Sequence Similarity Clusters for the Entities in PDB 1MVW

Entity #1 | Chains: A,D,G,J,M,P
SKELETAL MUSCLE MYOSIN II protein, length: 840 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 11 12 801
95 % 14 15 1005
90 % 14 15 1049
70 % 18 19 946
50 % 51 52 527
40 % 96 100 399
30 % 131 135 259
Entity #2 | Chains: B,E,H,K,N,Q
SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 10 11 830
95 % 13 14 1036
90 % 14 16 1012
70 % 16 18 984
50 % 17 19 987
40 % 332 351 70
30 % 333 352 73
Entity #3 | Chains: C,F,I,L,O,R
SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN protein, length: 147 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 11 12 813
95 % 14 15 1025
90 % 14 15 1060
70 % 15 16 1067
50 % 23 25 802
40 % 333 351 70
30 % 334 352 73
Entity #4 | Chains: 1,2,3,4,5,6,7,8,9,V,W,X,Y,Z
RABBIT SKELETAL MUSCLE ACTIN protein, length: 375 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 156 157 7
95 % 167 168 14
90 % 219 220 11
70 % 244 245 15
50 % 251 252 18
40 % 271 272 22
30 % 292 293 29

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
14 4J9Y 2 R Calmodulin 10116
15 2O60 1 A Calmodulin 9031
16 5V03 2 R Calmodulin 9606
17 3IF7 1 A Calmodulin 9913
18 6DAD 1 A, B Calmodulin-1 9606
19 5NIN 1 A, B Calmodulin 9606
20 1QTX 1 A PROTEIN (CALMODULIN) 562
21 4G28 2 R Calmodulin 10116
22 4G27 2 R Calmodulin 10116
23 1M45 1 A Myosin light chain 4932
24 1G4Y 2 R CALMODULIN 10116
25 4J9Z 2 R Calmodulin 10116
26 2F3Z 1 A Calmodulin 9606
27 1PRW 1 A Calmodulin 9913
28 1OSA 1 A CALMODULIN 5888
29 5JQA 1 A Calmodulin 9606
30 1MXE 1 A, B Calmodulin 7227
31 1NCX 1 A TROPONIN C 9031
32 6M7H 1 A Calmodulin-1 9606
33 1TOP 1 A TROPONIN C 9031
34 1YR5 1 A calmodulin residues 1-148 9606
35 5JTH 1 A Calmodulin 9606
36 1CLL 1 A CALMODULIN 9606
37 5V02 2 R Calmodulin-1 9606
38 1NCZ 1 A TROPONIN C 9031
39 2WEL 2 D CALMODULIN 9606
40 1N0Y 1 A, B Calmodulin 5888
41 3BYA 1 A Calmodulin 9606
42 1VRK 1 A CALMODULIN 32630
43 3SJQ 1 A, B Calmodulin 10116
44 6MBA 2 B Calmodulin-1 10116
45 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
46 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 5.6.1.8 | Details
47 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 5.6.1.8 | Details
48 1NCY 1 A TROPONIN C 9031
49 5K8Q 1 A Calmodulin 9606
50 4EHQ 1 A Calmodulin 10116
51 1CLM 1 A CALMODULIN 5888
52 5TNC 1 A TROPONIN-C 9103
53 4BW7 1 A, C CALMODULIN 9606
54 1AHR 1 A CALMODULIN 9031
55 1IQ5 1 A CALMODULIN 8355
56 6O5G 1 A Calmodulin-1 9606
57 5WBX 2 R Calmodulin-1 9606
58 1CM4 1 A CALMODULIN 9913
59 1ZUZ 1 A calmodulin 9606
60 4TNC 1 A TROPONIN C 9031
61 1QS7 1 A, C CALMODULIN 562
62 2Y4V 1 A CALMODULIN 9606
63 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
64 6DAE 1 A, B Calmodulin-1 9606
65 2HQW 1 A Calmodulin 10116
66 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
67 3SUI 1 A Calmodulin 9606
68 1UP5 1 A, B Calmodulin 9031
69 4BW8 1 A, B CALMODULIN 9606
70 4QNH 2 R Calmodulin 10116
71 6MUE 1 A Calmodulin-1 9606
72 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
73 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
74 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
75 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
76 4Q5U 1 A Calmodulin 9606
77 4AQR 1 A, B CALMODULIN-7 3702
78 2BE6 1 A, B, C Calmodulin 2 9606
79 1N2D 1 A, B Myosin Light Chain 4932
80 1CDL 1 A, B, C, D CALMODULIN 9606
81 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
82 6EEB 1 A Calmodulin-1 9606
83 4DBP 2 C Calmodulin 7227
84 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
85 4M1L 1 A Calmodulin UNP residues 2-149 9606
86 2BCX 1 A Calmodulin 9031
87 1LIN 1 A CALMODULIN 9913
88 3CLN 1 A CALMODULIN 10117
89 1IWQ 1 A CALMODULIN 9606
90 1M46 1 A Myosin light chain 4932
