1IC5

CRYSTAL STRUCTURE OF HYHEL-10 FV MUTANT(HD99A)-HEN LYSOZYME COMPLEX


Sequence Similarity Clusters for the Entities in PDB 1IC5

Entity #1 | Chains: L
LYSOZYME BINDING IG KAPPA CHAIN protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 14 4986
95 % 16 22 2933
90 % 16 24 2776
70 % 19 29 2176
50 % 141 415 21
40 % 154 440 24
30 % 466 1364 5
Entity #2 | Chains: H
IGG1 FAB CHAIN H protein, length: 114 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 73041
95 % 16 22 3029
90 % 16 22 3107
70 % 19 42 1173
50 % 321 910 5
40 % 321 927 6
30 % 467 1364 5
Entity #3 | Chains: Y
LYSOZYME C protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 658 787 3
95 % 711 843 5
90 % 722 860 6
70 % 728 867 11
50 % 940 1095 9
40 % 962 1130 10
30 % 962 1132 16

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 6JB9 1 A Nanobody D3-L11 9838
4 5E7B 1 A nanobody nano-L06 9838
5 2P45 2 B ANTIBODY CAB-RN05 9838
6 6OSH 3 H Antibody heavy chain variable region 9986
7 2X1Q 1 A, B GELSOLIN NANOBODY 9844
8 5U64 1 B VHH-28 9838
9 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
10 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
11 4B41 1 A, B ANTIBODY G7 9844
12 5IMM 1 B Nanobody 9835
13 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
14 6HER 2 B Nanobody 484 9838
15 5NLU 1 A single domain llama antibody Nb36 9844
16 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
17 5IMK 1 B Nanobody 9835
18 6CWK 1 A Anti-Ricin antibody 30538
19 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
20 4B50 1 A 2H10 LLAMA VHH 9844
21 6HEQ 1 A Prion nanobody 484 9838
22 6U14 1 A, B VHH R303 C33A/C102A mutant 9838
23 6DBA 1 A, B nanobody VHH R303 9838
24 6RU3 1 C hFP1Nb1 9844
25 2XT1 2 B CAMELID VHH 9 30538
26 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
27 6OSV 3 H Antibody heavy chain variable region 9986
28 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
29 5J1S 3 C VHH domain BS-2 30538
30 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
31 5J1T 3 C VHH domain BS-2 30538
32 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
33 6JB2 1 A Nanobody D3-L11 9838
34 6J9O 1 H Heavy chain of AF4H1K1 scFv 9606
35 2X1O 1 A, B GELSOLIN NANOBODY 9844
36 4QGY 1 A, B nanobody n25, VH domain 9844
37 5VNV 1 A Nb.b201 32630
38 6J14 1 A GY-14 heavy chain V fragment 10090
39 5DXW 1 A PD-L1 nanobody 9835
40 6IR2 2 B mCherry's nanobody LaM2 9837
41 4N9O 2 B Nanobody Nb484 Nb484 9844
42 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
43 6JB5 1 A Nanobody D3-L11 9838
44 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
45 1T2J 1 A M12-Variable Heavy domain 9606
46 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
47 6DBF 2 B InlB specific VHH R303 9838
48 6SGE 2 B, D Nanobody B6 9606
49 6DBG 2 C, D VHH R303 9838
50 6I2G 1 A ALFA nanobody 30538
51 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
52 5VM6 1 A single domain camelid nanobody VHH T10 9844
53 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
54 4KML 2 B Nanobody 9844
55 6DYX 1 D VHH R419 30538
56 4Z9K 2 B VHH2(F5) antibody 30538
57 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
58 5LMW 1 A Nanobody 9844
59 5NM0 1 A, B, C, D Nb36 9844
60 6U53 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire C (ZC) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
61 6H6Y 2 E, F, G, H Nanobody (VHH) Nano-7 30538
62 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
63 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
64 4PPT 1 A Engineered single domain VHH antibody 9844
65 3R0M 1 A, B Llama VHH A12 9844
66 3ZKQ 2 D XA4813 9844
67 4I13 2 B Protein ca1697 (nanobody) 9844
68 5C2U 1 B Nanobody Nanobody 9838
69 1XFP 1 A heavy chain antibody VHH domain 9838
70 6U12 2 B VHH R303 C33A/C102A mutant 9838
71 4POY 1 A VHH-metal 9844
72 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
73 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
74 5NLW 1 A nanobody Nb36 9844
75 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
76 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
77 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
78 3G9A 2 B Minimizer 9838
79 6P79 1 H Engineered antibody heavy chain 10090
80 6U50 1 C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
81 6U54 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire C (ZC) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
82 2P43 2 B ANTIBODY CAB-RN05 9838
83 4KRN 1 A Nanobody/VHH domain EgA1 9844
84 4GFT 2 B Nanobody 9844
85 4TVS 2 a, b VHH Domain BS-1 30538
86 4W6Y 2 B Nanobody NbFedF9 9844
87 6EZW 1 B VHH antibody BCD090-M2 9844
88 6ITP 1 A, B anti-cortisol camelid antibody 9837
89 1UAC 2 H Ig VH,anti-lysozyme 10090
90 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
91 6JB8 1 A Nanobody D3-L11 9838
92 6K65 3 H 1P4B variable heavy chain 10090
93 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
94 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
95 6ITQ 1 A, B, C, D anti-cortisol camelid antibody 9837
96 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
97 5O02 2 C Nanobody (VHH) Nano-4 30538
98 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
99 6JSZ 2 D XAPERONE 9606
100 4X7F 2 C, D Nano-25 Nanobody 30538
101 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
102 4LGR 2 B Camelid nanobody (VHH3) 30538
