113 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
114 3L9I 2 C Calmodulin 7227
115 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
116 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
117 1CM1 1 A CALMODULIN 9913
118 4DS7 1 A, B, C, D Calmodulin 28985
119 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
120 2D8N 1 A Recoverin 9606
121 1NIW 1 A, C, E, G calmodulin 10116
122 4OR9 2 B Calcineurin subunit B type 1 regulatory subunit 9606
123 2EHB 1 A Calcineurin B-like protein 4 residues in database 1-207 3702
124 4CLN 1 A CALMODULIN 7227
125 3G43 1 A, B, C, D Calmodulin 9606
126 6CZQ 2 R Calmodulin-1 residues 5-148 10116
127 3PN7 2 B, E Myosin regulatory light chain 6577
128 3PN7 3 C, F Myosin essential light chain 6577
129 1XA5 1 A Calmodulin 9913
130 1OOJ 1 A Calmodulin CMD-1 6239
131 2X0G 2 B CALMODULIN 9606
132 1DTL 1 A CARDIAC TROPONIN C 9031
133 2F2O 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
134 1TCF 1 A TROPONIN C 9986
135 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
136 6B8P 2 B, D, F, H Calmodulin-1 9606
137 4DCK 2 B Calmodulin Calmodulin 9606
138 2P6B 3 B, D Calcineurin subunit B isoform 1 Residues 16-170 9606
139 4PJJ 2 B Calmodulin 7227
140 4L79 2 B Calmodulin 9606
141 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
142 5WC5 2 R Calmodulin-1 9606
143 4BY5 1 A, B, C, D FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
144 5AER 1 A NEURONAL CALCIUM SENSOR 1 10116
145 2CT9 1 A, B Calcium-binding protein p22 10116
146 2X51 2 B CALMODULIN 7227
147 6B8N 2 B, D, F, H Calmodulin-1 9606
148 6B8L 2 B, D, F, H Calmodulin-1 9606
149 2GGM 1 A, B Centrin-2 9606
150 3BXL 1 A Calmodulin 10116
151 3TS5 2 B, E Myosin regulatory light chain 6577
152 3TS5 3 C, F Myosin essential light chain 6577
153 2VB6 2 B CALMODULIN 9031
154 5DBR 1 A Calmodulin 9606
155 4BY4 1 A, B FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
156 3DVE 1 A Calmodulin 9606
157 1A2X 1 A TROPONIN C 9986
158 4DBQ 2 B Calmodulin 7227
159 3FWB 1 A Cell division control protein 31 4932
160 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
161 2BKH 2 B CALMODULIN 7227
162 2V02 1 A CALMODULIN 9606
163 5AFP 1 A, B NEURONAL CALCIUM SENSOR 1 10116
164 6B8M 2 B, D, F, H Calmodulin-1 9606
165 1TCO 2 B SERINE/THREONINE PHOSPHATASE B2 CHAIN A IS THE CATALYTIC SUBUNIT, RESIDUES 18 -392. CHAIN B IS THE REGULATORY SUBUNIT, RESIDUES 1 - 169 9913 3.1.3.16 | Details
166 1QIW 1 A, B CALMODULIN 9913
167 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
168 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
169 4ZLK 2 B Calmodulin 10090
170 3TUY 2 B, E Myosin regulatory light chain 6577
171 3TUY 3 C, F Myosin essential light chain 6577
172 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
173 1BJF 1 A, B NEUROCALCIN DELTA 9913
174 3EWT 1 A Calmodulin 9606
175 2VAS 2 B CALMODULIN 7227
176 1Y6W 1 A Calmodulin 9606
177 5SVE 2 B Calcineurin subunit B type 1 9606
178 1CTR 1 A CALMODULIN 9606
179 1L7Z 1 A CALMODULIN 9606
180 5G4P 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
181 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
182 4BYF 2 B, D CALMODULIN 9606
183 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
184 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
185 4MBE 1 A, D Cell division control protein 31 4932
186 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
187 3DVK 1 A Calmodulin 9606
188 5G58 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
189 3BXK 1 A, C Calmodulin 10116
190 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
191 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
192 1QIV 1 A CALMODULIN 9913
193 1A29 1 A CALMODULIN 9913
194 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
195 2FOT 1 A Calmodulin 9913
196 3HR4 2 B, D, F, H Calmodulin 9606
197 4ORA 2 B Calcineurin subunit B type 1 9606
198 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
199 4OV2 1 A, B, C, D Neuronal calcium sensor 1 C-terminal truncation (UNP residues 1-177) 10116
200 3QRX 1 A Centrin 3055
201 6B8Q 2 B, D, F, H Calmodulin-1 9606
202 3GN4 2 B, D, F, H Calmodulin 7227
203 3FWC 1 A, E, I, M Cell division control protein 31 4932
204 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
205 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
206 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
207 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
208 3EWV 1 A Calmodulin 9606
209 4ORC 2 B Calcineurin subunit B type 1 regulatory subunit 9606
210 2BEC 1 A Calcineurin B homologous protein 2 9606
211 3OXQ 1 A, B, C, D Calmodulin 9606
212 1K90 2 D, E, F CALMODULIN 9606
213 4GOW 1 D Calmodulin 9606
214 2F2P 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
215 4ANJ 2 B CALMODULIN 7227
216 4OVN 1 A, B, C, D, E Calmodulin 9606
217 5HIT 1 A Calmodulin 9031
218 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
219 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
220 1V1G 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
221 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
222 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
223 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
