1IC5

CRYSTAL STRUCTURE OF HYHEL-10 FV MUTANT(HD99A)-HEN LYSOZYME COMPLEX


Sequence Similarity Clusters for the Entities in PDB 1IC5

Entity #1 | Chains: L
LYSOZYME BINDING IG KAPPA CHAIN protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 14 4940
95 % 16 22 2911
90 % 16 24 2736
70 % 19 29 2155
50 % 140 409 20
40 % 143 416 24
30 % 463 1346 5
Entity #2 | Chains: H
IGG1 FAB CHAIN H protein, length: 114 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 71854
95 % 16 22 2917
90 % 16 22 2997
70 % 17 34 1621
50 % 317 889 4
40 % 319 913 5
30 % 464 1346 5
Entity #3 | Chains: Y
LYSOZYME C protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 657 786 3
95 % 708 839 5
90 % 719 856 6
70 % 725 863 11
50 % 937 1091 8
40 % 940 1097 10
30 % 959 1128 16

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 6JB9 1 A Nanobody D3-L11 9838
4 5E7B 1 A nanobody nano-L06 9838
5 2P45 2 B ANTIBODY CAB-RN05 9838
6 6OSH 3 H Antibody heavy chain variable region 9986
7 2X1Q 1 A, B GELSOLIN NANOBODY 9844
8 5U64 1 B VHH-28 9838
9 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
10 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
11 4B41 1 A, B ANTIBODY G7 9844
12 5IMM 1 B Nanobody 9835
13 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
14 6HER 2 B Nanobody 484 9838
15 5NLU 1 A single domain llama antibody Nb36 9844
16 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
17 5IMK 1 B Nanobody 9835
18 6CWK 1 A Anti-Ricin antibody 30538
19 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
20 4B50 1 A 2H10 LLAMA VHH 9844
21 6HEQ 1 A Prion nanobody 484 9838
22 6U14 1 A, B VHH R303 C33A/C102A mutant 9838
23 6DBA 1 A, B nanobody VHH R303 9838
24 6RU3 1 C hFP1Nb1 9844
25 2XT1 2 B CAMELID VHH 9 30538
26 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
27 6OSV 3 H Antibody heavy chain variable region 9986
28 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
29 5J1S 3 C VHH domain BS-2 30538
30 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
31 5J1T 3 C VHH domain BS-2 30538
32 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
33 6JB2 1 A Nanobody D3-L11 9838
34 6J9O 1 H Heavy chain of AF4H1K1 scFv 9606
35 2X1O 1 A, B GELSOLIN NANOBODY 9844
36 4QGY 1 A, B nanobody n25, VH domain 9844
37 5VNV 1 A Nb.b201 32630
38 6J14 1 A GY-14 heavy chain V fragment 10090
39 5DXW 1 A PD-L1 nanobody 9835
40 6IR2 2 B mCherry's nanobody LaM2 9837
41 4N9O 2 B Nanobody Nb484 Nb484 9844
42 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
43 6JB5 1 A Nanobody D3-L11 9838
44 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
45 1T2J 1 A M12-Variable Heavy domain 9606
46 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
47 6DBF 2 B InlB specific VHH R303 9838
48 6SGE 2 B, D Nanobody B6 9606
49 6DBG 2 C, D VHH R303 9838
50 6I2G 1 A ALFA nanobody 30538
51 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
52 5VM6 1 A single domain camelid nanobody VHH T10 9844
53 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
54 4KML 2 B Nanobody 9844
55 6DYX 1 D VHH R419 30538
56 4Z9K 2 B VHH2(F5) antibody 30538
57 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
58 5LMW 1 A Nanobody 9844
59 5NM0 1 A, B, C, D Nb36 9844
60 6U53 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire C (ZC) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
61 6H6Y 2 E, F, G, H Nanobody (VHH) Nano-7 30538
62 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
63 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
64 4PPT 1 A Engineered single domain VHH antibody 9844
65 3R0M 1 A, B Llama VHH A12 9844
66 3ZKQ 2 D XA4813 9844
67 4I13 2 B Protein ca1697 (nanobody) 9844
68 5C2U 1 B Nanobody Nanobody 9838
69 1XFP 1 A heavy chain antibody VHH domain 9838
70 6U12 2 B VHH R303 C33A/C102A mutant 9838
71 4POY 1 A VHH-metal 9844
72 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
73 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
74 5NLW 1 A nanobody Nb36 9844
75 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
76 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
77 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
78 3G9A 2 B Minimizer 9838
79 6P79 1 H Engineered antibody heavy chain 10090
80 6U50 1 C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
81 6U54 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire C (ZC) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
82 2P43 2 B ANTIBODY CAB-RN05 9838
83 4KRN 1 A Nanobody/VHH domain EgA1 9844
84 4GFT 2 B Nanobody 9844
85 4TVS 2 a, b VHH Domain BS-1 30538
86 4W6Y 2 B Nanobody NbFedF9 9844
87 6EZW 1 B VHH antibody BCD090-M2 9844
88 6ITP 1 A, B anti-cortisol camelid antibody 9837
89 1UAC 2 H Ig VH,anti-lysozyme 10090
90 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
91 6JB8 1 A Nanobody D3-L11 9838
92 6K65 3 H 1P4B variable heavy chain 10090
93 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
94 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
95 6ITQ 1 A, B, C, D anti-cortisol camelid antibody 9837
96 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
97 5O02 2 C Nanobody (VHH) Nano-4 30538
98 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
99 6JSZ 2 D XAPERONE 9606
100 4X7F 2 C, D Nano-25 Nanobody 30538
101 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
102 4LGR 2 B Camelid nanobody (VHH3) 30538