103 5J57 2 B VHH single chain antibody V5E1 30538
104 6BA5 2 B, D, F, H Variable domain Heavy chain, antibody R11 9606
105 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
106 5OMM 2 C Nanobody (VHH) Nano-14 30538
107 5E03 1 A CTLA-4 nanobody 9835
108 5LZ0 1 A, B PorM nanobody 9844
109 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
110 6DBE 1 A, B nanobody VHH R303 9844
111 6XW5 2 C, D Nanobody NB-5820 30538
112 2XXC 1 B CAMELID VHH 9 30538
113 3QYC 1 A, B VH domain of IgG molecule 9606
114 5VAK 2 B Nb914 Nanobody 9844
115 2XXM 2 B CAMELID VHH 9 30538
116 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
117 6LR7 2 B Nanobody LaG16 9837
118 6T2J 1 A, B Single domain antibody 32630
119 6DBD 1 A, B, C, D nanobody VHH R326 9844
120 5JDS 1 B Nanobody 9835
121 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
122 6OBE 2 B VHH antibody V6H8 30538
123 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
124 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
125 5L21 2 B VHH-C2 30538
126 5FWO 1 A NANOBODY 9844
127 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
128 3B9V 1 A, B, C, D heavy chain variable domain 9606
129 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
130 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
131 5N88 1 A, H VH59 antibody 9606
132 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
133 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
134 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
135 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
136 6YZ5 2 F Nanobody H11-D4 9844
137 4POU 2 B VHH Antibody 9844
138 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
139 6J5D 2 H antibody heavy chain 10090
140 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
141 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
142 6H70 2 C, D Nanobody (VHH) Nano-62 30538
143 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
144 2P42 2 B, D ANTIBODY CAB-RN05 9838
145 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
146 4QLR 1 A, B Llama nanobody n02 VH domain 9844
147 5J56 2 B VHH single chain antibody V1C7 30538
148 6OBC 2 B VHH antibody 30538
149 6J5F 2 H antibody heavy chain 10090
150 4NBX 2 B A20.1 VHH 9844
151 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
152 4HEP 2 G vHH17 domain 9844
153 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
154 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
155 5IML 2 B Nanobody 9835
156 3A6C 2 H IG VH, anti-lysozyme 10090
157 2DQD 2 H Ig VH,anti-lysozyme 10090
158 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
159 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
160 3A67 2 H IG VH, anti-lysozyme 10090
161 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
162 1J1X 2 H Ig VH,anti-lysozyme 10090
163 5M2J 2 D Anti-(ED-B) scFV 9606
164 6KYZ 2 B, E YDF H chain 9606
165 2DQC 2 H Ig VH,anti-lysozyme 10090
166 1J1O 2 H Ig VH,anti-lysozyme 10090
167 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
168 4M62 2 H, I GEP2 FV heavy chain 9606
169 5IVO 1 A BC2-nanobody 30538
170 1J1P 2 H Ig VH,anti-lysozyme 10090
171 6S0Y 1 A, B M2e-VHH-23m 9844
172 4NBZ 2 B, D A26.8 VHH 9844
173 5AYU 2 H Ig VH,anti-lysozyme 10090
174 3A6B 2 H IG VH, anti-lysozyme 10090
175 2DQJ 2 H Ig VH,anti-lysozyme 10090
176 5F21 2 B nanobody MU375 9844
177 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
178 2P44 2 B ANTIBODY CAB-RN05 9838
179 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
180 5TP3 1 A, B F-VHH-4 9844
181 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
182 4LHJ 2 B Camelid antibody 30538
183 4BEL 2 D, E XA4813 9844
184 5M7Q 1 A, B Nanobody NbD2 9838
185 5H8D 1 A VHH nanobody 9844
186 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
187 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
188 3DUR 2 B, D Ig-like protein 10090
189 2XV6 2 B, D CAMELID VHH 9 30538
190 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
191 5VM0 1 A, B Camelid Nanobody VHH T9 9844
192 4ZG1 1 A, B, C, D, E, F NB17 9844
193 6BAN 2 B, D, F, H Variable domain R11 Heavy chain 9606
194 4I1N 2 B Protein ca1697 (nanobody) 9844
195 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
196 6F0D 1 A, B VHH antibody BCD090-M2 9844
197 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
198 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
199 4W6X 2 B Nanobody NbFedF7 9844
200 5JA9 2 A, B Nanobody 6 9844
201 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
202 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
203 1OP9 1 A HL6 camel VHH fragment 9838
204 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
205 4LRN 1 H GEP 1 heavy chain 9606
206 4S11 1 A GELSOLIN NANOBODY 9844
207 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
208 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
209 6RTW 2 B Llama-derived nanobody NB64 9844
210 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
211 6IR1 2 B mCherry's nanobody LaM4 9837
212 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
213 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
214 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
215 6RNK 2 B Nanobody6 30538
216 4Y7M 1 A, B Hi113 protein 9844
217 5JMO 2 C, D camelid VHH fragment 9838
218 6GJS 2 B Nanobody D12 9844
