1IC5

CRYSTAL STRUCTURE OF HYHEL-10 FV MUTANT(HD99A)-HEN LYSOZYME COMPLEX


Sequence Similarity Clusters for the Entities in PDB 1IC5

Entity #1 | Chains: L
LYSOZYME BINDING IG KAPPA CHAIN protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 14 4986
95 % 16 22 2933
90 % 16 24 2776
70 % 19 29 2176
50 % 141 415 21
40 % 154 440 24
30 % 466 1364 5
Entity #2 | Chains: H
IGG1 FAB CHAIN H protein, length: 114 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 73041
95 % 16 22 3029
90 % 16 22 3107
70 % 19 42 1173
50 % 321 910 5
40 % 321 927 6
30 % 467 1364 5
Entity #3 | Chains: Y
LYSOZYME C protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 658 787 3
95 % 711 843 5
90 % 722 860 6
70 % 728 867 11
50 % 940 1095 9
40 % 962 1130 10
30 % 962 1132 16

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 4UNU 1 A, B IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
3 5IVN 1 A BC2-nanobody 30538
4 5ACM 1 A, B MCG IG LAMBDA CHAIN V-II REGION MGC 9606
5 6JB9 1 A Nanobody D3-L11 9838
6 5E7B 1 A nanobody nano-L06 9838
7 2P45 2 B ANTIBODY CAB-RN05 9838
8 6OSH 1 L Antibody Light chain variable region 9986
9 6OSH 3 H Antibody heavy chain variable region 9986
10 2X1Q 1 A, B GELSOLIN NANOBODY 9844
11 5U64 1 B VHH-28 9838
12 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
13 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
14 4B41 1 A, B ANTIBODY G7 9844
15 5IMM 1 B Nanobody 9835
16 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
17 4QYO 2 B Fv fragment(mAb6D8) light chain 10090
18 6HER 2 B Nanobody 484 9838
19 5NLU 1 A single domain llama antibody Nb36 9844
20 2Q20 1 A, B Vk1 O18/O8 germline light chain variable domain 9606
21 1MQK 1 L antibody 7E2 FV fragment, light chain 10090
22 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
23 5IMK 1 B Nanobody 9835
24 6CWK 1 A Anti-Ricin antibody 30538
25 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
26 4B50 1 A 2H10 LLAMA VHH 9844
27 6HEQ 1 A Prion nanobody 484 9838
28 6U14 1 A, B VHH R303 C33A/C102A mutant 9838
29 6DBA 1 A, B nanobody VHH R303 9838
30 6RU3 1 C hFP1Nb1 9844
31 2XT1 2 B CAMELID VHH 9 30538
32 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
33 4QY8 2 B Fv fragment(mAb6D8) light chain 10090
34 6OSV 1 L Antibody light chain variable region 9986
35 6OSV 3 H Antibody heavy chain variable region 9986
36 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
37 5J1S 3 C VHH domain BS-2 30538
38 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
39 5L6Q 1 A, B H5AL 9606
40 5J1T 3 C VHH domain BS-2 30538
41 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
42 6JB2 1 A Nanobody D3-L11 9838
43 6J9O 1 H Heavy chain of AF4H1K1 scFv 9606
44 6J9O 2 L Light chain of AF4H1K1 scFv 9606
45 2X1O 1 A, B GELSOLIN NANOBODY 9844
46 4QGY 1 A, B nanobody n25, VH domain 9844
47 5VNV 1 A Nb.b201 32630
48 6J14 1 A GY-14 heavy chain V fragment 10090
49 6J14 2 B GY-14 light chain V fragment 10090
50 5DXW 1 A PD-L1 nanobody 9835
51 6IR2 2 B mCherry's nanobody LaM2 9837
52 3T0W 1 A, B immunoglobulin variable lambda domain 9606
53 4N9O 2 B Nanobody Nb484 Nb484 9844
54 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
55 6JB5 1 A Nanobody D3-L11 9838
56 5ACL 1 A MCG IG LAMBDA CHAIN V-II REGION MGC 9606
57 3T0V 1 A immunoglobulin variable lambda domain 9606
58 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
59 1OAQ 2 L LIGHT CHAIN FV, RESIDUES 1-120 10090
60 1T2J 1 A M12-Variable Heavy domain 9606
61 1DLF 1 L ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
62 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
63 6DBF 2 B InlB specific VHH R303 9838
64 6SGE 2 B, D Nanobody B6 9606
65 6SM1 1 A Immunoglobulin lambda variable 2-14 9606
66 6DBG 2 C, D VHH R303 9838
67 6I2G 1 A ALFA nanobody 30538
68 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
69 5VM6 1 A single domain camelid nanobody VHH T10 9844
70 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
71 4KML 2 B Nanobody 9844
72 6DYX 1 D VHH R419 30538
73 4Z9K 2 B VHH2(F5) antibody 30538
74 1J05 1 A, L anti-CEA mAb T84.66, light chain Fv fragment 10090
75 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
76 5LMW 1 A Nanobody 9844
77 5NM0 1 A, B, C, D Nb36 9844
78 6U53 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire C (ZC) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
79 6H6Y 2 E, F, G, H Nanobody (VHH) Nano-7 30538
80 2RHE 1 A BENCE-JONES PROTEIN RHE (LIGHT CHAIN) 9606
81 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
82 4QXT 2 B Fv fragment(mAb6D8) light chain 10090
83 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
84 4PPT 1 A Engineered single domain VHH antibody 9844
85 3R0M 1 A, B Llama VHH A12 9844
86 3ZKQ 2 D XA4813 9844
87 4I13 2 B Protein ca1697 (nanobody) 9844
88 5C2U 1 B Nanobody Nanobody 9838
89 1XFP 1 A heavy chain antibody VHH domain 9838
90 6U12 2 B VHH R303 C33A/C102A mutant 9838
91 4POY 1 A VHH-metal 9844
92 1A2Y 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
93 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
94 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
95 5NLW 1 A nanobody Nb36 9844
96 3CDC 1 A, B Light Chain Amyloidogenic 9606
97 3CDF 1 A, B, C, D, E, F IMMUNOGLOBULIN LIGHT CHAIN 9606
98 3DVI 1 A Amyloidogenic light chain variable domain AL-103 9606
99 2DLF 1 L PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CHAIN)) FV FRAGMENT (VL DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
100 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
101 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
102 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
103 3G9A 2 B Minimizer 9838
104 1EEQ 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
105 6P79 1 H Engineered antibody heavy chain 10090
106 6P79 2 L Engineered antibody light chain 10090
107 6U50 1 C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
108 6U54 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire C (ZC) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
109 3U79 1 A, B, C, D, E, F, G, H Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain 9606
110 2P43 2 B ANTIBODY CAB-RN05 9838