103 5J57 2 B VHH single chain antibody V5E1 30538
104 6BA5 2 B, D, F, H Variable domain Heavy chain, antibody R11 9606
105 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
106 5OMM 2 C Nanobody (VHH) Nano-14 30538
107 5E03 1 A CTLA-4 nanobody 9835
108 5LZ0 1 A, B PorM nanobody 9844
109 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
110 6DBE 1 A, B nanobody VHH R303 9844
111 6XW5 2 C, D Nanobody NB-5820 30538
112 2XXC 1 B CAMELID VHH 9 30538
113 3QYC 1 A, B VH domain of IgG molecule 9606
114 5VAK 2 B Nb914 Nanobody 9844
115 2XXM 2 B CAMELID VHH 9 30538
116 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
117 6LR7 2 B Nanobody LaG16 9837
118 6T2J 1 A, B Single domain antibody 32630
119 6DBD 1 A, B, C, D nanobody VHH R326 9844
120 5JDS 1 B Nanobody 9835
121 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
122 6OBE 2 B VHH antibody V6H8 30538
123 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
124 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
125 5L21 2 B VHH-C2 30538
126 5FWO 1 A NANOBODY 9844
127 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
128 3B9V 1 A, B, C, D heavy chain variable domain 9606
129 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
130 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
131 5N88 1 A, H VH59 antibody 9606
132 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
133 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
134 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
135 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
136 4POU 2 B VHH Antibody 9844
137 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
138 6J5D 2 H antibody heavy chain 10090
139 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
140 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
141 6H70 2 C, D Nanobody (VHH) Nano-62 30538
142 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
143 2P42 2 B, D ANTIBODY CAB-RN05 9838
144 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
145 4QLR 1 A, B Llama nanobody n02 VH domain 9844
146 5J56 2 B VHH single chain antibody V1C7 30538
147 6OBC 2 B VHH antibody 30538
148 6J5F 2 H antibody heavy chain 10090
149 4NBX 2 B A20.1 VHH 9844
150 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
151 4HEP 2 G vHH17 domain 9844
152 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
153 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
154 5IML 2 B Nanobody 9835
155 3A6C 2 H IG VH, anti-lysozyme 10090
156 2DQD 2 H Ig VH,anti-lysozyme 10090
157 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
158 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
159 3A67 2 H IG VH, anti-lysozyme 10090
160 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
161 1J1X 2 H Ig VH,anti-lysozyme 10090
162 5M2J 2 D Anti-(ED-B) scFV 9606
163 2DQC 2 H Ig VH,anti-lysozyme 10090
164 1J1O 2 H Ig VH,anti-lysozyme 10090
165 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
166 4M62 2 H, I GEP2 FV heavy chain 9606
167 5IVO 1 A BC2-nanobody 30538
168 1J1P 2 H Ig VH,anti-lysozyme 10090
169 6S0Y 1 A, B M2e-VHH-23m 9844
170 4NBZ 2 B, D A26.8 VHH 9844
171 5AYU 2 H Ig VH,anti-lysozyme 10090
172 3A6B 2 H IG VH, anti-lysozyme 10090
173 2DQJ 2 H Ig VH,anti-lysozyme 10090
174 5F21 2 B nanobody MU375 9844
175 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
176 2P44 2 B ANTIBODY CAB-RN05 9838
177 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
178 5TP3 1 A, B F-VHH-4 9844
179 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
180 4LHJ 2 B Camelid antibody 30538
181 4BEL 2 D, E XA4813 9844
182 5M7Q 1 A, B Nanobody NbD2 9838
183 5H8D 1 A VHH nanobody 9844
184 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
185 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
186 3DUR 2 B, D Ig-like protein 10090
187 2XV6 2 B, D CAMELID VHH 9 30538
188 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
189 5VM0 1 A, B Camelid Nanobody VHH T9 9844
190 4ZG1 1 A, B, C, D, E, F NB17 9844
191 6BAN 2 B, D, F, H Variable domain R11 Heavy chain 9606
192 4I1N 2 B Protein ca1697 (nanobody) 9844
193 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
194 6F0D 1 A, B VHH antibody BCD090-M2 9844
195 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
196 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
197 4W6X 2 B Nanobody NbFedF7 9844
198 5JA9 2 A, B Nanobody 6 9844
199 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
200 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
201 1OP9 1 A HL6 camel VHH fragment 9838
202 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
203 4LRN 1 H GEP 1 heavy chain 9606
204 4S11 1 A GELSOLIN NANOBODY 9844
205 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
206 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
207 6RTW 2 B Llama-derived nanobody NB64 9844
208 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
209 6IR1 2 B mCherry's nanobody LaM4 9837
210 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
211 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
212 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
213 6RNK 2 B Nanobody6 30538
214 4Y7M 1 A, B Hi113 protein 9844
215 5JMO 2 C, D camelid VHH fragment 9838
216 6GJS 2 B Nanobody D12 9844
217 6GJS 3 C Nanobody T4 9844
218 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