219 6GJS 3 C Nanobody T4 9844
220 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
221 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
222 4B5E 1 A, B PS2-8 9844
223 2DQE 2 H Ig VH,anti-lysozyme 10090
224 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
225 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
226 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
227 4X7C 2 C, D Nano-85 Nanobody VHH 30538
228 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
229 3EBA 1 A CAbHul6 9838
230 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
231 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
232 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
233 5VM4 1 A, B, C, D, E, F, G, H, I, J, K, L Single domain camelid nanobody VHH T10 9844
234 6U52 1 A, C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
235 6QGW 2 B NanoE6 9844
236 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
237 4I0C 2 C, D cAbHuL5 antibody 9838
238 6H1F 1 A gelsolin nanobody, Nb11 9844
239 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
240 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
241 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
242 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
243 5BOP 1 A, C Nanobody 9844
244 6U55 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire E (ZE) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
245 4DKA 1 A, B single domain antibody VHH 9844
246 5O05 1 C, D Nanobody (VHH) Nano-42 30538
247 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
248 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
249 3DUU 2 B, D Ig-like protein 10090
250 6OBO 2 C, D VHH antibody V6A6 30538
251 3K74 2 B Nanobody 9844
252 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
253 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
254 6A3W 1 A, D, G, J utomilumab VH 9606
255 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
256 6UL6 3 C ciA-H7 30538
257 6OBG 2 C, D VHH antibody V8E6 30538
258 1SJV 1 A r9 llama VHH single domain antibody 9844
259 6CK8 1 A, B, C Llama antibody SD38 9844
260 6XW6 2 C, D Nanobody NB-5853 30538
261 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
262 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
263 6GZP 1 A Nanobody 9844
264 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
265 6H6Z 2 C, D Nanobody (VHH) Nano-62 30538
266 1UA6 2 H Ig VH,anti-lysozyme 10090
267 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
268 4W68 1 A, B Single domain antibody 9844
269 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
270 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
271 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
272 3EAK 1 A, B NbBCII10-FGLA 9838
273 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
274 4ORZ 3 C single domain antibody sdAb19 9844
275 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
276 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
277 6DN0 1 A, C Human Variable Heavy Chain of Herceptin containing VH mutation K30D 9606
278 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
279 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
280 6IBB 2 B, D Nanobody6 30538
281 6XW7 2 C, D, G, H Nanobody NB-5829 30538
282 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
283 5C1M 2 B Nanobody 39 9844
284 5F7K 2 C, D Nanobody Nb-ER19 9844
285 5LMJ 1 A, B, C, D nanobody 9844
286 5E1H 2 B F8(JOB10) VHH antibody 30538
287 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
288 6OCD 2 B, D VHH antibody V6D4 30538
289 4OCM 3 C, F Nb1 9844
290 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
291 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
292 4X7E 2 C, D Nano-85 Nanobody 30538
293 5F1O 2 B nanobody MU551 9844
294 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
295 5O03 2 C, D Nanobody (VHH) Nano-32 9844
296 6GWN 2 B VHH-2g-42 30538
297 6GWN 3 C VHH-2w-64 30538
298 2DQI 2 H Ig VH,anti-lysozyme 10090
299 4Y8D 2 C, D nanobody 9844
300 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
301 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
302 6XW4 2 C, D Nanobody NB-5867 30538
303 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
304 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
305 4C58 2 B nanobody 9844
306 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
307 3DV6 2 B Ig-like protein 10090
308 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
309 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
310 5VXM 2 B Single-domain antibody 20ipaD 30538
311 4XVJ 2 H antibody heavy chain variable domain 9606
312 4IDL 1 A Single Domain Antibody VHH A9 9844
313 6UI1 2 B ciA-H7 30538
314 6UI1 3 C ciA-D12 30538
315 6UI1 4 D ciA-B5 30538
316 1JV5 2 B Ig chain heavy chain precursor V region 9606
317 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
318 3K7U 1 A Antibody 9844
319 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
320 6KSN 1 A, B ICab3 9838
321 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
322 4NBY 2 B, C A20.1 VHH 9844
323 6HHD 2 B Nanobody 484 9838
324 6HHD 4 D Nanobody 484 9838
325 4X7D 2 C, D Nano-85 Nanobody VHH 9844
326 5VAN 2 B Nb914 Nanobody 9844
327 5F7N 2 C, D Nanobody Nb-ER19 30538
328 5OCL 1 A, C, F, H anti-llama nanobody 30538