224 4E50 1 A Calmodulin, Linker, IQ motif of Neurogranin chimera of Calmodulin, Linker, IQ motif of Neurogranin 10090
225 5V7X 2 B Calmodulin-1 9606
226 5I0I 2 C Calmodulin 9606
227 5I0I 3 E Calmodulin 9606
228 4ORB 2 B Calcineurin subunit B type 1 regulatory subunit 10090
229 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
230 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
231 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
232 1J1D 1 A, D Troponin C 9606
233 4UMO 2 C, D CALMODULIN 9606
234 4JPZ 3 C, I Calmodulin 9606
235 1DEG 1 A CALMODULIN 9913
236 5M6C 1 A Neuron-specific calcium-binding protein hippocalcin 9606
237 5M6C 2 E Neuron-specific calcium-binding protein hippocalcin 9606
238 4YRU 1 A, B, C, D Neuronal calcium sensor 1 UNP residues 1-177 10116
239 3DVJ 1 A Calmodulin 9606
240 3DVM 1 A Calmodulin 9606
241 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
242 1M63 2 B, F CALCINEURIN B SUBUNIT ISOFORM 1 9606
243 2HET 1 A, B, C, D Recoverin 9913
244 1V1F 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
245 4E53 1 A, B Calmodulin, Linker, IQ motif of Neuromodulin chimera of Calmodulin, Linker, IQ motif of Neuromodulin 10090
246 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
247 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
248 4WPX 1 A, D Cell division control protein 31-like protein 209285
249 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
250 2BKI 2 B, D CALMODULIN 9031
251 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
252 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
253 2GV5 1 A, B, D, E Cell division control protein 31 4932
254 5D43 1 A, B Centrin-1 10090
255 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
256 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
257 2DOQ 1 A, B, C Cell division control protein 31 4932
258 1MF8 2 B CALCINEURIN B SUBUNIT ISOFORM 1 9606 3.1.3.16 | Details
259 1S26 2 D, E, F Calmodulin 9606
260 1SK6 2 D, E, F Calmodulin 9606
261 1K93 2 D, E, F CALMODULIN 9606
262 2I2R 2 E, F, G, H, M, N, O, P Kv channel-interacting protein 1 conserved structural core (residues 37-216) 9606
263 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
264 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
265 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
266 1J1E 1 A, D Troponin C 9606
267 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
268 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
269 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
270 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
271 2NZ0 1 A, C Kv channel-interacting protein 1 N-terminal deletion domain 9606
272 2OTG 2 B Myosin regulatory light chain 6577
273 2OTG 3 C Myosin essential light chain 6577
274 1YTZ 3 C Troponin C 9031
275 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
276 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
277 4R8G 2 A, B, H Calmodulin 8355
278 1PK0 2 D, E, F Calmodulin 9606
279 1QX7 1 A, B, I, M, R Calmodulin 10116
280 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
281 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
282 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
283 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
284 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
285 2EC6 3 C Myosin essential light chain 6577
286 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
287 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
288 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
289 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
290 2OS8 3 C Myosin essential light chain Myosin ELC 6577
291 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
292 4JQ0 2 C Calmodulin 9606
293 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
294 1LVC 2 D, E, F calmodulin 9606
295 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
296 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
297 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
298 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
299 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
300 1YV0 3 C Troponin C, skeletal muscle 9031
301 6CNM 2 E, F, G, H Calmodulin-1 9606
302 6CNN 2 E, F, G, H Calmodulin-1 9606
303 6CNO 2 E, F, G, H Calmodulin-1 9606
304 6C1D 3 R Calmodulin 32644
305 6C1G 2 R Calmodulin 32644
306 6C1H 3 R Calmodulin 32644
307 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
308 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
309 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
310 5OEO 1 A Calmodulin-1 9606
311 5VMS 2 B Calmodulin 9606
312 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
313 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
314 5TP5 1 A Calmodulin 9606
315 5TP6 1 A Calmodulin 9606
316 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
317 5T7C 1 A Hippocalcin-like protein 1 Myristoyl group is covalently attached to the N-terminal 9606
318 5T0X 1 A Calmodulin 8355
319 5SY1 1 C, D Calmodulin 7108
320 5GGM 1 A Calmodulin 9606
321 5B7X 1 A Calmodulin, putative 5759
322 5K7L 2 B Calmodulin 9606
323 5J8H 1 A Calmodulin 9606
324 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
325 2N8J 1 A Calmodulin 9606