219 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
220 4B5E 1 A, B PS2-8 9844
221 2DQE 2 H Ig VH,anti-lysozyme 10090
222 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
223 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
224 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
225 4X7C 2 C, D Nano-85 Nanobody VHH 30538
226 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
227 3EBA 1 A CAbHul6 9838
228 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
229 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
230 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
231 5VM4 1 A, B, C, D, E, F, G, H, I, J, K, L Single domain camelid nanobody VHH T10 9844
232 6U52 1 A, C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
233 6QGW 2 B NanoE6 9844
234 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
235 4I0C 2 C, D cAbHuL5 antibody 9838
236 6H1F 1 A gelsolin nanobody, Nb11 9844
237 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
238 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
239 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
240 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
241 5BOP 1 A, C Nanobody 9844
242 6U55 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire E (ZE) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
243 4DKA 1 A, B single domain antibody VHH 9844
244 5O05 1 C, D Nanobody (VHH) Nano-42 30538
245 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
246 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
247 3DUU 2 B, D Ig-like protein 10090
248 6OBO 2 C, D VHH antibody V6A6 30538
249 3K74 2 B Nanobody 9844
250 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
251 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
252 6A3W 1 A, D, G, J utomilumab VH 9606
253 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
254 6UL6 3 C ciA-H7 30538
255 6OBG 2 C, D VHH antibody V8E6 30538
256 1SJV 1 A r9 llama VHH single domain antibody 9844
257 6CK8 1 A, B, C Llama antibody SD38 9844
258 6XW6 2 C, D Nanobody NB-5853 30538
259 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
260 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
261 6GZP 1 A Nanobody 9844
262 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
263 6H6Z 2 C, D Nanobody (VHH) Nano-62 30538
264 1UA6 2 H Ig VH,anti-lysozyme 10090
265 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
266 4W68 1 A, B Single domain antibody 9844
267 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
268 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
269 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
270 3EAK 1 A, B NbBCII10-FGLA 9838
271 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
272 4ORZ 3 C single domain antibody sdAb19 9844
273 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
274 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
275 6DN0 1 A, C Human Variable Heavy Chain of Herceptin containing VH mutation K30D 9606
276 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
277 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
278 6IBB 2 B, D Nanobody6 30538
279 6XW7 2 C, D, G, H Nanobody NB-5829 30538
280 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
281 5C1M 2 B Nanobody 39 9844
282 5F7K 2 C, D Nanobody Nb-ER19 9844
283 5LMJ 1 A, B, C, D nanobody 9844
284 5E1H 2 B F8(JOB10) VHH antibody 30538
285 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
286 6OCD 2 B, D VHH antibody V6D4 30538
287 4OCM 3 C, F Nb1 9844
288 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
289 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
290 4X7E 2 C, D Nano-85 Nanobody 30538
291 5F1O 2 B nanobody MU551 9844
292 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
293 5O03 2 C, D Nanobody (VHH) Nano-32 9844
294 6GWN 2 B VHH-2g-42 30538
295 6GWN 3 C VHH-2w-64 30538
296 2DQI 2 H Ig VH,anti-lysozyme 10090
297 4Y8D 2 C, D nanobody 9844
298 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
299 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
300 6XW4 2 C, D Nanobody NB-5867 30538
301 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
302 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
303 4C58 2 B nanobody 9844
304 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
305 3DV6 2 B Ig-like protein 10090
306 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
307 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
308 5VXM 2 B Single-domain antibody 20ipaD 30538
309 4XVJ 2 H antibody heavy chain variable domain 9606
310 4IDL 1 A Single Domain Antibody VHH A9 9844
311 6UI1 2 B ciA-H7 30538
312 6UI1 3 C ciA-D12 30538
313 6UI1 4 D ciA-B5 30538
314 1JV5 2 B Ig chain heavy chain precursor V region 9606
315 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
316 3K7U 1 A Antibody 9844
317 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
318 6KSN 1 A, B ICab3 9838
319 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
320 4NBY 2 B, C A20.1 VHH 9844
321 6HHD 2 B Nanobody 484 9838
322 6HHD 4 D Nanobody 484 9838
323 4X7D 2 C, D Nano-85 Nanobody VHH 9844
324 5VAN 2 B Nb914 Nanobody 9844
325 5F7N 2 C, D Nanobody Nb-ER19 30538
326 5OCL 1 A, C, F, H anti-llama nanobody 30538
327 5OCL 2 B, D, E, G anti-vglut nanobody 9844
328 2A9M 2 H, I fluorescein-scfv heavy chain 9606
329 6OC8 1 A, B, C, D VHH8c 9844
330 5E5M 2 B, D, F, H CTLA-4 nanobody 9835