111 4KRN 1 A Nanobody/VHH domain EgA1 9844
112 4GFT 2 B Nanobody 9844
113 4TVS 2 a, b VHH Domain BS-1 30538
114 4W6Y 2 B Nanobody NbFedF9 9844
115 6EZW 1 B VHH antibody BCD090-M2 9844
116 6ITP 1 A, B anti-cortisol camelid antibody 9837
117 1UAC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
118 1UAC 2 H Ig VH,anti-lysozyme 10090
119 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
120 6JB8 1 A Nanobody D3-L11 9838
121 6K65 2 L 1P4B variable light chain 10090
122 6K65 3 H 1P4B variable heavy chain 10090
123 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
124 4R3S 2 B FV FRAGMENT(MAB6D8) LIGHT CHAIN 10090
125 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
126 6ITQ 1 A, B, C, D anti-cortisol camelid antibody 9837
127 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
128 1EEU 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
129 5O02 2 C Nanobody (VHH) Nano-4 30538
130 4UNV 1 A IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
131 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
132 6JSZ 2 D XAPERONE 9606
133 4X7F 2 C, D Nano-25 Nanobody 30538
134 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
135 4UT7 2 L BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV LIGHT CHAIN DOMAIN, RESIDUES 1-147 9606
136 4LGR 2 B Camelid nanobody (VHH3) 30538
137 5J57 2 B VHH single chain antibody V5E1 30538
138 6BA5 1 A, C, E, G Variable domain of Light Chain, antibody R11 9606
139 6BA5 2 B, D, F, H Variable domain Heavy chain, antibody R11 9606
140 1MFA 1 L IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN) 10090
141 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
142 5OMM 2 C Nanobody (VHH) Nano-14 30538
143 5E03 1 A CTLA-4 nanobody 9835
144 5LZ0 1 A, B PorM nanobody 9844
145 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
146 6DBE 1 A, B nanobody VHH R303 9844
147 6XW5 2 C, D Nanobody NB-5820 30538
148 2XXC 1 B CAMELID VHH 9 30538
149 3QYC 1 A, B VH domain of IgG molecule 9606
150 5VAK 2 B Nb914 Nanobody 9844
151 2XXM 2 B CAMELID VHH 9 30538
152 5IR3 1 A Ig lambda chain V-VI region AR 9606
153 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
154 6LR7 2 B Nanobody LaG16 9837
155 4AJ0 1 A, B, C, D GERMINAL LINE LAMBDA 3 3RCW VARIANT VARIABLE DOMAIN VARIANT OF 3RJL2, RESIDUES 1-107 9606
156 6T2J 1 A, B Single domain antibody 32630
157 6DBD 1 A, B, C, D nanobody VHH R326 9844
158 5JDS 1 B Nanobody 9835
159 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
160 4OB5 2 L 4E10 antibody germline precursor 7 light chain Fv 9606
161 1BWW 1 A, B PROTEIN (IG KAPPA CHAIN V-I REGION REI) IMMUNOGLOBULIN KAPPA LIGHT CHAIN 9606
162 6OBE 2 B VHH antibody V6H8 30538
163 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
164 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
165 4AIZ 1 A, C, D V2-17 PROTEIN 9606
166 4AIZ 2 B V2-17 PROTEIN 9606
167 5L21 2 B VHH-C2 30538
168 5FWO 1 A NANOBODY 9844
169 4L1H 1 A Ig kappa chain V-I region Rei 9606
170 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
171 3B9V 1 A, B, C, D heavy chain variable domain 9606
172 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
173 1VFA 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
174 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
175 5N88 1 A, H VH59 antibody 9606
176 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
177 2D7T 2 L anti polyhydroxybutyrate antibody Fv, light chain residues 1-110 9606
178 3BD3 1 A, B catalytic antibody 10090
179 2OTU 1 A, C, E, G Fv light chain variable domain 10090
180 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
181 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
182 1EFQ 1 A KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
183 2E27 1 L anti-ciguatoxin antibody, light chain Fv fragment 10090
184 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
185 4N1C 1 A, B immunoglobulin variable light chain domain 9606
186 6YZ5 2 F Nanobody H11-D4 9844
187 4POU 2 B VHH Antibody 9844
188 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
189 6J5D 2 H antibody heavy chain 10090
190 6J5D 3 L antibody light chain 10090
191 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
192 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
193 4AIX 1 A, B, C, D IG LAMBDA CHAIN V-IV REGION BAU 9606
194 6H70 2 C, D Nanobody (VHH) Nano-62 30538
195 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
196 2P42 2 B, D ANTIBODY CAB-RN05 9838
197 1I8K 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
198 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
199 4QLR 1 A, B Llama nanobody n02 VH domain 9844
200 5J56 2 B VHH single chain antibody V1C7 30538
201 6OBC 2 B VHH antibody 30538
202 4X4Z 1 A, B Herceptin VL domain with F53D mutation 9606
203 6J5F 2 H antibody heavy chain 10090
204 6J5F 3 L antibody light chain 10090
205 4NBX 2 B A20.1 VHH 9844
206 1G7J 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
207 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
208 4HEP 2 G vHH17 domain 9844
209 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
210 1PEW 1 A, B Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN 9606
211 1VFB 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
212 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
213 5IML 2 B Nanobody 9835
214 3A6C 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
215 3A6C 2 H IG VH, anti-lysozyme 10090
216 2DQD 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
217 2DQD 2 H Ig VH,anti-lysozyme 10090
218 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
219 1WTL 1 A, B BENCE-JONES PROTEIN MCG (LIGHT CHAIN) 9606
220 1G7I 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
221 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
222 3A67 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
223 3A67 2 H IG VH, anti-lysozyme 10090
224 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
225 1J1X 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
226 1J1X 2 H Ig VH,anti-lysozyme 10090
227 5M2J 2 D Anti-(ED-B) scFV 9606
228 6KYZ 2 B, E YDF H chain 9606
229 6KYZ 3 C, F YDF L chain 9606