326 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
327 2N6A 1 A human calmodulin/connexin-36 peptide hybrid 9606
328 3JAX 2 C, D smooth muscle myosin essential light chain 6183
329 2N27 1 A Calmodulin UNP residues 2-149 9606
330 2MGU 1 A Calmodulin 10116
331 2MG5 1 A Calmodulin UNP residues 2-149 9606
332 2MES 1 A Calmodulin 8355
333 3J41 2 E, F Calmodulin 9606
334 2M55 1 A Calmodulin 9606
335 2M3S 1 A Calmodulin UNP residues 1-149 9031
336 2M28 1 A Calcium-binding protein 4 10090
337 2M29 1 A Calcium-binding protein 4 10090
338 2M0J 1 A Calmodulin 9606
339 2M0K 1 A Calmodulin 9606
340 2LV6 1 A Calmodulin 9606
341 2LMT 1 A Calmodulin-related protein 97A 7227
342 2LMU 1 A Calmodulin-related protein 97A 7227
343 2LMV 1 A Calmodulin-related protein 97A 7227
344 2LL6 1 A Calmodulin 9606
345 2LL7 1 A Calmodulin 9606
346 2LHH 1 A Calmodulin UNP RESIDUES 2-121 4932
347 2LHI 1 A Calmodulin, Serine/threonine-protein phosphatase 2B catalytic subunit A1 THE FUSION PROTEIN OF CALMODULIN (RESIDUE 1-146), LINKER (GSSTG) AND CALCINEURIN A1 (RESIDUES 453-476) 32630
348 2LGF 1 A Calmodulin sequence database residues 4-149 9606
349 2LCP 1 A Neuronal calcium sensor 1 9606
350 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
351 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
352 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
353 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
354 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
355 2L7L 1 A Calmodulin 9606
356 2L53 1 A Calmodulin calmodulin 9606
357 2L2E 1 A Calcium-binding protein NCS-1 4896
358 2L1W 1 A Calmodulin 3847
359 2KNE 1 A Calmodulin 9606
360 2KDU 1 A Calmodulin 8355
361 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
362 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
363 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
364 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
365 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
366 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
367 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
368 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
369 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
370 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
371 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
372 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
373 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
374 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
375 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
376 2K61 1 A Calmodulin 9606
377 2K0J 1 A calmodulin 9606
378 2K0E 1 A Calmodulin 9606
379 2K0F 1 A calmodulin 9606
380 2JZI 1 A Calmodulin 9606
381 2JU0 1 A Calcium-binding protein NCS-1 4932
382 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
383 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
384 2JT3 1 A Troponin C 9606
385 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
386 2JNF 1 A Troponin C 212017
387 2E30 1 A Calcium-binding protein p22 9606
388 2I94 1 A Recoverin 9913
389 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
390 1X02 1 A calmodulin 8355
391 1SY9 1 A CALMODULIN 8355
392 1NWD 1 A Calmodulin 8355
393 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
394 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
395 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
396 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
397 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
398 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
399 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
400 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
401 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
402 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
403 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
404 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
405 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
406 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
407 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
408 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
409 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
410 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
411 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
412 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
413 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
414 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
415 1LKJ 1 A Calmodulin 4932
416 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
417 1LA3 1 A Recoverin 9913
418 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
419 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
420 1GGW 1 A PROTEIN (CDC4P) 4896
421 1FPW 1 A CALCIUM-BINDING PROTEIN NCS-1 4932
422 1CFF 1 A PROTEIN (CALMODULIN) 8355
423 1CKK 1 A Calmodulin-1 8355
424 1MUX 1 A CALMODULIN 8355
425 1JSA 1 A RECOVERIN 9913
426 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
427 1DMO 1 A CALMODULIN 8355
428 1IKU 1 A RECOVERIN 9913
429 1CFD 1 A CALMODULIN 8355
430 1TNW 1 A TROPONIN C 9031
431 1TNX 1 A TROPONIN C 9031
432 1CFC 1 A CALMODULIN 8355
433 2BBM 1 A CALMODULIN 7227
434 2BBN 1 A CALMODULIN 7227