331 1SJX 1 A immunoglobulin VH domain 9844
332 3ZKS 2 D XA4813 9844
333 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
334 6H72 2 C, D Nanobody (VHH) Nano-94 30538
335 6OCA 2 C, D VHH antibody V2G10 30538
336 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
337 6UHT 2 C, D JLI-G10 30538
338 5MY6 2 B Nanobody 2Rs15d 9838
339 6RTY 2 B Llama-derived nanobody NB64 Nanobody NB64 containing a C-terminal His6-Tag for purification 9844
340 3DUS 2 B, D Ig-like protein 10090
341 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
342 6F5G 2 B VHH minibody anti-Cter PCSK9 VHH from immunization of Llama from E. coli expression 9844
343 5M2I 2 G, H, I, J, K, L VHH1 9844
344 6OQ8 2 C, D 7F 9835
345 6SC5 2 B, C Single domain antibody 32630
346 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
347 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
348 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
349 6SC8 2 B, C Single domain antibody 32630
350 3K1K 2 C, D Enhancer 9838
351 4U7S 1 A, B sdAb A3 9844
352 6WAQ 1 A, C nanobody SARS VHH-72 9844
353 4U3X 1 A, C Human VH domain antibody 9606
354 4W81 1 A Single Domain Antibody 9844
355 5GRV 1 L homo-specific diabody heavy chain 9606
356 5JMR 1 A, B camelid VHH fragment 9838
357 6RVC 2 D, E, F Nanobody NB75 Llama nanobody NB75 containing a a C-terminal His6-Tag for IMAC purification. 9844
358 4W70 1 A Single Domain Antibody 9844
359 6QTL 1 A, D, E, H VHH 9835
360 6QTL 2 B, C, F, G VHH 9835
361 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
362 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
363 4BFB 2 D, E XA4813 9844
364 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
365 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
366 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
367 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
368 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
369 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
370 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
371 6SC6 2 B, C Single domain antibody 32630
372 4LHQ 2 B, D Camelid nanobody 30538
373 3DV4 2 B Ig-like protein 10090
374 6H71 2 C, D Nanobody (VHH) Nano-94 30538
375 6OL7 1 A, E, K, P iv8 Heavy Chain 10090
376 6OL7 3 C, H, I, M glVRC01 Heavy Chain 9606
377 3ZKX 2 B XA4813 9844
378 3ZKX 3 C XA4815 9844
379 6I6J 2 C Sybody 32644
380 5F1K 2 C, D nanobody MU1053 9844
381 6A78 3 H, I Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv 10090
382 3ZLQ 2 C, D XA4813 9844
383 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
384 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
385 6GWP 2 B VHH-2g-42 30538
386 6GWP 3 C VHH-2w-64 30538
387 4NC0 2 B A26.8 VHH 9844
388 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
389 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
390 5GS1 2 B, N, P, R heavy chain 9606
391 5F7Y 3 C, D Nanobody Nb-ER19 9844
392 2DQG 2 H Ig VH,anti-lysozyme 10090
393 6I8G 2 B EDS1-specific nanobody 9844
394 5IMO 1 B Nanobody 9835
395 5U65 1 A, B VHH-5 9838
396 4TYU 1 A, B Single Domain Antibody 9844
397 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
398 2DQH 2 H Ig VH,anti-lysozyme 10090
399 4AQ1 2 B, D NBKB6 VHH 9844
400 6FV0 2 F nanobody 9844
401 4EIG 2 B CA1698 camel antibody fragment 9844
402 3EHB 3 C FV fragment Chain H 10090
403 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
404 3HB3 3 C ANTIBODY FV FRAGMENT 10090
405 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
406 6GWQ 2 B VHH-2g-42 30538
407 6QGX 2 B NanoF7 9844
408 2X89 1 A, B, C ANTIBODY 9838
409 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
410 5O04 2 E, F Nanobody (VHH) Nano-26 30538
411 5O04 3 C, D Nanobody (VHH) Nano-85 30538
412 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
413 3P9W 2 B, D, F, H human VEGF 9606
414 6OQ7 2 C E3 9835
415 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
416 5F8R 2 C, D Nanobody Nb-ER19 9844
417 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
418 4OCL 3 C, F Nb1 9844
419 4RAV 2 A, C single-chain Fv, VH 9606
420 5XJ4 2 H durvalumab-VH 9606
421 5LWY 2 H V REGION HEAVY CHAIN 10090
422 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
423 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
424 4IOS 2 D, E, F, G Llama nanobody 11 9844
425 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
426 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
427 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
428 4C57 2 C, D NANOBODY 9844
429 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
430 6OL6 3 H iglb12 Heavy Chain 9606
431 4OCN 3 C, F Nb1 9844
432 4GRW 3 E, G Nanobody 124C4 9844
433 4GRW 4 F, J Nanobody 37D5 9844
434 4GRW 5 H, I Nanobody 22E11 9844
435 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
436 4NC2 2 B B39 VHH 9844
437 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
438 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
439 6IVZ 2 H Heavy chain of monoclonal antibody 5A 9606
440 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
441 6EY0 2 E, G, H llama nanobody nb01 9844
442 6EY0 3 F llama nanobody nb01 9844
443 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
444 5F9A 2 C Nanobody Nb-ER19 9844
445 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
446 6GJQ 2 B, D, F, H Nanobody T27 9844
