Sequence Similarity Clusters for the Entities in PDB 2V01

Entity #1 | Chains: A
CALMODULIN protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 55 174 98
95 % 63 219 79 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 67 226 82
70 % 74 231 88
50 % 75 240 109
40 % 90 347 65
30 % 90 348 68

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2O5G 1 A Calmodulin 9031
2 4DJC 1 A Calmodulin 9606
3 3GOF 1 A, B Calmodulin 9031
4 3GP2 1 A Calmodulin 9031
5 4LZX 1 A Calmodulin UNP residues 2-149 9606
6 2W73 1 A, B, E, F CALMODULIN 9606
7 2F3Y 1 A Calmodulin 9606
8 5DOW 1 A, C, E, G Calmodulin 9606
9 4J9Y 2 R Calmodulin 10116
10 2O60 1 A Calmodulin 9031
11 5V03 2 R Calmodulin 9606
12 3IF7 1 A Calmodulin 9913
13 6DAD 1 A, B Calmodulin-1 9606
14 5NIN 1 A, B Calmodulin 9606
15 1QTX 1 A PROTEIN (CALMODULIN) 562
16 4G28 2 R Calmodulin 10116
17 4G27 2 R Calmodulin 10116
18 1G4Y 2 R CALMODULIN 10116
19 4J9Z 2 R Calmodulin 10116
20 2F3Z 1 A Calmodulin 9606
21 1PRW 1 A Calmodulin 9913
22 5JQA 1 A Calmodulin 9606
23 1MXE 1 A, B Calmodulin 7227
24 1YR5 1 A calmodulin residues 1-148 9606
25 5JTH 1 A Calmodulin 9606
26 1CLL 1 A CALMODULIN 9606
27 5V02 2 R Calmodulin-1 9606
28 2WEL 2 D CALMODULIN 9606
29 3BYA 1 A Calmodulin 9606
30 1VRK 1 A CALMODULIN 32630
31 3SJQ 1 A, B Calmodulin 10116
32 6MBA 2 B Calmodulin-1 10116
33 5K8Q 1 A Calmodulin 9606
34 4EHQ 1 A Calmodulin 10116
35 4BW7 1 A, C CALMODULIN 9606
36 1AHR 1 A CALMODULIN 9031
37 1IQ5 1 A CALMODULIN 8355
38 6O5G 1 A Calmodulin-1 9606
39 5WBX 2 R Calmodulin-1 9606
40 1CM4 1 A CALMODULIN 9913
41 1ZUZ 1 A calmodulin 9606
42 1QS7 1 A, C CALMODULIN 562
43 2Y4V 1 A CALMODULIN 9606
44 6DAE 1 A, B Calmodulin-1 9606
45 2HQW 1 A Calmodulin 10116
46 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
47 3SUI 1 A Calmodulin 9606
48 1UP5 1 A, B Calmodulin 9031
49 4BW8 1 A, B CALMODULIN 9606
50 4QNH 2 R Calmodulin 10116
51 6MUE 1 A Calmodulin-1 9606
52 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
53 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
54 4Q5U 1 A Calmodulin 9606
55 4AQR 1 A, B CALMODULIN-7 3702
56 2BE6 1 A, B, C Calmodulin 2 9606
57 1CDL 1 A, B, C, D CALMODULIN 9606
58 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
59 6EEB 1 A Calmodulin-1 9606
60 4DBP 2 C Calmodulin 7227
61 4HEX 1 A, B Calmodulin 10090
62 4M1L 1 A Calmodulin UNP residues 2-149 9606
63 2BCX 1 A Calmodulin 9031
64 1LIN 1 A CALMODULIN 9913
65 3CLN 1 A CALMODULIN 10117
66 1IWQ 1 A CALMODULIN 9606
67 2V01 1 A CALMODULIN 9606
68 1WRZ 1 A calmodulin 9606
69 2YGG 2 B CALMODULIN 10116
70 1RFJ 1 A calmodulin 4113
71 3L9I 2 C Calmodulin 7227
72 1CM1 1 A CALMODULIN 9913
73 1NIW 1 A, C, E, G calmodulin 10116
74 4CLN 1 A CALMODULIN 7227
75 3G43 1 A, B, C, D Calmodulin 9606