91 2V01 1 A CALMODULIN 9606
92 6OQQ 2 B, D Calmodulin 4932
93 1WRZ 1 A calmodulin 9606
94 2YGG 2 B CALMODULIN 10116
95 1RFJ 1 A calmodulin 4113
96 5W1A 2 B, D Myosin light chain alkali 7227
97 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
98 3L9I 2 C Calmodulin 7227
99 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
100 1CM1 1 A CALMODULIN 9913
101 4DS7 1 A, B, C, D Calmodulin 28985
102 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
103 1NIW 1 A, C, E, G calmodulin 10116
104 4CLN 1 A CALMODULIN 7227
105 3G43 1 A, B, C, D Calmodulin 9606
106 6CZQ 2 R Calmodulin-1 residues 5-148 10116
107 3PN7 3 C, F Myosin essential light chain 6577
108 1XA5 1 A Calmodulin 9913
109 1OOJ 1 A Calmodulin CMD-1 6239
110 2X0G 2 B CALMODULIN 9606
111 1DTL 1 A CARDIAC TROPONIN C 9031
112 1TCF 1 A TROPONIN C 9986
113 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
114 6B8P 2 B, D, F, H Calmodulin-1 9606
115 4DCK 2 B Calmodulin Calmodulin 9606
116 4PJJ 2 B Calmodulin 7227
117 4L79 2 B Calmodulin 9606
118 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
119 5WC5 2 R Calmodulin-1 9606
120 2X51 2 B CALMODULIN 7227
121 6B8N 2 B, D, F, H Calmodulin-1 9606
122 6B8L 2 B, D, F, H Calmodulin-1 9606
123 6N5W 3 C Calmodulin-1 9606
124 3BXL 1 A Calmodulin 10116
125 3TS5 3 C, F Myosin essential light chain 6577
126 2VB6 2 B CALMODULIN 9031
127 5DBR 1 A Calmodulin 9606
128 3DVE 1 A Calmodulin 9606
129 1A2X 1 A TROPONIN C 9986
130 4DBQ 2 B Calmodulin 7227
131 6DAF 1 A, B Calmodulin-1 9606
132 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
133 2BKH 2 B CALMODULIN 7227
134 2V02 1 A CALMODULIN 9606
135 6B8M 2 B, D, F, H Calmodulin-1 9606
136 1QIW 1 A, B CALMODULIN 9913
137 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
138 4ZLK 2 B Calmodulin 10090
139 3TUY 3 C, F Myosin essential light chain 6577
140 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
141 2VAS 2 B CALMODULIN 7227
142 1Y6W 1 A Calmodulin 9606
143 1CTR 1 A CALMODULIN 9606
144 1L7Z 1 A CALMODULIN 9606
145 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
146 4BYF 2 B, D CALMODULIN 9606
147 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
148 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
149 6DAH 1 A, B, C, D Calmodulin-1 9606
150 3DVK 1 A Calmodulin 9606
151 3BXK 1 A, C Calmodulin 10116
152 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
153 1QIV 1 A CALMODULIN 9913
154 1A29 1 A CALMODULIN 9913
155 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
156 2FOT 1 A Calmodulin 9913
157 3HR4 2 B, D, F, H Calmodulin 9606
158 6K4K 2 C, D Calmodulin-1 9606
159 6B8Q 2 B, D, F, H Calmodulin-1 9606
160 3GN4 2 B, D, F, H Calmodulin 7227
161 6MUD 1 A Calmodulin-1 9606
162 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
163 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
164 3OXQ 1 A, B, C, D Calmodulin 9606
165 1K90 2 D, E, F CALMODULIN 9606
166 4GOW 1 D Calmodulin 9606
167 4ANJ 2 B CALMODULIN 7227
168 4OVN 1 A, B, C, D, E Calmodulin 9606
169 5HIT 1 A Calmodulin 9031
170 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
171 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
172 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
173 5V7X 2 B Calmodulin-1 9606
174 5I0I 2 C Calmodulin 9606
175 5I0I 3 E Calmodulin 9606
176 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
177 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
178 1J1D 1 A, D Troponin C 9606
179 4UMO 2 C, D CALMODULIN 9606
180 4JPZ 3 C, I Calmodulin 9606
181 1DEG 1 A CALMODULIN 9913
182 3DVJ 1 A Calmodulin 9606
183 3DVM 1 A Calmodulin 9606
184 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
185 6K4L 2 C, D Calmodulin-1 9606
186 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