447 5CBA 1 A, C 3b4 heavy chain 9606
448 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
449 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
450 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
451 2OTW 2 B, D Fv heavy chain variable domain VH 10090
452 3STB 1 A, B single domain antibody VHH 9844
453 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
454 4W6W 2 B NbFedF6 9844
455 5JA8 2 B, D, F, H Nanobody 2 9844
456 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
457 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
458 1P4B 2 H Antibody Variable heavy chain 10090
459 5U4M 2 B V1C7 VHH antibody 30538
460 5O0W 2 E, F, G, H Nb474 30538
461 4Y5V 1 A, D, G diabody 305 VH domain 9606
462 6HJX 6 F, G, H, I, J nanobody 72 9844
463 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
464 6SC9 2 B, C Single domain antibody 32630
465 6MTJ 2 D 35O22 scFv heavy chain portion 9606
466 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
467 3V0A 3 C Llama antibody F12 9844
468 6FYU 3 C, F, I Single domain antibody SD36 9844
469 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
470 3K80 1 A, B Antibody 9844
471 5VAQ 2 B Nb914 Nanobody 9844
472 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
473 5F8Q 2 C, D Nanobody Nb-ER19 9844
474 4U05 1 A, B Single Domain Antibody 9844
475 6OBM 2 B VHH antibody V6A7 30538
476 6RBB 1 H, I, J, K VHH domain of netakimab 9844
477 5F9D 2 C Nanobody Nb-ER19 9844
478 4LGP 2 B, D VHH1 camelid nanobody 30538
479 2P48 2 B ANTIBODY CAB-RN05 9838
480 5U4L 2 B V1C7 VHH antibody G29R variant 30538
481 5VXK 1 B single-domain antibody JMK-H2 30538
482 5F7M 2 C, D Nanobody Nb-ER19 9844
483 5NBL 3 E, F nAct-Nanobody N-actin and Arp4 specific nanobody with a C-terminal double Strep-Tag. 30538
484 6U51 1 A, C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
485 6W03 2 D 35O22 scFv heavy chain 9606
486 6H15 2 C, D VHH L-P2-B10 9844
487 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
488 5F7W 2 C, D Nanobody Nb-ER19 9844
489 4YQX 1 H, N JES6-1 VH domain 10116
490 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
491 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
492 6HHU 2 G nanobody AF684 9844
493 6HHU 3 H Nanobody AF694 9844
494 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
495 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
496 4NC1 2 C, D A20.1 VHH 9844
497 4NC1 3 E, F A26.8 VHH 9844
498 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
499 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
500 2DQF 2 B, E Ig VH,anti-lysozyme 10090
501 5E7F 1 A, B, C nanobody L06 9838
502 2P46 2 B, D ANTIBODY CAB-RN05 9838
503 6QGY 2 B, D NanoB12 9844
504 6MTN 2 D 35O22 scFv heavy chain portion 9606
505 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
506 6MU7 2 D 35O22 scFv heavy chain portion 9606
507 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
508 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
509 5LHP 2 B Camelid-Derived Antibody Fragment 30538
510 6J7W 1 A, B UniAb Heavy chain Antibody 9606
511 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
512 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
513 5SV4 1 A, B Single Domain Antibody A3C8 9844
514 4LGS 2 B Camelid nanobody (VHH4) 30538
515 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
516 5Y80 2 B NANOBODY 9844
517 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
518 5CBE 1 A, C E10 heavy chain 9606
519 2P47 2 B ANTIBODY CAB-RN05 9838
520 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
521 3WXW 2 H V region heavy chain 10090
522 3K3Q 1 A llama Aa1 VHH domain 9844
523 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
524 6SC7 2 B, C Single domain antibody 32630
525 1AR1 3 C ANTIBODY FV FRAGMENT 10090
526 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
527 6GJU 2 B Nanobody T4 9844
528 6GJU 3 C Nanobody T2a 9844
529 5VNW 2 C, D Nb.b201 32630
530 1BVK 2 B, E HULYS11 FV 9606
531 6FE4 2 F, G, H, I, J Nb113 30538
532 6GS4 2 H nanobody 9844
533 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
534 6MU6 2 D 35O22 scFv heavy chain portion 9606
535 6A79 3 H, I Heavy chain of the anti-human Robo1 antibody B5209B scFv 10090
536 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
537 6CWG 2 B, D VHH antibody 30538
538 5HVF 2 B VHH-i83 30538
539 1P4I 2 H antibody variable heavy chain 10090
540 4PGJ 1 A, C Human heavy chain domain antibody 9606
541 4KDT 1 A, B Nanobody24 9835
542 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
543 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
544 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
545 6SSI 2 F, G, H, I, J NANOBODY 22 9844
546 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
547 6FYT 3 I Single domain antibody SD38 9844
548 5MJE 2 B Nanobody 8 9844
549 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
550 3OGO 2 E, F, G, H GFP-nanobody 9838
551 4C59 2 B NANOBODY 9844
552 5VXL 2 B single-domain antibody JPS-G3 30538
553 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
554 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
555 4DK6 1 A, B single domain antibody VHH 9844
556 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
557 1CL7 2 H PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain)) FAB 10090