230 2DQC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
231 2DQC 2 H Ig VH,anti-lysozyme 10090
232 1J1O 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
233 1J1O 2 H Ig VH,anti-lysozyme 10090
234 1MVU 1 A Ig kappa-chain VJ-region (Light chain) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
235 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
236 4M62 1 L, M GEP2 FV light chain UNP residues 21-129 9606
237 4M62 2 H, I GEP2 FV heavy chain 9606
238 5IVO 1 A BC2-nanobody 30538
239 1J1P 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
240 1J1P 2 H Ig VH,anti-lysozyme 10090
241 6S0Y 1 A, B M2e-VHH-23m 9844
242 4NBZ 2 B, D A26.8 VHH 9844
243 1QAC 1 A, B IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN VARIABLE DOMAIN 9606
244 5AYU 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
245 5AYU 2 H Ig VH,anti-lysozyme 10090
246 3A6B 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
247 3A6B 2 H IG VH, anti-lysozyme 10090
248 2DQJ 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
249 2DQJ 2 H Ig VH,anti-lysozyme 10090
250 5F21 2 B nanobody MU375 9844
251 1N4X 1 L, M immunoglobulin kappa chain variable region 10090
252 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
253 2P44 2 B ANTIBODY CAB-RN05 9838
254 3DVF 1 A Amyloidogenic immunoglobulin light chain protein AL-12 9606
255 1KIQ 1 A MONOCLONAL ANTIBODY D1.3 10090
256 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
257 5TP3 1 A, B F-VHH-4 9844
258 2IMN 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
259 3B5G 1 A, B AMYLOID LAMBDA 6 LIGHT CHAIN VARIABLE REGION PIP residues 1-111 9606
260 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
261 4LHJ 2 B Camelid antibody 30538
262 4BEL 2 D, E XA4813 9844
263 5M7Q 1 A, B Nanobody NbD2 9838
264 5H8D 1 A VHH nanobody 9844
265 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
266 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
267 3DUR 1 A, C antibody Fv fragment SAG173-04 variable region fragment (Fv) 10090
268 3DUR 2 B, D Ig-like protein 10090
269 5T93 1 A, B, C, D ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient last residue was not visible on electron density 9606
270 2XV6 2 B, D CAMELID VHH 9 30538
271 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
272 5VM0 1 A, B Camelid Nanobody VHH T9 9844
273 1LVE 1 A LEN, A VARIABLE DOMAIN FROM KAPPA-4 TYPE 9606
274 4ZG1 1 A, B, C, D, E, F NB17 9844
275 2IMM 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
276 6BAN 1 A, C, E, G Variable domain of R11 Light Chain 9606
277 6BAN 2 B, D, F, H Variable domain R11 Heavy chain 9606
278 4I1N 2 B Protein ca1697 (nanobody) 9844
279 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
280 5C9K 1 A, B, C, D, E, F, G, H Amyloid lambda 6 light chain variable region PIP 9606
281 6F0D 1 A, B VHH antibody BCD090-M2 9844
282 1FGV 1 L H52 FV (LIGHT CHAIN) 9606
283 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
284 4LCI 1 L anti canine CD28 antibody, 1C6, light chain 10090
285 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
286 4W6X 2 B Nanobody NbFedF7 9844
287 5JA9 2 A, B Nanobody 6 9844
288 1A7N 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
289 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
290 1CD0 1 A, B PROTEIN (JTO, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) IMMUNOGLOBULIN VARIABLE DOMAIN 9606
291 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
292 1OP9 1 A HL6 camel VHH fragment 9838
293 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
294 4LRN 1 H GEP 1 heavy chain 9606
295 4LRN 2 L GEP 1 light chain 9606
296 4S11 1 A GELSOLIN NANOBODY 9844
297 1EK3 1 A, B KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL, REC 9606
298 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
299 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
300 6RTW 2 B Llama-derived nanobody NB64 9844
301 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
302 6IR1 2 B mCherry's nanobody LaM4 9837
303 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
304 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
305 1G7H 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
306 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
307 6RNK 2 B Nanobody6 30538
308 4Y7M 1 A, B Hi113 protein 9844
309 5JMO 2 C, D camelid VHH fragment 9838
310 6GJS 2 B Nanobody D12 9844
311 6GJS 3 C Nanobody T4 9844
312 1A7O 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
313 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
314 1KIR 1 A MONOCLONAL ANTIBODY D1.3 10090
315 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
316 4B5E 1 A, B PS2-8 9844
317 2DQE 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
318 2DQE 2 H Ig VH,anti-lysozyme 10090
319 1DVF 1 A FV D1.3 IGG1, KAPPA 10090
320 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
321 1DVF 3 C FV E5.2 IGG1, KAPPA 10090
322 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
323 1G7M 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
324 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
325 4X7C 2 C, D Nano-85 Nanobody VHH 30538
326 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
327 1OAU 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
328 1B0W 1 A, B, C BENCE-JONES KAPPA I PROTEIN BRE VARIABLE DOMAIN OF LIGHT CHAIN 9606
329 3EBA 1 A CAbHul6 9838
330 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
331 1A6W 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
332 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
333 1A7R 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
334 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
335 5VM4 1 A, B, C, D, E, F, G, H, I, J, K, L Single domain camelid nanobody VHH T10 9844
336 6U52 1 A, C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
337 6QGW 2 B NanoE6 9844
338 1WZ1 1 L Ig light chain 10090
339 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
340 3UPA 1 A, B kappa light chain variable domain 9606
341 4I0C 2 C, D cAbHuL5 antibody 9838
342 3LVE 1 A LEN KAPPA-IV LIGHT CHAIN DIMER 9606
343 6H1F 1 A gelsolin nanobody, Nb11 9844