187 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
188 6K4R 2 C, D Calmodulin-1 9606
189 2BKI 2 B, D CALMODULIN 9031
190 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
191 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
192 1S26 2 D, E, F Calmodulin 9606
193 1SK6 2 D, E, F Calmodulin 9606
194 1K93 2 D, E, F CALMODULIN 9606
195 6MC9 2 B Calmodulin-1 10116
196 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 5.6.1.8 | Details
197 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
198 1J1E 1 A, D Troponin C 9606
199 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
200 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
201 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
202 2OTG 3 C Myosin essential light chain 6577
203 1YTZ 3 C Troponin C 9031
204 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
205 4R8G 2 A, B, H Calmodulin 8355
206 1PK0 2 D, E, F Calmodulin 9606
207 1QX7 1 A, B, I, M, R Calmodulin 10116
208 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
209 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
210 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
211 2EC6 3 C Myosin essential light chain 6577
212 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
213 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
214 2OS8 3 C Myosin essential light chain Myosin ELC 6577
215 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
216 4JQ0 2 C Calmodulin 9606
217 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 5.6.1.8 | Details
218 1LVC 2 D, E, F calmodulin 9606
219 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
220 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
221 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
222 1YV0 3 C Troponin C, skeletal muscle 9031
223 6S5T 2 B Calmodulin-2 9606
224 6PBX 2 B, D, F, H Calmodulin-1 9606
225 6PBY 2 B, D, F, H Calmodulin-1 9606
226 6JV2 2 B, D, F, H Calmodulin-1 9606
227 6JRS 3 C, F, I, L Calmodulin-1 9606
228 6JIY 3 C, F, I, L Calmodulin-1 9606
229 6JIU 3 C, F, I, L Calmodulin-1 9606
230 6JII 3 C, F, I, L Calmodulin-1 9606
231 6JI8 3 C, F, I, L Calmodulin-1 9606
232 6E2F 2 E Calmodulin-1 9606
233 6E2G 2 E Calmodulin-1 9606
234 6DMW 2 E Calmodulin-1 10116
235 6GDK 1 A Calmodulin-1 9606
236 6GDL 1 A Calmodulin-1 9606
237 5ZOR 1 A Centrin, putative 5691
238 6CTB 1 A Calmodulin-1 8355
239 6CNM 2 E, F, G, H Calmodulin-1 9606
240 6CNN 2 E, F, G, H Calmodulin-1 9606
241 6CNO 2 E, F, G, H Calmodulin-1 9606
242 6C1D 3 R Calmodulin 32644
243 6C1G 2 R Calmodulin 32644
244 6C1H 3 R Calmodulin 32644
245 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
246 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
247 6BUT 1 A Calmodulin-1 9606
248 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
249 5OEO 1 A Calmodulin-1 9606
250 5VMS 2 B Calmodulin 9606
251 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
252 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
253 5TP5 1 A Calmodulin 9606
254 5TP6 1 A Calmodulin 9606
255 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
256 5T0X 1 A Calmodulin 8355
257 5SY1 1 C, D Calmodulin 7108
258 5GGM 1 A Calmodulin 9606
259 5K7L 2 B Calmodulin 9606
260 5J8H 1 A Calmodulin 9606
261 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
262 2N8J 1 A Calmodulin 9606
263 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
264 3JAX 2 C, D smooth muscle myosin essential light chain 6183
265 2N27 1 A Calmodulin UNP residues 2-149 9606
266 2MGU 1 A Calmodulin 10116
267 2MG5 1 A Calmodulin UNP residues 2-149 9606
268 2MES 1 A Calmodulin 8355
269 3J41 2 E, F Calmodulin 9606
270 2M55 1 A Calmodulin 9606
271 2M3S 1 A Calmodulin UNP residues 1-149 9031
272 2M0J 1 A Calmodulin 9606