558 5F7L 2 B, D Nanobody Nb-ER14 9844
559 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
560 5HVG 2 B, D VHH-a204 30538
561 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
562 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
563 6J11 2 D, F, H VH of 7D10 10090
564 5HVH 2 B VHH-a204 30538
565 5HVH 3 C VHH-i83 30538
566 4XT1 3 C nanobody 7 30538
567 6GKD 2 B, G, J, M, P, S Nanobody D12 9844
568 6GKD 3 C, H, K, N, Q, T Nanobody G3a 9844
569 5LXG 2 H V REGION HEAVY CHAIN 10090
570 5HM1 1 A, B, C lama VHH antibody 2E7 9844
571 5NBM 3 E, F nAct-Nanobody N-actin and Arp4 binding nanobody with a C-terminal double Strep-Tag. 30538
572 5FUC 3 E, V VHH6 9838
573 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
574 3H3P 1 H, I Fv 4E10 heavy chain 9606
575 5O2U 2 B, D VHH 59H10 9844
576 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
577 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
578 5OMN 2 C Nanobody (VHH) Nano-27 30538
579 4KRP 2 B Nanobody/VHH domain 9G8 9844
580 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
581 6VZI 2 D 35O22 scFv heavy chain 9606
582 6FUZ 2 N nanobody 9844
583 4FHB 2 D Nb179 9844
584 4DK3 1 A, B single domain antibody VHH 9844
585 4KRL 1 B Nanobody/VHH domain 7D12 9844
586 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
587 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
588 6H3T 1 H, I scFv 1C11 VH 10090
589 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
590 6NNJ 2 D 35O22 scFv heavy chain 9606
591 6HJY 5 F, J nanobody 72 9844
592 6HJY 6 G, H, I nanobody 72 9844
593 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
594 6OS2 2 D Nanobody Nb.AT110i1_le 32630
595 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
596 6H16 2 B VHH L-P2-D07 9844
597 6MXT 2 N nanobody Nb71 9844
598 6QX4 2 C, E Nanobody NbAF683 9844
599 6QX4 3 D, H Nanobody NbAF694 9844
600 4LDE 2 B Camelid Antibody Fragment 9844
601 4Y5Y 1 A, D diabody 330 VH domain 9606
602 6IBL 2 C, D Camelid antibody fragment Nb80 9844
603 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
604 1BVL 1 A, C HULYS11 FV 10090
605 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
606 3RJQ 2 B Llama VHH A12 9844
607 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
608 6CF2 1 A Anti-Rev Antibody, heavy chain Fab single-chain variable fragment 9986
609 6LGW 1 A, C scFv 523-11 VH 10090
610 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
611 3LHP 1 H, I Fv 4E10 heavy chain 9606
612 6NM6 2 D 35O22 scFv heavy chain 9606
613 6NM6 7 U N6 FR3-03 heavy chain 9606
614 5Y7Z 2 C, D NANOBODY 9844
615 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
616 6CK9 2 D 35O22 scFv heavy chain portion 9606
617 6EQI 2 B Nb696 9844
618 6NNF 2 D 35O22 scFv heavy chain 9606
619 6NNF 7 U VRC01 FR3-03 heavy chain 9606
620 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
621 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
622 4KFZ 2 C, D Anti-LMO2 VH 9606
623 6GK4 2 B, E Nanobody D12 9844
624 6GK4 3 C, F Nanobody T8 9844
625 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
626 6OS1 2 D Nanobody Nb.AT110i1_le 32630
627 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
628 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
629 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
630 6H3U 1 H, I scFv 4B6 VH 10090
631 6R7T 1 A anti MAGEB1 nanobody 9844
632 4YGA 2 B, D, F, H VHH-1B7 30538
633 6MU8 2 D 35O22 scFv heavy chain portion 9606
634 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
635 2A9N 2 H, I fluorescein-scfv heavy chain 9606
636 5GS0 3 D, F heavy chain (anti-TLR3) 10090
637 5GS0 4 H, X heavy chain (anti-Lid) 10090
638 5YY5 2 H Heavy chain 9606
639 5YY5 4 C Heavy chain 9606
640 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
641 6O3C 2 B NbSmo8 9844
642 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
643 5GRJ 1 H avelumab H chain 9606
644 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
645 6MUG 2 D 35O22 scFv heavy chain portion 9606
646 6IW2 2 B, E, H, K, N, Q Heavy chain of monoclonal antibody 5A 9606
647 6N4Y 2 E, F, G, H Nanobody 43 Nanobody 43 9844
648 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
649 6TEJ 3 C Syb_NL5 32630
650 4KRO 2 B Nanobody/VHH domain EgA1 9844
651 3WXV 2 H V region heavy chain 10090
652 6F2G 2 B Nanobody 74 9844
653 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
654 5TJW 2 K NP-specific inhibitory VHH 30538
655 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
656 6H7M 3 C, D Camelid antibody fragment Nb6B9 9844
657 6J5G 2 H antibody heavy chain 10090
658 4LDL 2 B Camelid Antibody Fragment 9844
659 6GS7 2 H nanobody 9844
660 6OYH 1 E, F, G, H MraYAA nanobody 9844
661 6MUF 2 D 35O22 scFv heavy chain portion 9606
662 4LDO 2 B Camelid Antibody Fragment 9844
663 5XJ3 1 A, D, G, J ipilimumab-VH 9606
664 6JRI 1 A, B, C, D, E, F, G, H Nanobody 30538
665 3SN6 5 N Camelid antibody VHH fragment 9844
666 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
667 4M8Q 1 A, H GEP1 Fv heavy chain 9606
668 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
669 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
670 6OS0 2 D Nanobody Nb.AT110i1 32630
671 5O8F 2 K, O Nanobody Nb25 9844
672 5O8F 3 L, M, N Nanobody Nb25 9844
673 5NQW 2 C, D 026 9844
674 5C3L 4 D Nanobody Nb15 Nanobody 9838