344 1A7P 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
345 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
346 4K3G 1 A, B immunoglobulin lambda variable domain L5(L89S) 9606
347 1XIW 3 C, G immunoglobulin light chain variable region 10090
348 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
349 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
350 5NGV 3 L anti-human ActRIIB mAb BYM338 light-chain VL 9606
351 1A7Q 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
352 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
353 5BOP 1 A, C Nanobody 9844
354 6U55 1 A Anti-Zaire ebolavirus Nucleoprotein Single Domain Antibody Zaire E (ZE) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
355 4DKA 1 A, B single domain antibody VHH 9844
356 5O05 1 C, D Nanobody (VHH) Nano-42 30538
357 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
358 1DSF 1 L ANTICANCER ANTIBODY B1 FV 10090
359 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
360 3DUU 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
361 3DUU 2 B, D Ig-like protein 10090
362 6OBO 2 C, D VHH antibody V6A6 30538
363 3BJ9 1 1 Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1 Fusion protein consists of Ig domain of VPREB protein and J-fragment of Ig lambda-5 9606
364 3LRG 1 A, B anti-huntingtin VL domain anti-huntingtin VL domain 9606
365 3K74 2 B Nanobody 9844
366 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
367 1KIP 1 A MONOCLONAL ANTIBODY D1.3 10090
368 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
369 6A3W 1 A, D, G, J utomilumab VH 9606
370 6A3W 2 B, E, H, K utomilumab VL 9606
371 5LVE 1 A BENCE-JONES PROTEIN LEN G KAPPA CHAIN V-IV, VARIABLE DOMAIN, LIGHT CHAIN 9606
372 2EIZ 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
373 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
374 6UL6 3 C ciA-H7 30538
375 6OBG 2 C, D VHH antibody V8E6 30538
376 1SJV 1 A r9 llama VHH single domain antibody 9844
377 6CK8 1 A, B, C Llama antibody SD38 9844
378 6XW6 2 C, D Nanobody NB-5853 30538
379 1PW3 1 A, B immunoglobulin lambda chain variable region 9606
380 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
381 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
382 6GZP 1 A Nanobody 9844
383 5JPJ 1 A, B 6aJL2 protein 9606
384 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
385 2UZI 2 L ANTI-RAS FV LIGHT CHAIN 9606
386 6H6Z 2 C, D Nanobody (VHH) Nano-62 30538
387 3T0X 1 A, B Immunoglobulin variable lambda domain M8VLA4(S55P) 9606
388 1UA6 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
389 1UA6 2 H Ig VH,anti-lysozyme 10090
390 1IC7 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
391 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
392 4W68 1 A, B Single domain antibody 9844
393 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
394 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
395 1CFV 1 L MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
396 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
397 3EAK 1 A, B NbBCII10-FGLA 9838
398 1QP1 1 A, B, C BENCE-JONES KAPPA I ANTIBODY BRE (LIGHT CHAIN) IMMUNOGLOBULIN FRAGMENT, VARIABLE DOMAIN 9606
399 3U7A 1 A Amyloidogenic immunoglobulin light chain protein AL-09 Y32F Y96F, variable domain 9606
400 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
401 4ORZ 3 C single domain antibody sdAb19 9844
402 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
403 4UU9 2 B, L MEDI7814 VARIABLE DOMAIN LIGHT CHAIN 9606
404 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
405 6DN0 1 A, C Human Variable Heavy Chain of Herceptin containing VH mutation K30D 9606
406 6DN0 2 B, D Human Variable Light Chain of Herceptin containing VL mutation S52D 9606
407 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
408 1G7L 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
409 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
410 6IBB 2 B, D Nanobody6 30538
411 6XW7 2 C, D, G, H Nanobody NB-5829 30538
412 1BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
413 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
414 5C1M 2 B Nanobody 39 9844
415 5F7K 2 C, D Nanobody Nb-ER19 9844
416 5LMJ 1 A, B, C, D nanobody 9844
417 5E1H 2 B F8(JOB10) VHH antibody 30538
418 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
419 1IVL 1 A, B IGG-KAPPA M29B FV (LIGHT CHAIN) 10090
420 6OCD 2 B, D VHH antibody V6D4 30538
421 4OCM 3 C, F Nb1 9844
422 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
423 1A6U 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
424 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
425 4X7E 2 C, D Nano-85 Nanobody 30538
426 5F1O 2 B nanobody MU551 9844
427 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
428 5O03 2 C, D Nanobody (VHH) Nano-32 9844
429 6GWN 2 B VHH-2g-42 30538
430 6GWN 3 C VHH-2w-64 30538
431 2DQI 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
432 2DQI 2 H Ig VH,anti-lysozyme 10090
433 1BRE 1 A, B, C, D, E, F BENCE-JONES KAPPA I PROTEIN BRE 9606
434 4Y8D 2 C, D nanobody 9844
435 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
436 3CX5 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
437 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
438 6XW4 2 C, D Nanobody NB-5867 30538
439 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
440 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
441 4C58 2 B nanobody 9844
442 5B8C 1 A, D, G, J Pembrolizumab light chain variable region (PemVL) 9606
443 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
444 3DV6 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
445 3DV6 2 B Ig-like protein 10090
446 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
447 2EKS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
448 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
449 3BD5 1 A, B catalytic antibody 10090
450 5VXM 2 B Single-domain antibody 20ipaD 30538
451 4XVJ 2 H antibody heavy chain variable domain 9606
452 4XVJ 3 L antibody light chain variable domain 9606
453 1AC6 1 A, B T-CELL RECEPTOR ALPHA VARIABLE DOMAIN 10090
454 4IDL 1 A Single Domain Antibody VHH A9 9844
455 6UI1 2 B ciA-H7 30538