329 5OCL 2 B, D, E, G anti-vglut nanobody 9844
330 2A9M 2 H, I fluorescein-scfv heavy chain 9606
331 6OC8 1 A, B, C, D VHH8c 9844
332 5E5M 2 B, D, F, H CTLA-4 nanobody 9835
333 1SJX 1 A immunoglobulin VH domain 9844
334 3ZKS 2 D XA4813 9844
335 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
336 6H72 2 C, D Nanobody (VHH) Nano-94 30538
337 6OCA 2 C, D VHH antibody V2G10 30538
338 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
339 6UHT 2 C, D JLI-G10 30538
340 5MY6 2 B Nanobody 2Rs15d 9838
341 6RTY 2 B Llama-derived nanobody NB64 Nanobody NB64 containing a C-terminal His6-Tag for purification 9844
342 3DUS 2 B, D Ig-like protein 10090
343 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
344 6F5G 2 B VHH minibody anti-Cter PCSK9 VHH from immunization of Llama from E. coli expression 9844
345 5M2I 2 G, H, I, J, K, L VHH1 9844
346 6OQ8 2 C, D 7F 9835
347 6SC5 2 B, C Single domain antibody 32630
348 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
349 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
350 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
351 6SC8 2 B, C Single domain antibody 32630
352 3K1K 2 C, D Enhancer 9838
353 4U7S 1 A, B sdAb A3 9844
354 6WAQ 1 A, C nanobody SARS VHH-72 9844
355 4U3X 1 A, C Human VH domain antibody 9606
356 4W81 1 A Single Domain Antibody 9844
357 5GRV 1 L homo-specific diabody heavy chain 9606
358 5JMR 1 A, B camelid VHH fragment 9838
359 6RVC 2 D, E, F Nanobody NB75 Llama nanobody NB75 containing a a C-terminal His6-Tag for IMAC purification. 9844
360 4W70 1 A Single Domain Antibody 9844
361 6QTL 1 A, D, E, H VHH 9835
362 6QTL 2 B, C, F, G VHH 9835
363 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
364 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
365 4BFB 2 D, E XA4813 9844
366 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
367 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
368 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
369 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
370 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
371 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
372 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
373 6SC6 2 B, C Single domain antibody 32630
374 4LHQ 2 B, D Camelid nanobody 30538
375 3DV4 2 B Ig-like protein 10090
376 6H71 2 C, D Nanobody (VHH) Nano-94 30538
377 6OL7 1 A, E, K, P iv8 Heavy Chain 10090
378 6OL7 3 C, H, I, M glVRC01 Heavy Chain 9606
379 3ZKX 2 B XA4813 9844
380 3ZKX 3 C XA4815 9844
381 6I6J 2 C Sybody 32644
382 5F1K 2 C, D nanobody MU1053 9844
383 6A78 3 H, I Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv 10090
384 3ZLQ 2 C, D XA4813 9844
385 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
386 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
387 6GWP 2 B VHH-2g-42 30538
388 6GWP 3 C VHH-2w-64 30538
389 4NC0 2 B A26.8 VHH 9844
390 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
391 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
392 5GS1 2 B, N, P, R heavy chain 9606
393 5F7Y 3 C, D Nanobody Nb-ER19 9844
394 2DQG 2 H Ig VH,anti-lysozyme 10090
395 6I8G 2 B EDS1-specific nanobody 9844
396 5IMO 1 B Nanobody 9835
397 5U65 1 A, B VHH-5 9838
398 6KZ0 2 B, E, H, K GGVV H chain 9606
399 4TYU 1 A, B Single Domain Antibody 9844
400 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
401 2DQH 2 H Ig VH,anti-lysozyme 10090
402 4AQ1 2 B, D NBKB6 VHH 9844
403 6FV0 2 F nanobody 9844
404 4EIG 2 B CA1698 camel antibody fragment 9844
405 3EHB 3 C FV fragment Chain H 10090
406 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
407 3HB3 3 C ANTIBODY FV FRAGMENT 10090
408 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
409 6GWQ 2 B VHH-2g-42 30538
410 6QGX 2 B NanoF7 9844
411 2X89 1 A, B, C ANTIBODY 9838
412 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
413 5O04 2 E, F Nanobody (VHH) Nano-26 30538
414 5O04 3 C, D Nanobody (VHH) Nano-85 30538
415 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
416 3P9W 2 B, D, F, H human VEGF 9606
417 6OQ7 2 C E3 9835
418 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
419 5F8R 2 C, D Nanobody Nb-ER19 9844
420 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
421 4OCL 3 C, F Nb1 9844
422 4RAV 2 A, C single-chain Fv, VH 9606
423 5XJ4 2 H durvalumab-VH 9606
424 5LWY 2 H V REGION HEAVY CHAIN 10090
425 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
426 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
427 4IOS 2 D, E, F, G Llama nanobody 11 9844
428 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
429 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
430 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
431 4C57 2 C, D NANOBODY 9844
432 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
433 6OL6 3 H iglb12 Heavy Chain 9606
434 4OCN 3 C, F Nb1 9844
435 4GRW 3 E, G Nanobody 124C4 9844
436 4GRW 4 F, J Nanobody 37D5 9844
437 4GRW 5 H, I Nanobody 22E11 9844
438 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
439 4NC2 2 B B39 VHH 9844
440 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
441 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
442 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
443 6EY0 2 E, G, H llama nanobody nb01 9844
444 6EY0 3 F llama nanobody nb01 9844