675 5J3H 2 C mAb 83-7 Fab heavy chain 10090
676 6WAR 2 B, D, F, H, J, L, N, P nanobody MERS VHH-55 9844
677 6OQ6 2 D 5D 9835
678 5U8R 2 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
679 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
680 6QV0 3 E, F Sb_TM35 sybody 32630
681 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
682 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
683 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
684 6H7J 3 C, D Camelid antibody fragment Nb80 9844
685 6IEC 2 C, F, H, J R17 H chain 9606
686 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
687 6B73 2 C, D Nanobody 9844
688 6QUZ 3 E, F Sb_TM35 sybody 32630
689 4PIR 2 F, G, H, I, J VHH15 9844
690 6Q6Z 2 B EDS1-SPECIFIC NANOBODY 9844
691 5XWD 2 H VH chain of 059-152 9606
692 6C5W 2 C, E nanobody 32644
693 4QKX 2 B R9 protein 9844
694 5JQH 2 C, D Nanobody60, Nb60 9844
695 6F2W 2 B Nanobody 74 9844
696 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
697 4PD4 10 J Igh protein 10090
698 6VI4 2 C, D Nanobody 6 9844
699 6N48 2 B Camelid Antibody Fragment 9835
700 6SSP 2 K, L NANOBODY 21 9844
701 6C9W 2 B Nanobody9047 Full 9844
702 6TYL 2 C, H Nanobody A 9844
703 6TYL 3 E, J Nanobody B 9844
704 6TYL 4 D, I Nanobody C 9844
705 6KNM 2 A Single domain antibody JN241 9837
706 6GS1 2 H Nanobody 00 9844
707 5DA0 2 B Nanobody 9844
708 6GCI 2 B Nanobody Nanobody selected against the BKA-inhibited ADP/ATP carrier 9844
709 6QPG 4 M, N, O, P Nanobody NB8205 9835
710 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
711 5U8Q 3 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
712 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
713 4ODX 2 A, H GEP7 Fv heavy chain 9606
714 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
715 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
716 1RVF 6 H FAB 17-IA 10090
717 6DO1 2 C, D, E, F Nanobody Nb.AT110i1 32630
718 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
719 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
720 6NFJ 2 B, E Nanobody 30 9844
721 4MQS 2 B Nanobody 9-8 9844
722 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
723 5WB2 3 D nanobody B1 32630
724 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
725 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
726 6I8H 2 B EDS1-specific nanobody 9844
727 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
728 6K68 1 A, C, F, J 3MNZ Variable heavy chain 10090
729 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
730 6QV1 3 E, F Nb_TM1 nanobody 30538
731 4MQT 2 B Nanobody 9-8 9844
732 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
733 6OZ6 1 E, F, G, H MraYAA nanobody 9844
734 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
735 6CNV 3 C SD84h 32630
736 6IW0 2 H Heavy chain of monoclonal antibody 5A 9606
737 6OYZ 1 E, F, G, H MraYAA nanobody 9844
738 6N50 2 E Nanobody 43 9844
739 6OQ5 2 D 5D 9835
740 6OQ5 3 E E3 9835
741 6OQ5 4 F 7F 9835
742 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
743 4NKO 2 B, D, F Engineered scFv heavy chain 10090
744 5EUL 4 V AYC08 30538
745 6NIU 1 F, H, I, M Human MZ4 Fab heavy chain 9606
746 5GXB 2 B nanobody 30538
747 5NBD 2 C Nanobody 9844
748 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
749 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
750 5H8O 1 A VHH nanobody 9844
751 6QV2 3 E, F Nb_TM No.2 nanobody 30538
752 4KSD 2 B R2 protein 9844
753 6RUV 1 R, S Nanobody hFPNb1 9844
754 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
755 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
756 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
757 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
758 5TD8 5 E nanobody 30538
759 7BUA 3 G, H, J SIgN-3C Fab heavy chain 9606
760 7BUB 1 G, H SIgN-3C Fab heavy chain 9606
761 7BUD 1 G, H SIgN-3C Fab heavy chain 9606
762 7BUE 1 G, H, J SIgN-3C Fab heavy chain 9606
763 7BUF 1 G, H SIgN-3C IgG heavy chain 9606
764 7BU8 3 G, H, J SIgN-3C Fab heavy chain 9606
765 6M1H 3 C Nanobody 35 9844
766 6M1I 3 C Nanobody 35 9844
767 6VPX 3 H, K, M Antibody 10E8 Fab heavy chain 9606
768 6VPX 6 P Antibody PGT151 Fab heavy chain 9606
769 6LPB 5 N nanobody Nb35 32644
770 6LNT 3 H, P Fab DV62.5 heavy-chain variable region 9606
771 6LMK 4 N Nb35 9844
772 6LHT 2 H heavy chain variable region of Fab 18A7 10090
773 6LHP 2 H heavy chain variable region of Fab 14B10 10090
774 6LHQ 6 H heavy chain variable region of Fab NA9D7 10090
775 6UYE 3 G, H, I Antibody rEBOV-548 Fab, heavy chain 9606
776 6UVA 4 N Nanobody 35 9844
777 6UUS 4 N Nanobody 35 9844
778 6UUN 5 N Nanobody 35 9844
779 6UKT 3 C NB8109 9844
780 6UKT 4 D NB8117 9844
781 6UKT 5 E NB8119 9844
782 6UKT 6 F NB9156 9844
783 6U59 4 F, H, K rabbit antibody 13B Fragment antigen binding heavy chain 9986
784 6TYS 2 C, F, H 5B3 antibody heavy chain 10090
785 6PB0 6 N Nanobody 35 32630
786 6PB1 6 N Nanobody 35 32630
787 6P9X 4 N Nanobody 35 9844
788 6P9Y 4 N Nanobody 35 9844
789 6RU5 3 C hC3Nb1 9844
790 6K2I 1 A camelid nanobody Nb11 30538
791 6OYA 4 N Camelid antibody VHH fragment 9844
792 6ORV 4 NP Nanobody 35 9606
793 6ORQ 3 D, H, J Ab275MUR antibody Fab heavy chain 10090
794 6RAF 3 C Anti-vesicular stomatitis virus N VHH 30538
795 6RAG 3 C Nanobody Nb9F10 30538
796 6RAH 3 C Nanobody Nb9F10 30538
797 6RAI 3 C Nanobody Nb9F10 30538