456 6UI1 3 C ciA-D12 30538
457 6UI1 4 D ciA-B5 30538
458 1JV5 1 A Ig kappa chain precursor V region anti-blood group A Fv 9606
459 1JV5 2 B Ig chain heavy chain precursor V region 9606
460 1FVC 1 A, C IGG1-KAPPA 4D5 FV (LIGHT CHAIN) 9606
461 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
462 3K7U 1 A Antibody 9844
463 4Z0X 1 A Antibody HC26AM light chain variable domain 9606
464 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
465 6KSN 1 A, B ICab3 9838
466 1IC5 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
467 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
468 4NBY 2 B, C A20.1 VHH 9844
469 6HHD 2 B Nanobody 484 9838
470 6HHD 4 D Nanobody 484 9838
471 4X7D 2 C, D Nano-85 Nanobody VHH 9844
472 5VAN 2 B Nb914 Nanobody 9844
473 2CD0 1 A, B PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) VARIABLE DOMAIN 9606
474 5F7N 2 C, D Nanobody Nb-ER19 30538
475 5OCL 1 A, C, F, H anti-llama nanobody 30538
476 5OCL 2 B, D, E, G anti-vglut nanobody 9844
477 2A9M 1 L, M fluorescein-scfv light chain 9606
478 2A9M 2 H, I fluorescein-scfv heavy chain 9606
479 6OC8 1 A, B, C, D VHH8c 9844
480 5E5M 2 B, D, F, H CTLA-4 nanobody 9835
481 1SJX 1 A immunoglobulin VH domain 9844
482 3ZKS 2 D XA4813 9844
483 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
484 6H72 2 C, D Nanobody (VHH) Nano-94 30538
485 6OCA 2 C, D VHH antibody V2G10 30538
486 1A6V 1 L, M, N B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
487 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
488 6UHT 2 C, D JLI-G10 30538
489 5MY6 2 B Nanobody 2Rs15d 9838
490 6RTY 2 B Llama-derived nanobody NB64 Nanobody NB64 containing a C-terminal His6-Tag for purification 9844
491 3DUS 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
492 3DUS 2 B, D Ig-like protein 10090
493 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
494 5NH3 3 L, M anti-human ActRIIB mAb BYM338 Fv light-chain 9606
495 6F5G 2 B VHH minibody anti-Cter PCSK9 VHH from immunization of Llama from E. coli expression 9844
496 5M2I 2 G, H, I, J, K, L VHH1 9844
497 6OQ8 2 C, D 7F 9835
498 6SC5 2 B, C Single domain antibody 32630
499 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
500 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
501 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
502 6SC8 2 B, C Single domain antibody 32630
503 3K1K 2 C, D Enhancer 9838
504 4U7S 1 A, B sdAb A3 9844
505 6WAQ 1 A, C nanobody SARS VHH-72 9844
506 4U3X 1 A, C Human VH domain antibody 9606
507 4W81 1 A Single Domain Antibody 9844
508 5GRV 1 L homo-specific diabody heavy chain 9606
509 5GRV 2 K homo-specific diabody light chain 9606
510 5JMR 1 A, B camelid VHH fragment 9838
511 6RVC 2 D, E, F Nanobody NB75 Llama nanobody NB75 containing a a C-terminal His6-Tag for IMAC purification. 9844
512 4W70 1 A Single Domain Antibody 9844
513 6QTL 1 A, D, E, H VHH 9835
514 6QTL 2 B, C, F, G VHH 9835
515 2GSG 1 A, C monoclonal antibody light chain variable domain 10090
516 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
517 2W0L 1 A, B, C, D V1-22 protein 9606
518 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
519 5TBD 2 B, F, G, K Fv fragment (mAb4D1) heavy chain 10090
520 4BFB 2 D, E XA4813 9844
521 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
522 5DHV 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
523 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
524 4LVE 1 A, B LEN KAPPA-IV LIGHT CHAIN DIMER 9606
525 43C9 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
526 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
527 1NMB 2 L FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
528 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
529 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
530 1I8I 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
531 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
532 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
533 1OAR 2 L, M, N, O IMMUNOGLOBULING E FV, RESIDUES 1-110 10090
534 6SC6 2 B, C Single domain antibody 32630
535 1D9K 1 A, E T-CELL RECEPTOR D10 (ALPHA CHAIN) 10090
536 4LHQ 2 B, D Camelid nanobody 30538
537 3DV4 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
538 3DV4 2 B Ig-like protein 10090
539 6H71 2 C, D Nanobody (VHH) Nano-94 30538
540 6OL7 1 A, E, K, P iv8 Heavy Chain 10090
541 6OL7 2 B, F, L, N glVRC01 Light Chain 9606
542 6OL7 3 C, H, I, M glVRC01 Heavy Chain 9606
543 6OL7 4 D, J, O, Q iv8 Light Chain 10090
544 6SM2 1 A, B Pat-1 This is a patient derived mutant from WT-1 (PDB ID 6SM1) with fatal amyloid formation 9606
545 3ZKX 2 B XA4813 9844
546 3ZKX 3 C XA4815 9844
547 6I6J 2 C Sybody 32644
548 5F1K 2 C, D nanobody MU1053 9844
549 6A78 3 H, I Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv 10090
550 3ZLQ 2 C, D XA4813 9844
551 1I3G 1 L ANTIBODY FV FRAGMENT VL DOMAIN 10090
552 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
553 1DL7 1 L PROTEIN (ANTIBODY M3C65 (LIGHT CHAIN)) COMBINED LIGHT AND HEAVY CHAIN VIA (G4S)3 LINKER FV (SINGLE CHAIN) 10090
554 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
555 6GWP 2 B VHH-2g-42 30538
556 6GWP 3 C VHH-2w-64 30538
557 4NC0 2 B A26.8 VHH 9844
558 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
559 1OCW 2 L IMMUNOGLOBULIN E FV REGION, RESIDUES 1-120 10090
560 1IGM 1 L IGM-KAPPA POT FV (LIGHT CHAIN) 9606
561 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
562 5GS1 1 A, M, O, Q light chain 9606
563 5GS1 2 B, N, P, R heavy chain 9606
564 5F7Y 3 C, D Nanobody Nb-ER19 9844
565 2DQG 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
566 2DQG 2 H Ig VH,anti-lysozyme 10090
567 6I8G 2 B EDS1-specific nanobody 9844
568 5IMO 1 B Nanobody 9835
569 5U65 1 A, B VHH-5 9838
570 2PXY 1 A T cell receptor alpha chain 10090
571 3BDX 1 A, B, C Amyloid lambda 6 light chain variable region PIP (fragment) Residues 1-111 9606
572 6KZ0 2 B, E, H, K GGVV H chain 9606
573 6KZ0 3 C, F, I, L GGVV L chain 9606
574 4TYU 1 A, B Single Domain Antibody 9844
575 43CA 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
576 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