273 2M0K 1 A Calmodulin 9606
274 2LV6 1 A Calmodulin 9606
275 2LMT 1 A Calmodulin-related protein 97A 7227
276 2LMU 1 A Calmodulin-related protein 97A 7227
277 2LMV 1 A Calmodulin-related protein 97A 7227
278 2LL6 1 A Calmodulin 9606
279 2LL7 1 A Calmodulin 9606
280 2LGF 1 A Calmodulin sequence database residues 4-149 9606
281 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
282 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
283 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
284 2L7L 1 A Calmodulin 9606
285 2L53 1 A Calmodulin calmodulin 9606
286 2L1W 1 A Calmodulin 3847
287 2KNE 1 A Calmodulin 9606
288 2KDU 1 A Calmodulin 8355
289 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
290 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
291 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
292 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
293 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
294 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
295 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
296 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
297 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
298 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
299 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
300 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
301 2K61 1 A Calmodulin 9606
302 2K0J 1 A calmodulin 9606
303 2K0E 1 A Calmodulin 9606
304 2K0F 1 A calmodulin 9606
305 2JZI 1 A Calmodulin 9606
306 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
307 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
308 2JT3 1 A Troponin C 9606
309 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
310 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
311 1X02 1 A calmodulin 8355
312 1SY9 1 A CALMODULIN 8355
313 1NWD 1 A Calmodulin 8355
314 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
315 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
316 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
317 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
318 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
319 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
320 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
321 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
322 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
323 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
324 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
325 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
326 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
327 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
328 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
329 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
330 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
331 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
332 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
333 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
334 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
335 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
336 1LKJ 1 A Calmodulin 4932
337 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
338 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
339 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
340 1GGW 1 A PROTEIN (CDC4P) 4896
341 1CFF 1 A CALMODULIN 8355
342 1CKK 1 A Calmodulin-1 8355
343 1MUX 1 A CALMODULIN 8355
344 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
345 1DMO 1 A CALMODULIN 8355
346 1CFD 1 A CALMODULIN 8355
347 1TNW 1 A TROPONIN C 9031
348 1TNX 1 A TROPONIN C 9031
349 1CFC 1 A CALMODULIN 8355
350 2BBM 1 A CALMODULIN 7227
351 2BBN 1 A CALMODULIN 7227