445 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
446 5F9A 2 C Nanobody Nb-ER19 9844
447 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
448 6GJQ 2 B, D, F, H Nanobody T27 9844
449 5CBA 1 A, C 3b4 heavy chain 9606
450 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
451 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
452 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
453 2OTW 2 B, D Fv heavy chain variable domain VH 10090
454 3STB 1 A, B single domain antibody VHH 9844
455 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
456 4W6W 2 B NbFedF6 9844
457 5JA8 2 B, D, F, H Nanobody 2 9844
458 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
459 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
460 1P4B 2 H Antibody Variable heavy chain 10090
461 5U4M 2 B V1C7 VHH antibody 30538
462 5O0W 2 E, F, G, H Nb474 30538
463 4Y5V 1 A, D, G diabody 305 VH domain 9606
464 6HJX 6 F, G, H, I, J nanobody 72 9844
465 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
466 6SC9 2 B, C Single domain antibody 32630
467 6MTJ 2 D 35O22 scFv heavy chain portion 9606
468 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
469 3V0A 3 C Llama antibody F12 9844
470 6FYU 3 C, F, I Single domain antibody SD36 9844
471 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
472 3K80 1 A, B Antibody 9844
473 5VAQ 2 B Nb914 Nanobody 9844
474 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
475 5F8Q 2 C, D Nanobody Nb-ER19 9844
476 4U05 1 A, B Single Domain Antibody 9844
477 6OBM 2 B VHH antibody V6A7 30538
478 6RBB 1 H, I, J, K VHH domain of netakimab 9844
479 5F9D 2 C Nanobody Nb-ER19 9844
480 4LGP 2 B, D VHH1 camelid nanobody 30538
481 2P48 2 B ANTIBODY CAB-RN05 9838
482 5U4L 2 B V1C7 VHH antibody G29R variant 30538
483 5VXK 1 B single-domain antibody JMK-H2 30538
484 5F7M 2 C, D Nanobody Nb-ER19 9844
485 5NBL 3 E, F nAct-Nanobody N-actin and Arp4 specific nanobody with a C-terminal double Strep-Tag. 30538
486 6U51 1 A, C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
487 6W03 2 D 35O22 scFv heavy chain 9606
488 6H15 2 C, D VHH L-P2-B10 9844
489 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
490 5F7W 2 C, D Nanobody Nb-ER19 9844
491 4YQX 1 H, N JES6-1 VH domain 10116
492 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
493 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
494 6HHU 2 G nanobody AF684 9844
495 6HHU 3 H Nanobody AF694 9844
496 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
497 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
498 4NC1 2 C, D A20.1 VHH 9844
499 4NC1 3 E, F A26.8 VHH 9844
500 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
501 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
502 2DQF 2 B, E Ig VH,anti-lysozyme 10090
503 5E7F 1 A, B, C nanobody L06 9838
504 2P46 2 B, D ANTIBODY CAB-RN05 9838
505 6QGY 2 B, D NanoB12 9844
506 6MTN 2 D 35O22 scFv heavy chain portion 9606
507 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
508 6MU7 2 D 35O22 scFv heavy chain portion 9606
509 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
510 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
511 5LHP 2 B Camelid-Derived Antibody Fragment 30538
512 6J7W 1 A, B UniAb Heavy chain Antibody 9606
513 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
514 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
515 5SV4 1 A, B Single Domain Antibody A3C8 9844
516 6Z2M 4 D, F nanobody D4 9844
517 4LGS 2 B Camelid nanobody (VHH4) 30538
518 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
519 5Y80 2 B NANOBODY 9844
520 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
521 5CBE 1 A, C E10 heavy chain 9606
522 2P47 2 B ANTIBODY CAB-RN05 9838
523 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
524 3WXW 2 H V region heavy chain 10090
525 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
526 6SC7 2 B, C Single domain antibody 32630
527 1AR1 3 C ANTIBODY FV FRAGMENT 10090
528 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
529 6GJU 2 B Nanobody T4 9844
530 6GJU 3 C Nanobody T2a 9844
531 5VNW 2 C, D Nb.b201 32630
532 1BVK 2 B, E HULYS11 FV 9606
533 6FE4 2 F, G, H, I, J Nb113 30538
534 6GS4 2 H nanobody 9844
535 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
536 6MU6 2 D 35O22 scFv heavy chain portion 9606
537 6A79 3 H, I Heavy chain of the anti-human Robo1 antibody B5209B scFv 10090
538 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
539 6CWG 2 B, D VHH antibody 30538
540 5HVF 2 B VHH-i83 30538
541 1P4I 2 H antibody variable heavy chain 10090
542 4PGJ 1 A, C Human heavy chain domain antibody 9606
543 4KDT 1 A, B Nanobody24 9835
544 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
545 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
546 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
547 6SSI 2 F, G, H, I, J NANOBODY 22 9844
548 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
549 6FYT 3 I Single domain antibody SD38 9844
550 5MJE 2 B Nanobody 8 9844
551 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
552 3OGO 2 E, F, G, H GFP-nanobody 9838
553 4C59 2 B NANOBODY 9844
554 5VXL 2 B single-domain antibody JPS-G3 30538
555 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
556 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