76 6CZQ 2 R Calmodulin-1 residues 5-148 10116
77 1XA5 1 A Calmodulin 9913
78 1OOJ 1 A Calmodulin CMD-1 6239
79 2X0G 2 B CALMODULIN 9606
80 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
81 6B8P 2 B, D, F, H Calmodulin-1 9606
82 4DCK 2 B Calmodulin Calmodulin 9606
83 4PJJ 2 B Calmodulin 7227
84 4L79 2 B Calmodulin 9606
85 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
86 5WC5 2 R Calmodulin-1 9606
87 2X51 2 B CALMODULIN 7227
88 6B8N 2 B, D, F, H Calmodulin-1 9606
89 6B8L 2 B, D, F, H Calmodulin-1 9606
90 6N5W 3 C Calmodulin-1 9606
91 3BXL 1 A Calmodulin 10116
92 2VB6 2 B CALMODULIN 9031
93 5DBR 1 A Calmodulin 9606
94 3DVE 1 A Calmodulin 9606
95 4DBQ 2 B Calmodulin 7227
96 6DAF 1 A, B Calmodulin-1 9606
97 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
98 2BKH 2 B CALMODULIN 7227
99 2V02 1 A CALMODULIN 9606
100 6B8M 2 B, D, F, H Calmodulin-1 9606
101 1QIW 1 A, B CALMODULIN 9913
102 4ZLK 2 B Calmodulin 10090
103 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
104 3EWT 1 A Calmodulin 9606
105 2VAS 2 B CALMODULIN 7227
106 1Y6W 1 A Calmodulin 9606
107 1CTR 1 A CALMODULIN 9606
108 1L7Z 1 A CALMODULIN 9606
109 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
110 4BYF 2 B, D CALMODULIN 9606
111 6DAH 1 A, B, C, D Calmodulin-1 9606
112 3DVK 1 A Calmodulin 9606
113 3BXK 1 A, C Calmodulin 10116
114 1QIV 1 A CALMODULIN 9913
115 1A29 1 A CALMODULIN 9913
116 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
117 2FOT 1 A Calmodulin 9913
118 3HR4 2 B, D, F, H Calmodulin 9606
119 6K4K 2 C, D Calmodulin-1 9606
120 6B8Q 2 B, D, F, H Calmodulin-1 9606
121 3GN4 2 B, D, F, H Calmodulin 7227
122 6MUD 1 A Calmodulin-1 9606
123 3EWV 1 A Calmodulin 9606
124 3OXQ 1 A, B, C, D Calmodulin 9606
125 1K90 2 D, E, F CALMODULIN 9606
126 4GOW 1 D Calmodulin 9606
127 4ANJ 2 B CALMODULIN 7227
128 4OVN 1 A, B, C, D, E Calmodulin 9606
129 5HIT 1 A Calmodulin 9031
130 5V7X 2 B Calmodulin-1 9606
131 5I0I 2 C Calmodulin 9606
132 5I0I 3 E Calmodulin 9606
133 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
134 4UMO 2 C, D CALMODULIN 9606
135 4JPZ 3 C, I Calmodulin 9606
136 1DEG 1 A CALMODULIN 9913
137 3DVJ 1 A Calmodulin 9606
138 3DVM 1 A Calmodulin 9606
139 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
140 6K4L 2 C, D Calmodulin-1 9606
141 6K4R 2 C, D Calmodulin-1 9606
142 2BKI 2 B, D CALMODULIN 9031
143 1S26 2 D, E, F Calmodulin 9606
144 1SK6 2 D, E, F Calmodulin 9606
145 1K93 2 D, E, F CALMODULIN 9606
146 6MC9 2 B Calmodulin-1 10116
147 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
148 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
149 4R8G 2 A, B, H Calmodulin 8355
150 1PK0 2 D, E, F Calmodulin 9606
151 1QX7 1 A, B, I, M, R Calmodulin 10116