577 2DQH 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
578 2DQH 2 H Ig VH,anti-lysozyme 10090
579 4AQ1 2 B, D NBKB6 VHH 9844
580 6FV0 2 F nanobody 9844
581 2Q1E 1 A, B, C, D Amyloidogenic immunoglobulin light chain protein AL-09 9606
582 4EIG 2 B CA1698 camel antibody fragment 9844
583 3EHB 3 C FV fragment Chain H 10090
584 3EHB 4 D FV fragment Chain L 10090
585 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
586 3HB3 3 C ANTIBODY FV FRAGMENT 10090
587 3HB3 4 D ANTIBODY FV FRAGMENT 10090
588 4FFY 1 L DENV1-E111 single chain variable fragment (light chain) 10090
589 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
590 6GWQ 2 B VHH-2g-42 30538
591 6QGX 2 B NanoF7 9844
592 4N1E 1 A, B, C, D, E, F, G, H immunoglobulin variable light chain domain 9606
593 2X89 1 A, B, C ANTIBODY 9838
594 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
595 5O04 2 E, F Nanobody (VHH) Nano-26 30538
596 5O04 3 C, D Nanobody (VHH) Nano-85 30538
597 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
598 5LBS 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 SCFV fragment, light chain 9606
599 3P9W 2 B, D, F, H human VEGF 9606
600 6OQ7 2 C E3 9835
601 1AP2 1 A, C MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
602 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
603 5F8R 2 C, D Nanobody Nb-ER19 9844
604 1IC4 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
605 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
606 4OCL 3 C, F Nb1 9844
607 3CDY 1 A, B IMMUNOGLOBULIN LIGHT CHAIN 9606
608 4RAV 1 B, D Single-chain Fv, VL 9606
609 4RAV 2 A, C single-chain Fv, VH 9606
610 5XJ4 2 H durvalumab-VH 9606
611 5XJ4 3 L durvalumab-VL 9606
612 5LWY 2 H V REGION HEAVY CHAIN 10090
613 5LWY 3 L V REGION LIGHT CHAIN 10090
614 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
615 1KB9 11 K LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
616 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
617 4X4X 2 B, D Human Variable Light Chain of Herceptin 9606
618 4IOS 2 D, E, F, G Llama nanobody 11 9844
619 2W0K 1 A, B V1-22 PROTEIN 9606
620 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
621 2BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
622 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
623 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
624 2IBZ 11 Y Variable Light chain of antibody fragment 10090
625 4K3H 1 A, B, C, D, E, F, G, H Immunoglobulin lambda variable domain L5(L89S) 9606
626 4C57 2 C, D NANOBODY 9844
627 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
628 6OL6 3 H iglb12 Heavy Chain 9606
629 6OL6 4 L iglb12 light chain 9606
630 4OCN 3 C, F Nb1 9844
631 4GRW 3 E, G Nanobody 124C4 9844
632 4GRW 4 F, J Nanobody 37D5 9844
633 4GRW 5 H, I Nanobody 22E11 9844
634 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
635 4NC2 2 B B39 VHH 9844
636 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
637 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
638 2OI9 2 B T cell receptor alpha chain 10090
639 6IVZ 2 H Heavy chain of monoclonal antibody 5A 9606
640 3BD4 1 A, B catalytic antibody 10090
641 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
642 1WT5 2 C, D ANTI EGFR ANTIBODY FV REGION VL fragment 9606
643 6EY0 2 E, G, H llama nanobody nb01 9844
644 6EY0 3 F llama nanobody nb01 9844
645 1JHL 1 L IGG1-KAPPA D11.15 FV (LIGHT CHAIN) 10090
646 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
647 5F9A 2 C Nanobody Nb-ER19 9844
648 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
649 4LLV 2 B, D, F, L 4E10 Fv light chain 9606
650 6GJQ 2 B, D, F, H Nanobody T27 9844
651 5CBA 1 A, C 3b4 heavy chain 9606
652 5CBA 2 B, D 3b4 light chain 9606
653 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
654 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
655 1A14 3 L NC10 FV (LIGHT CHAIN) VL DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
656 1C08 1 A ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VL FRAGMENT 10090
657 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
658 2OTW 1 A, C Fv light chain avriable domain VL 10090
659 2OTW 2 B, D Fv heavy chain variable domain VH 10090
660 3STB 1 A, B single domain antibody VHH 9844
661 2YSS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
662 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
663 4W6W 2 B NbFedF6 9844
664 5JA8 2 B, D, F, H Nanobody 2 9844
665 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
666 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
667 2BJM 2 L IGE SPE7 LIGHT CHAIN LIGHT CHAIN, RESIDUES 1-110 10090
668 1P4B 1 L Antibody Variable light chain 10090
669 1P4B 2 H Antibody Variable heavy chain 10090
670 5U4M 2 B V1C7 VHH antibody 30538
671 5O0W 2 E, F, G, H Nb474 30538
672 4Y5V 1 A, D, G diabody 305 VH domain 9606
673 4Y5V 2 B, E, H Diabody 305 VL domain 9606
674 6HJX 6 F, G, H, I, J nanobody 72 9844
675 1I9E 1 A CYTOTOXIC TCELL VALPHA DOMAIN N-TERMINAL DOMAIN OF ALPHA CHAIN 10090
676 1DQL 1 L IGM MEZ IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN FRAGMENT 9606
677 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
678 6SC9 2 B, C Single domain antibody 32630
679 6MTJ 2 D 35O22 scFv heavy chain portion 9606
680 6MTJ 3 E 35O22 scFv light chain portion 9606
681 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
682 3V0A 3 C Llama antibody F12 9844
683 2Z35 1 A T-cell receptor alpha-chain 10090
684 6FYU 3 C, F, I Single domain antibody SD36 9844
685 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
686 3K80 1 A, B Antibody 9844
687 5VAQ 2 B Nb914 Nanobody 9844
688 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
689 5F8Q 2 C, D Nanobody Nb-ER19 9844
690 4U05 1 A, B Single Domain Antibody 9844
691 6OBM 2 B VHH antibody V6A7 30538
692 6RBB 1 H, I, J, K VHH domain of netakimab 9844
693 5F9D 2 C Nanobody Nb-ER19 9844
694 4LGP 2 B, D VHH1 camelid nanobody 30538
695 2P48 2 B ANTIBODY CAB-RN05 9838
696 5U4L 2 B V1C7 VHH antibody G29R variant 30538
697 5VXK 1 B single-domain antibody JMK-H2 30538
698 5F7M 2 C, D Nanobody Nb-ER19 9844