798 6RAJ 3 C Nanobody Nb9F10 30538
799 6RAK 3 C Nanobody Nb9F10 30538
800 6RAL 3 C Nanobody Nb9F10 30538
801 6RAM 3 C Nanobody Nb9F10 30538
802 6RAN 3 C Nanobody Nb9F10 Nanobody 30538
803 6QX3 3 O Nb8205 9844
804 6QXE 1 M, O Nb8205 11320
805 6NN3 2 H Fab monoclonal antibody 860-55D, heavy chain 9606
806 6NIY 2 N Nanobody35 9844
807 6NIJ 1 H PGT145 Fab heavy chain 9606
808 6NI2 1 A Nanobody 32 9844
809 6NI3 5 N Nanobody 35 9844
810 6NFC 1 C, J, K base-binding RM20A3 fragment antigen binding heavy chain 9544
811 6NFC 5 H BG18-like precursor HMP42 fragment antigen binding heavy chain 9606
812 6NF5 3 E, H, O BG18-like precursor HMP1 fragment antigen binding heavy chain 9606
813 6NF5 5 G, K, Q base-binding RM20A3 fragment antigen binding heavy chain 9544
814 6IYN 1 A Nb26 30538
815 6NBF 6 N Nanobody-35 32630
816 6NBH 6 N Nanobody-35 32630
817 6NBI 6 N Nanobody-35 32630
818 6NB3 3 D, H LCA60 heavy chain 9606
819 6NB4 2 H LCA60 heavy chain 9606
820 6NB6 2 H, I S230 heavy chain 9606
821 6NB7 2 D, G, H S230 heavy chain 9606
822 6ITC 4 V Nanobody 9844
823 6ITC 7 C Nanobody 9844
824 6N51 2 C, D Nanobody 43 9844
825 6I53 4 G Megabody38 9844
826 6N1V 5 M, X, Y PGT122 Heavy chain 9606
827 6N1V 7 Q, f, g VRC03 Heavy chain 9606
828 6N1W 4 5, M, m PGT122 Heavy chain 9606
829 6N1W 7 8, Q, q VRC03 Heavy chain 9606
830 6MPG 4 3, W, X A12V163-b.01 Heavy Chain 9544
831 6MPG 5 5, M, m PGT122 Heavy chain 9606
832 6MPH 1 1, 3, H DF1W-a.01 heavy chain 9544
833 6MPH 5 M, X, Y PGT122 heavy chain 9606
834 6MID 3 H monoclonal antibody ZIKV-195 heavy chain Fab variable domain 9606
835 6AJ7 2 H VH of Fab 15C5 10090
836 6AJ9 2 D VH of Fab 11G1 10090
837 6AJ9 4 H VH of Fab 15C5 10090
838 6AD0 2 H VH of Fab 2G8 10090
839 6E3Y 2 N Nanobody 35 9844
840 6A96 1 K, L, O Nb25 9844
841 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
842 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
843 6DZV 2 B 15B8 antibody heavy chain Fab variable domain 10090
844 6DZW 3 H 15B8 antibody heavy chain 10090
845 6DZY 2 H 15B8 antibody heavy chain Fab variable domain 10090
846 6DZZ 2 B 15B8 antibody heavy chain Fab variable domain 10090
847 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
848 6GG0 2 H Heavy chain 9606
849 6CXC 1 G, I, X R4.C6 Fab Heavy Chain 10090
850 6CUE 3 3, H, h vFP7.04 Heavy chain 10090
851 6CUE 5 5, M, m PGT122 heavy Chain 9606
852 6CUE 7 7, Q, q VRC03 Heavy chain 9606
853 6CUF 3 5, M, m PGT122 Heavy chain 9606
854 6CUF 6 8, Q, q VRC03 heavy chain 9606
855 6CDI 4 5, M, m PGT122 Heavy Chain 9606
856 6BSP 1 A U4 Heavy chain 10090
857 6B3J 6 N Nanobody 35 9844
858 6EHG 3 C hC3Nb1 9844
859 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
860 5XS7 2 H Heavy chain of Fab 1D5 10090
861 5W3L 5 E C5 antibody variable heavy domain 10090
862 5W3M 1 E C5 antibody variable heavy domain 10090
863 5W3O 1 D C5 antibody variable heavy domain 10090
864 5W3E 1 E C5 antibody variable heavy domain 10090
865 5VAI 6 N nanobody 35 9844
866 5UZ7 4 N NANOBODY 35 9844
867 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
868 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
869 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
870 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
871 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
872 5H30 3 G, I, K IgG C10 heavy chain 9606
873 5KWL 4 7 VHH 10E 9838
874 5KTZ 4 7 VHH 12B 9838
875 5KU0 4 7 VHH 17B 9838
876 5KU2 4 7 VHH 7A 9838
877 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
878 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
879 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
880 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
881 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
882 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
883 3JCX 2 H Fab E heavy chain 10116
884 5FOJ 1 A Nanobody 9838
885 3JBC 5 7 nanobody VHH PVSP29F 9838
886 3JBD 5 7 nanobody VHH PVSP6A 9838
887 3JBE 5 7 nanobody VHH PVSS8A 9838
888 3JBF 5 7 nanobody VHH PVSP19B 9838
889 3JBG 5 7 nanobody VHH PVSS21E 9838
890 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
891 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
892 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
893 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
894 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
895 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
896 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
897 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
898 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
899 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
900 3J6U 3 H Fab 5J7 heavy chain variable region 9606
901 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
902 3IY1 2 B Fab B, heavy chain 10116
903 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
904 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
905 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
906 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
907 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
908 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
909 3IY0 2 H Fab 14, heavy domain 10090
910 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
911 1G9E 1 A H14 9844
912 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
913 1VHP 1 A VH-P8 9606