557 4DK6 1 A, B single domain antibody VHH 9844
558 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
559 5F7L 2 B, D Nanobody Nb-ER14 9844
560 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
561 6VEP 3 C, I, O, U Fv 83-7 heavy chain 10090
562 5HVG 2 B, D VHH-a204 30538
563 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
564 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
565 6J11 2 D, F, H VH of 7D10 10090
566 5HVH 2 B VHH-a204 30538
567 5HVH 3 C VHH-i83 30538
568 4XT1 3 C nanobody 7 30538
569 6GKD 2 B, G, J, M, P, S Nanobody D12 9844
570 6GKD 3 C, H, K, N, Q, T Nanobody G3a 9844
571 5LXG 2 H V REGION HEAVY CHAIN 10090
572 5HM1 1 A, B, C lama VHH antibody 2E7 9844
573 5NBM 3 E, F nAct-Nanobody N-actin and Arp4 binding nanobody with a C-terminal double Strep-Tag. 30538
574 5FUC 3 E, V VHH6 9838
575 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
576 3H3P 1 H, I Fv 4E10 heavy chain 9606
577 5O2U 2 B, D VHH 59H10 9844
578 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
579 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
580 5OMN 2 C Nanobody (VHH) Nano-27 30538
581 4KRP 2 B Nanobody/VHH domain 9G8 9844
582 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
583 6VZI 2 D 35O22 scFv heavy chain 9606
584 6FUZ 2 N nanobody 9844
585 4FHB 2 D Nb179 9844
586 4DK3 1 A, B single domain antibody VHH 9844
587 4KRL 1 B Nanobody/VHH domain 7D12 9844
588 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
589 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
590 6H3T 1 H, I scFv 1C11 VH 10090
591 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
592 6NNJ 2 D 35O22 scFv heavy chain 9606
593 6HJY 5 F, J nanobody 72 9844
594 6HJY 6 G, H, I nanobody 72 9844
595 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
596 6OS2 2 D Nanobody Nb.AT110i1_le 32630
597 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
598 6H16 2 B VHH L-P2-D07 9844
599 6MXT 2 N nanobody Nb71 9844
600 6QX4 2 C, E Nanobody NbAF683 9844
601 6QX4 3 D, H Nanobody NbAF694 9844
602 4LDE 2 B Camelid Antibody Fragment 9844
603 4Y5Y 1 A, D diabody 330 VH domain 9606
604 6IBL 2 C, D Camelid antibody fragment Nb80 9844
605 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
606 1BVL 1 A, C HULYS11 FV 10090
607 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
608 3RJQ 2 B Llama VHH A12 9844
609 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
610 6CF2 1 A Anti-Rev Antibody, heavy chain Fab single-chain variable fragment 9986
611 6LGW 1 A, C scFv 523-11 VH 10090
612 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
613 3LHP 1 H, I Fv 4E10 heavy chain 9606
614 6NM6 2 D 35O22 scFv heavy chain 9606
615 6NM6 7 U N6 FR3-03 heavy chain 9606
616 5Y7Z 2 C, D NANOBODY 9844
617 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
618 6CK9 2 D 35O22 scFv heavy chain portion 9606
619 6EQI 2 B Nb696 9844
620 6NNF 2 D 35O22 scFv heavy chain 9606
621 6NNF 7 U VRC01 FR3-03 heavy chain 9606
622 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
623 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
624 4KFZ 2 C, D Anti-LMO2 VH 9606
625 6GK4 2 B, E Nanobody D12 9844
626 6GK4 3 C, F Nanobody T8 9844
627 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
628 6OS1 2 D Nanobody Nb.AT110i1_le 32630
629 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
630 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
631 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
632 6H3U 1 H, I scFv 4B6 VH 10090
633 6R7T 1 A anti MAGEB1 nanobody 9844
634 4YGA 2 B, D, F, H VHH-1B7 30538
635 6MU8 2 D 35O22 scFv heavy chain portion 9606
636 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
637 2A9N 2 H, I fluorescein-scfv heavy chain 9606
638 5GS0 3 D, F heavy chain (anti-TLR3) 10090
639 5GS0 4 H, X heavy chain (anti-Lid) 10090
640 5YY5 2 H Heavy chain 9606
641 5YY5 4 C Heavy chain 9606
642 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
643 6O3C 2 B NbSmo8 9844
644 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
645 5GRJ 1 H avelumab H chain 9606
646 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
647 6MUG 2 D 35O22 scFv heavy chain portion 9606
648 6N4Y 2 E, F, G, H Nanobody 43 Nanobody 43 9844
649 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
650 6TEJ 3 C Syb_NL5 32630
651 4KRO 2 B Nanobody/VHH domain EgA1 9844
652 3WXV 2 H V region heavy chain 10090
653 6F2G 2 B Nanobody 74 9844
654 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
655 5TJW 2 K NP-specific inhibitory VHH 30538
656 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
657 6H7M 3 C, D Camelid antibody fragment Nb6B9 9844
658 6J5G 2 H antibody heavy chain 10090
659 4LDL 2 B Camelid Antibody Fragment 9844
660 6GS7 2 H nanobody 9844
661 6OYH 1 E, F, G, H MraYAA nanobody 9844
662 6MUF 2 D 35O22 scFv heavy chain portion 9606
663 4LDO 2 B Camelid Antibody Fragment 9844
664 5XJ3 1 A, D, G, J ipilimumab-VH 9606
665 6JRI 1 A, B, C, D, E, F, G, H Nanobody 30538
666 3SN6 5 N Camelid antibody VHH fragment 9844
667 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
668 4M8Q 1 A, H GEP1 Fv heavy chain 9606
669 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
670 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
671 6OS0 2 D Nanobody Nb.AT110i1 32630
672 5O8F 2 K, O Nanobody Nb25 9844