699 5NBL 3 E, F nAct-Nanobody N-actin and Arp4 specific nanobody with a C-terminal double Strep-Tag. 30538
700 6U51 1 A, C Anti-Sudan ebolavirus Nucleoprotein Single Domain Antibody Sudan B (SB) Semi-synthetic single pot library Nomad 1 based upon Lama glama 9844
701 6W03 2 D 35O22 scFv heavy chain 9606
702 6W03 3 E 35O22 scFv light chain 9606
703 6H15 2 C, D VHH L-P2-B10 9844
704 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
705 5F7W 2 C, D Nanobody Nb-ER19 9844
706 4YQX 1 H, N JES6-1 VH domain 10116
707 4YQX 2 L, O JES6-1 VL domain 10116
708 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
709 1EZV 11 Y LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
710 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
711 3U6R 2 B, L Antibody 1:7 (Light chain) 9606
712 1U3H 1 A, E T-cell receptor alpha-chain V2.3-J39-C 10090
713 6HHU 2 G nanobody AF684 9844
714 6HHU 3 H Nanobody AF694 9844
715 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
716 1NMC 3 C, L SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
717 1KB5 1 A KB5-C20 T-CELL ANTIGEN RECEPTOR 24 RESIDUE LINK BETWEEN VALPHA C-TERMINUS AND VBETA N-TERMINUS FV FRAGMENT, VARIABLE DOMAIN 10090
718 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
719 4NC1 2 C, D A20.1 VHH 9844
720 4NC1 3 E, F A26.8 VHH 9844
721 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
722 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
723 2DQF 1 A, D lysozyme binding Ig kappa chain V23-J2 region 10090
724 2DQF 2 B, E Ig VH,anti-lysozyme 10090
725 1B88 1 A, B T CELL RECEPTOR V-ALPHA DOMAIN V-ALPHA DOMAIN 10090
726 5E7F 1 A, B, C nanobody L06 9838
727 2P46 2 B, D ANTIBODY CAB-RN05 9838
728 6QGY 2 B, D NanoB12 9844
729 6MTN 2 D 35O22 scFv heavy chain portion 9606
730 6MTN 3 E 35O22 scFv light chain portion 9606
731 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
732 3CXH 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
733 6MU7 2 D 35O22 scFv heavy chain portion 9606
734 6MU7 3 E 35O22 scFv light chain portion 9606
735 2E7L 1 A, B Cytotoxic Tcell receptor UNP RESIDUES 21-132 10090
736 5YOY 2 D, E, F, M, N, O Golimumab light chain variable region 9606
737 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
738 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
739 5LHP 2 B Camelid-Derived Antibody Fragment 30538
740 2ICW 5 I, K T-cell receptor alpha chain V residues 21-131 10090
741 6J7W 1 A, B UniAb Heavy chain Antibody 9606
742 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
743 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
744 1P84 11 K Light Chain (Vl) Of Fv-Fragment 10090
745 5SV4 1 A, B Single Domain Antibody A3C8 9844
746 6Z2M 4 D, F nanobody D4 9844
747 4LGS 2 B Camelid nanobody (VHH4) 30538
748 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
749 5Y80 2 B NANOBODY 9844
750 2XTJ 2 B FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
751 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
752 5CBE 1 A, C E10 heavy chain 9606
753 5CBE 2 B, D E10 light chain 9606
754 2P47 2 B ANTIBODY CAB-RN05 9838
755 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
756 3WXW 2 H V region heavy chain 10090
757 3WXW 3 L V region light chain 10090
758 3K3Q 1 A llama Aa1 VHH domain 9844
759 1F6L 1 L ANTI-FERRITIN IMMUNOGLOBULIN LIGHT CHAIN VARIABLE LIGHT CHAIN 9606
760 3LRH 1 A, C, E, G, I, K, M, O anti-huntingtin VL domain anti-huntingtin VL domain 9606
761 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
762 6SC7 2 B, C Single domain antibody 32630
763 1AR1 3 C ANTIBODY FV FRAGMENT 10090
764 1AR1 4 D ANTIBODY FV FRAGMENT 10090
765 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
766 6GJU 2 B Nanobody T4 9844
767 6GJU 3 C Nanobody T2a 9844
768 5VNW 2 C, D Nb.b201 32630
769 1BVK 1 A, D HULYS11 FV 9606
770 1BVK 2 B, E HULYS11 FV 9606
771 6FE4 2 F, G, H, I, J Nb113 30538
772 5FV1 1 L, M VK DOMAIN ANTIBODY VK DOMAIN ANTIBODY, RESIDUES 1-108 9606
773 6GS4 2 H nanobody 9844
774 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
775 6MU6 2 D 35O22 scFv heavy chain portion 9606
776 6MU6 3 E 35O22 scFv light chain portion 9606
777 6A79 3 H, I Heavy chain of the anti-human Robo1 antibody B5209B scFv 10090
778 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
779 2CJU 2 L NQ16-113.8 ANTI-PHOX ANTIBODY 10090
780 6CWG 2 B, D VHH antibody 30538
781 5HVF 2 B VHH-i83 30538
782 1P4I 1 L ANTIBODY VARIABLE LIGHT CHAIN 10090
783 1P4I 2 H antibody variable heavy chain 10090
784 4PGJ 1 A, C Human heavy chain domain antibody 9606
785 2LVE 1 A RLEN KAPPA-IV LIGHT CHAIN DIMER 9606
786 4KDT 1 A, B Nanobody24 9835
787 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
788 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
789 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
790 2VH5 2 L ANTI-RAS FV LIGHT CHAIN 9606
791 6SSI 2 F, G, H, I, J NANOBODY 22 9844
792 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
793 6FYT 3 I Single domain antibody SD38 9844
794 5MJE 2 B Nanobody 8 9844
795 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
796 3LH2 3 L, M, N, O Fv 4E10 light chain 9606
797 3OGO 2 E, F, G, H GFP-nanobody 9838
798 4C59 2 B NANOBODY 9844
799 5VXL 2 B single-domain antibody JPS-G3 30538
800 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
801 1OAZ 3 L, N IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
802 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
803 4DK6 1 A, B single domain antibody VHH 9844
804 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
805 1CL7 2 H PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain)) FAB 10090
806 5F7L 2 B, D Nanobody Nb-ER14 9844
807 1KJ2 4 A, D KB5-C20 T-Cell receptor alpha-chain Fv fragment , variable domain 10090
808 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
809 1OAY 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
810 6VEP 3 C, I, O, U Fv 83-7 heavy chain 10090
811 6VEP 4 D, J, P, V Fv 83-7 light chain 10090
812 5HVG 2 B, D VHH-a204 30538
813 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
814 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
815 6J11 2 D, F, H VH of 7D10 10090
816 6J11 3 E, G, L VL of 7D10 10090