152 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
153 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
154 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
155 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
156 4JQ0 2 C Calmodulin 9606
157 1LVC 2 D, E, F calmodulin 9606
158 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
159 6S5T 2 B Calmodulin-2 9606
160 6JV2 2 B, D, F, H Calmodulin 9606
161 6JRS 3 C, F, I, L calmodulin 9606
162 6JIY 3 C, F, I, L Ca2+-loaded calmodulin 9606
163 6JIU 3 C, F, I, L Ca2+-loaded calmodulin 9606
164 6O20 2 F Calmodulin 9913
165 6JII 3 C, F, I, L apo-Calmodulin-mimicking mutant 9606
166 6JI8 3 C, F, I, L Calmodulin 9606
167 6E2F 2 E Calmodulin-1 9606
168 6E2G 2 E Calmodulin-1 9606
169 6DMW 2 E Calmodulin-1 10116
170 6GDK 1 A Calmodulin-1 9606
171 6GDL 1 A Calmodulin-1 9606
172 6CNM 2 E, F, G, H Calmodulin-1 9606
173 6CNN 2 E, F, G, H Calmodulin-1 9606
174 6CNO 2 E, F, G, H Calmodulin-1 9606
175 6C1D 3 R Calmodulin 32644
176 6C1G 2 R Calmodulin 32644
177 6C1H 3 R Calmodulin 32644
178 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
179 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
180 6BUT 1 A Calmodulin-1 9606
181 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
182 5OEO 1 A Calmodulin-1 9606
183 5VMS 2 B Calmodulin 9606
184 5TP5 1 A Calmodulin 9606
185 5TP6 1 A Calmodulin 9606
186 5T0X 1 A Calmodulin 8355
187 5SY1 1 C, D Calmodulin 7108
188 5GGM 1 A Calmodulin 9606
189 5K7L 2 B Calmodulin 9606
190 5J8H 1 A Calmodulin 9606
191 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
192 2N8J 1 A Calmodulin 9606
193 2N27 1 A Calmodulin UNP residues 2-149 9606
194 2MGU 1 A Calmodulin 10116
195 2MG5 1 A Calmodulin UNP residues 2-149 9606
196 2MES 1 A Calmodulin 8355
197 3J41 2 E, F Calmodulin 9606
198 2M55 1 A Calmodulin 9606
199 2M3S 1 A Calmodulin UNP residues 1-149 9031
200 2M0J 1 A Calmodulin 9606
201 2M0K 1 A Calmodulin 9606
202 2LV6 1 A Calmodulin 9606
203 2LL6 1 A Calmodulin 9606
204 2LL7 1 A Calmodulin 9606
205 2LGF 1 A Calmodulin sequence database residues 4-149 9606
206 2L7L 1 A Calmodulin 9606
207 2L53 1 A Calmodulin calmodulin 9606
208 2KNE 1 A Calmodulin 9606
209 2KDU 1 A Calmodulin 8355
210 2K61 1 A Calmodulin 9606
211 2K0J 1 A calmodulin 9606
212 2K0E 1 A Calmodulin 9606
213 2K0F 1 A calmodulin 9606
214 2JZI 1 A Calmodulin 9606
215 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
216 1X02 1 A calmodulin 8355
217 1SY9 1 A CALMODULIN 8355
218 1NWD 1 A Calmodulin 8355
219 1CFF 1 A CALMODULIN 8355
220 1CKK 1 A Calmodulin-1 8355
221 1MUX 1 A CALMODULIN 8355
222 1DMO 1 A CALMODULIN 8355
223 1CFD 1 A CALMODULIN 8355
224 1CFC 1 A CALMODULIN 8355
225 2BBM 1 A CALMODULIN 7227
226 2BBN 1 A CALMODULIN 7227