673 5O8F 3 L, M, N Nanobody Nb25 9844
674 5NQW 2 C, D 026 9844
675 5C3L 4 D Nanobody Nb15 Nanobody 9838
676 5J3H 2 C mAb 83-7 Fab heavy chain 10090
677 6VEQ 5 C, I Fv 83-7 heavy chain 10090
678 6WAR 2 B, D, F, H, J, L, N, P nanobody MERS VHH-55 9844
679 6OQ6 2 D 5D 9835
680 5U8R 2 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
681 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
682 6QV0 3 E, F Sb_TM35 sybody 32630
683 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
684 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
685 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
686 6H7J 3 C, D Camelid antibody fragment Nb80 9844
687 6IEC 2 C, F, H, J R17 H chain 9606
688 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
689 6B73 2 C, D Nanobody 9844
690 6QUZ 3 E, F Sb_TM35 sybody 32630
691 4PIR 2 F, G, H, I, J VHH15 9844
692 6Q6Z 2 B EDS1-SPECIFIC NANOBODY 9844
693 6YZ7 4 DDD, FFF Nanobody His tag 9844
694 6C5W 2 C, E nanobody 32644
695 4QKX 2 B R9 protein 9844
696 5JQH 2 C, D Nanobody60, Nb60 9844
697 6F2W 2 B Nanobody 74 9844
698 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
699 4PD4 10 J Igh protein 10090
700 6VI4 2 C, D Nanobody 6 9844
701 6N48 2 B Camelid Antibody Fragment 9835
702 6SSP 2 K, L NANOBODY 21 9844
703 6C9W 2 B Nanobody9047 Full 9844
704 6TYL 2 C, H Nanobody A 9844
705 6TYL 3 E, J Nanobody B 9844
706 6TYL 4 D, I Nanobody C 9844
707 6KNM 2 A Single domain antibody JN241 9837
708 6GS1 2 H Nanobody 00 9844
709 5DA0 2 B Nanobody 9844
710 6GCI 2 B Nanobody Nanobody selected against the BKA-inhibited ADP/ATP carrier 9844
711 6QPG 4 M, N, O, P Nanobody NB8205 9835
712 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
713 5U8Q 3 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
714 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
715 4ODX 2 A, H GEP7 Fv heavy chain 9606
716 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
717 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
718 1RVF 6 H FAB 17-IA 10090
719 6DO1 2 C, D, E, F Nanobody Nb.AT110i1 32630
720 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
721 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
722 6NFJ 2 B, E Nanobody 30 9844
723 4MQS 2 B Nanobody 9-8 9844
724 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
725 5WB2 3 D nanobody B1 32630
726 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
727 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
728 6I8H 2 B EDS1-specific nanobody 9844
729 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
730 6K68 1 A, C, F, J 3MNZ Variable heavy chain 10090
731 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
732 6QV1 3 E, F Nb_TM1 nanobody 30538
733 4MQT 2 B Nanobody 9-8 9844
734 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
735 6OZ6 1 E, F, G, H MraYAA nanobody 9844
736 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
737 6CNV 3 C SD84h 32630
738 6IW0 2 H Heavy chain of monoclonal antibody 5A 9606
739 6OYZ 1 E, F, G, H MraYAA nanobody 9844
740 6N50 2 E Nanobody 43 9844
741 6OQ5 2 D 5D 9835
742 6OQ5 3 E E3 9835
743 6OQ5 4 F 7F 9835
744 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
745 4NKO 2 B, D, F Engineered scFv heavy chain 10090
746 5EUL 4 V AYC08 30538
747 5GXB 2 B nanobody 30538
748 5NBD 2 C Nanobody 9844
749 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
750 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
751 5H8O 1 A VHH nanobody 9844
752 6QV2 3 E, F Nb_TM No.2 nanobody 30538
753 4KSD 2 B R2 protein 9844
754 6RUV 1 R, S Nanobody hFPNb1 9844
755 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
756 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
757 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
758 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
759 5TD8 5 E nanobody 30538
760 6Z43 2 X, Y, Z Nanobody 9844
761 6WPS 2 C, F, H S309 neutralizing antibody heavy chain Fab 9606
762 6WPT 2 D, H S309 neutralizing antibody heavy chain Fab 9606
763 6WHC 5 N Nanobody35 9844
764 7BUA 3 G, H, J SIgN-3C Fab heavy chain 9606
765 7BUB 1 G, H SIgN-3C Fab heavy chain 9606
766 7BUD 1 G, H SIgN-3C Fab heavy chain 9606
767 7BUE 1 G, H, J SIgN-3C Fab heavy chain 9606
768 7BUF 1 G, H SIgN-3C IgG heavy chain 9606
769 7BU8 3 G, H, J SIgN-3C Fab heavy chain 9606
770 6M1H 3 C Nanobody 35 9844
771 6M1I 3 C Nanobody 35 9844
772 6VPX 3 H, K, M Antibody 10E8 Fab heavy chain 9606
773 6VPX 6 P Antibody PGT151 Fab heavy chain 9606
774 6LPB 5 N nanobody Nb35 32644
775 6LNT 3 H, P Fab DV62.5 heavy-chain variable region 9606
776 6LMK 4 N Nb35 9844
777 6LHT 2 H heavy chain variable region of Fab 18A7 10090
778 6LHP 2 H heavy chain variable region of Fab 14B10 10090
779 6LHQ 6 H heavy chain variable region of Fab NA9D7 10090
780 6UYE 3 G, H, I Antibody rEBOV-548 Fab, heavy chain 9606
781 6UVA 4 N Nanobody 35 9844
782 6UUS 4 N Nanobody 35 9844
783 6UUN 5 N Nanobody 35 9844
784 6UKT 3 C NB8109 9844
785 6UKT 4 D NB8117 9844
786 6UKT 5 E NB8119 9844
787 6UKT 6 F NB9156 9844
788 6U59 4 F, H, K rabbit antibody 13B Fragment antigen binding heavy chain 9986
789 6TYS 2 C, F, H 5B3 antibody heavy chain 10090
790 6PB0 6 N Nanobody 35 32630
791 6PB1 6 N Nanobody 35 32630
792 6P9X 4 N Nanobody 35 9844
793 6P9Y 4 N Nanobody 35 9844
794 6RU5 3 C hC3Nb1 9844
795 6K2I 1 A camelid nanobody Nb11 30538