817 5HVH 2 B VHH-a204 30538
818 5HVH 3 C VHH-i83 30538
819 4XT1 3 C nanobody 7 30538
820 6GKD 2 B, G, J, M, P, S Nanobody D12 9844
821 6GKD 3 C, H, K, N, Q, T Nanobody G3a 9844
822 5LXG 2 H V REGION HEAVY CHAIN 10090
823 5LXG 3 L V REGION LIGHT CHAIN 10090
824 5HM1 1 A, B, C lama VHH antibody 2E7 9844
825 5NBM 3 E, F nAct-Nanobody N-actin and Arp4 binding nanobody with a C-terminal double Strep-Tag. 30538
826 5FUC 3 E, V VHH6 9838
827 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
828 4RZC 2 B, D, F, L Fv M6P-1 heavy chain 9986
829 3H3P 1 H, I Fv 4E10 heavy chain 9606
830 3H3P 2 L, M Fv 4E10 light chain 9606
831 5O2U 2 B, D VHH 59H10 9844
832 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
833 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
834 3NN8 2 B, E, F, H Engineered scFv, light chain 10090
835 5OMN 2 C Nanobody (VHH) Nano-27 30538
836 4KRP 2 B Nanobody/VHH domain 9G8 9844
837 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
838 1OAX 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
839 6VZI 2 D 35O22 scFv heavy chain 9606
840 6VZI 3 E 35O22 scFv light chain 9606
841 6FUZ 2 N nanobody 9844
842 4FHB 2 D Nb179 9844
843 4DK3 1 A, B single domain antibody VHH 9844
844 4KRL 1 B Nanobody/VHH domain 7D12 9844
845 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
846 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
847 2Z31 1 A T-cell receptor alpha-chain 10090
848 6H3T 1 H, I scFv 1C11 VH 10090
849 6H3T 2 L, M scFv 1C11 VL 10090
850 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
851 6NNJ 2 D 35O22 scFv heavy chain 9606
852 6NNJ 3 E 35O22 scFv light chain 9606
853 6NNJ 8 V CH31 scFv light chain 9606
854 6HJY 5 F, J nanobody 72 9844
855 6HJY 6 G, H, I nanobody 72 9844
856 1NMA 2 L FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
857 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
858 6OS2 2 D Nanobody Nb.AT110i1_le 32630
859 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
860 6H16 2 B VHH L-P2-D07 9844
861 6MXT 2 N nanobody Nb71 9844
862 6QX4 2 C, E Nanobody NbAF683 9844
863 6QX4 3 D, H Nanobody NbAF694 9844
864 4LDE 2 B Camelid Antibody Fragment 9844
865 4Y5Y 1 A, D diabody 330 VH domain 9606
866 4Y5Y 2 B, E diabody 330 VL domain 9606
867 6IBL 2 C, D Camelid antibody fragment Nb80 9844
868 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
869 1BVL 1 A, C HULYS11 FV 10090
870 1BVL 2 B, D HULYS11 FV 10090
871 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
872 3RJQ 2 B Llama VHH A12 9844
873 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
874 6CF2 1 A Anti-Rev Antibody, heavy chain Fab single-chain variable fragment 9986
875 6CF2 2 B Anti-Rev Antibody, light chain Fab single-chain variable fragment 9986
876 4UNT 1 A, B, C, D, E, F, G, H IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
877 6LGW 1 A, C scFv 523-11 VH 10090
878 6LGW 2 B, D scFv 523-11 VL 10090
879 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
880 3AB0 3 C, F antibody ScFv fragment, light chain 10090
881 3LHP 1 H, I Fv 4E10 heavy chain 9606
882 3LHP 2 L, M Fv 4E10 light chain 9606
883 6NM6 2 D 35O22 scFv heavy chain 9606
884 6NM6 3 E 35O22 scFv light chain 9606
885 6NM6 7 U N6 FR3-03 heavy chain 9606
886 6NM6 8 V N6 FR3-03 light chain 9606
887 5Y7Z 2 C, D NANOBODY 9844
888 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
889 2BX5 1 A, B, C, D, E, F, G, H, I, J, K, L, M, N, O VD9 VKI LIGHT-CHAIN LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
890 6CK9 2 D 35O22 scFv heavy chain portion 9606
891 6CK9 3 E 35O22 scFv light chain portion 9606
892 6EQI 2 B Nb696 9844
893 6NNF 2 D 35O22 scFv heavy chain 9606
894 6NNF 3 E 35O22 scFv light chain 9606
895 6NNF 7 U VRC01 FR3-03 heavy chain 9606
896 6NNF 8 V VRC01 FR3-03 light chain 9606
897 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
898 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
899 4KFZ 2 C, D Anti-LMO2 VH 9606
900 6GK4 2 B, E Nanobody D12 9844
901 6GK4 3 C, F Nanobody T8 9844
902 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
903 2UUD 2 K, L NQ10-1.12 ANTI-PHOX ANTIBODY 10090
904 6OS1 2 D Nanobody Nb.AT110i1_le 32630
905 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
906 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
907 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
908 4Y5X 2 B, E, H, K diabody 310 VH domain 9606
909 6H3U 1 H, I scFv 4B6 VH 10090
910 6H3U 2 L, M scFv 4B6 VL 10090
911 6R7T 1 A anti MAGEB1 nanobody 9844
912 4YGA 2 B, D, F, H VHH-1B7 30538
913 6MU8 2 D 35O22 scFv heavy chain portion 9606
914 6MU8 3 E 35O22 scFv light chain portion 9606
915 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
916 4UT9 3 L, M, N, O BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, LIGHT CHAIN DOMAIN 9606
917 2A9N 1 L, M fluorescein-scfv light chain 9606
918 2A9N 2 H, I fluorescein-scfv heavy chain 9606
919 5XQY 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 Y96K mutant of REI VL 9606
920 5GS0 2 C, E light chain (anti-TLR3) 10090
921 5GS0 3 D, F heavy chain (anti-TLR3) 10090
922 5GS0 4 H, X heavy chain (anti-Lid) 10090
923 5GS0 5 L, Y light chain (anti-Lid) 10090
924 5YY5 2 H Heavy chain 9606
925 5YY5 3 L Light chain 9606
926 5YY5 4 C Heavy chain 9606
927 5YY5 5 D Light chain 9606
928 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
929 6O3C 2 B NbSmo8 9844
930 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
931 1KYO 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT RESIDUES 1-107 10090
932 5GRJ 1 H avelumab H chain 9606
933 5GRJ 2 L avelumab L chain 9606
934 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
935 4NKD 2 B, D, F, H Engineered scFv light chain 10090
936 6MUG 2 D 35O22 scFv heavy chain portion 9606
937 6MUG 3 E 35O22 scFv light chain portion 9606
938 6IW2 2 B, E, H, K, N, Q Heavy chain of monoclonal antibody 5A 9606
939 6IW2 3 C, F, I, L, O, R Light chain of monoclonal antibody 5A 9606
940 6N4Y 2 E, F, G, H Nanobody 43 Nanobody 43 9844
941 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
942 6TEJ 3 C Syb_NL5 32630
943 4KRO 2 B Nanobody/VHH domain EgA1 9844
944 3WXV 2 H