796 6OYA 4 N Camelid antibody VHH fragment 9844
797 6ORV 4 NP Nanobody 35 9606
798 6ORQ 3 D, H, J Ab275MUR antibody Fab heavy chain 10090
799 6RAF 3 C Anti-vesicular stomatitis virus N VHH 30538
800 6RAG 3 C Nanobody Nb9F10 30538
801 6RAH 3 C Nanobody Nb9F10 30538
802 6RAI 3 C Nanobody Nb9F10 30538
803 6RAJ 3 C Nanobody Nb9F10 30538
804 6RAK 3 C Nanobody Nb9F10 30538
805 6RAL 3 C Nanobody Nb9F10 30538
806 6RAM 3 C Nanobody Nb9F10 30538
807 6RAN 3 C Nanobody Nb9F10 Nanobody 30538
808 6QX3 3 O Nb8205 9844
809 6QXE 1 M, O Nb8205 11320
810 6NIY 2 N Nanobody35 9844
811 6NI2 1 A Nanobody 32 9844
812 6NI3 5 N Nanobody 35 9844
813 6NFC 1 C, J, K base-binding RM20A3 fragment antigen binding heavy chain 9544
814 6NFC 5 H BG18-like precursor HMP42 fragment antigen binding heavy chain 9606
815 6NF5 5 G, K, Q base-binding RM20A3 fragment antigen binding heavy chain 9544
816 6IYN 1 A Nb26 30538
817 6NBF 6 N Nanobody-35 32630
818 6NBH 6 N Nanobody-35 32630
819 6NBI 6 N Nanobody-35 32630
820 6NB3 3 D, H LCA60 heavy chain 9606
821 6NB4 2 H LCA60 heavy chain 9606
822 6NB6 2 H, I S230 heavy chain 9606
823 6NB7 2 D, G, H S230 heavy chain 9606
824 6ITC 4 V Nanobody 9844
825 6ITC 7 C Nanobody 9844
826 6N51 2 C, D Nanobody 43 9844
827 6I53 4 G Megabody38 9844
828 6N1V 7 Q, f, g VRC03 Heavy chain 9606
829 6N1W 7 8, Q, q VRC03 Heavy chain 9606
830 6MPG 4 3, W, X A12V163-b.01 Heavy Chain 9544
831 6MPH 1 1, 3, H DF1W-a.01 heavy chain 9544
832 6MID 3 H monoclonal antibody ZIKV-195 heavy chain Fab variable domain 9606
833 6IDI 3 H, I, M Fab 1H10 heavy chain (V-region) 9606
834 6IDK 3 H, I, M Fab 1H10 heavy chain (V-region) 9606
835 6IDL 3 I, M Fab 1H10 heavy chain (V-region) 9606
836 6AJ7 2 H VH of Fab 15C5 10090
837 6AJ9 2 D VH of Fab 11G1 10090
838 6AJ9 4 H VH of Fab 15C5 10090
839 6AD0 2 H VH of Fab 2G8 10090
840 6E3Y 2 N Nanobody 35 9844
841 6A96 1 K, L, O Nb25 9844
842 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
843 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
844 6DZV 2 B 15B8 antibody heavy chain Fab variable domain 10090
845 6DZW 3 H 15B8 antibody heavy chain 10090
846 6DZY 2 H 15B8 antibody heavy chain Fab variable domain 10090
847 6DZZ 2 B 15B8 antibody heavy chain Fab variable domain 10090
848 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
849 6CXC 1 G, I, X R4.C6 Fab Heavy Chain 10090
850 6CUE 3 3, H, h vFP7.04 Heavy chain 10090
851 6CUE 7 7, Q, q VRC03 Heavy chain 9606
852 6CUF 6 8, Q, q VRC03 heavy chain 9606
853 6BSP 1 A U4 Heavy chain 10090
854 6B3J 6 N Nanobody 35 9844
855 6EHG 3 C hC3Nb1 9844
856 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
857 5XS7 2 H Heavy chain of Fab 1D5 10090
858 5W3L 5 E C5 antibody variable heavy domain 10090
859 5W3M 1 E C5 antibody variable heavy domain 10090
860 5W3O 1 D C5 antibody variable heavy domain 10090
861 5W3E 1 E C5 antibody variable heavy domain 10090
862 5VAI 6 N nanobody 35 9844
863 5UZ7 4 N NANOBODY 35 9844
864 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
865 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
866 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
867 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
868 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
869 5H30 3 G, I, K IgG C10 heavy chain 9606
870 5KWL 4 7 VHH 10E 9838
871 5KTZ 4 7 VHH 12B 9838
872 5KU0 4 7 VHH 17B 9838
873 5KU2 4 7 VHH 7A 9838
874 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
875 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
876 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
877 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
878 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
879 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
880 3JCX 2 H Fab E heavy chain 10116
881 5FOJ 1 A Nanobody 9838
882 3JBC 5 7 nanobody VHH PVSP29F 9838
883 3JBD 5 7 nanobody VHH PVSP6A 9838
884 3JBE 5 7 nanobody VHH PVSS8A 9838
885 3JBF 5 7 nanobody VHH PVSP19B 9838
886 3JBG 5 7 nanobody VHH PVSS21E 9838
887 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
888 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
889 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
890 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
891 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
892 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
893 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
894 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
895 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
896 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
897 3J6U 3 H Fab 5J7 heavy chain variable region 9606
898 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
899 3IY1 2 B Fab B, heavy chain 10116
900 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
901 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
902 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
903 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
904 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
905 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
906 3IY0 2 H Fab 14, heavy domain 10090
907 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
908 1G9E 1 A H14 9844
909 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
910 1VHP 1 A VH-P8 9606