BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (712 letters)

Database: pdb_polypeptide 
           202,155 sequences; 49,994,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

4XMN:2:B|pdbid|entity|chain(s)|sequence                              1211   0.0  
4XMM:2:B|pdbid|entity|chain(s)|sequence                              1211   0.0  
3JRO:1:A|pdbid|entity|chain(s)|sequence                               862   0.0  
3BG1:2:B,C,F,G|pdbid|entity|chain(s)|sequence                         806   0.0  
3BG0:2:B,C,F,G|pdbid|entity|chain(s)|sequence                         806   0.0  
3IKO:2:B,E,H|pdbid|entity|chain(s)|sequence                           805   0.0  
3JRP:1:A|pdbid|entity|chain(s)|sequence                               149   1e-35
5UPR:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          33   2.4  
1Y6Z:1:A,B|pdbid|entity|chain(s)|sequence                              31   9.1  
>4XMN:2:B|pdbid|entity|chain(s)|sequence
          Length = 652

 Score = 1211 bits (3133), Expect = 0.0,   Method: Composition-based stats.
 Identities = 624/641 (97%), Positives = 624/641 (97%)

Query: 72  DLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECND 131
           D  DADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECND
Sbjct: 12  DQPDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECND 71

Query: 132 EIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYL 191
           EIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYL
Sbjct: 72  EIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYL 131

Query: 192 DKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKT 251
           DKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKT
Sbjct: 132 DKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKT 191

Query: 252 DNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLA 311
           DNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLA
Sbjct: 192 DNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLA 251

Query: 312 IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLF 371
           IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLF
Sbjct: 252 IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLF 311

Query: 372 SLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANEN 431
           SLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANEN
Sbjct: 312 SLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANEN 371

Query: 432 TEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDXXXXXXXXXXXXXXXHGHS 491
           TEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSD               HGHS
Sbjct: 372 TEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFAQLHGHS 431

Query: 492 LFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGN 551
           LFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGN
Sbjct: 432 LFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGN 491

Query: 552 YLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWS 611
           YLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWS
Sbjct: 492 YLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWS 551

Query: 612 VSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILE 671
           VSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILE
Sbjct: 552 VSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILE 611

Query: 672 KNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI 712
           KNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI
Sbjct: 612 KNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI 652
>4XMM:2:B|pdbid|entity|chain(s)|sequence
          Length = 652

 Score = 1211 bits (3133), Expect = 0.0,   Method: Composition-based stats.
 Identities = 624/641 (97%), Positives = 624/641 (97%)

Query: 72  DLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECND 131
           D  DADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECND
Sbjct: 12  DQPDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECND 71

Query: 132 EIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYL 191
           EIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYL
Sbjct: 72  EIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYL 131

Query: 192 DKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKT 251
           DKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKT
Sbjct: 132 DKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKT 191

Query: 252 DNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLA 311
           DNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLA
Sbjct: 192 DNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLA 251

Query: 312 IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLF 371
           IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLF
Sbjct: 252 IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLF 311

Query: 372 SLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANEN 431
           SLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANEN
Sbjct: 312 SLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANEN 371

Query: 432 TEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDXXXXXXXXXXXXXXXHGHS 491
           TEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSD               HGHS
Sbjct: 372 TEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFAQLHGHS 431

Query: 492 LFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGN 551
           LFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGN
Sbjct: 432 LFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGN 491

Query: 552 YLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWS 611
           YLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWS
Sbjct: 492 YLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWS 551

Query: 612 VSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILE 671
           VSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILE
Sbjct: 552 VSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILE 611

Query: 672 KNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI 712
           KNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI
Sbjct: 612 KNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI 652
>3JRO:1:A|pdbid|entity|chain(s)|sequence
          Length = 753

 Score =  862 bits (2228), Expect = 0.0,   Method: Composition-based stats.
 Identities = 432/447 (96%), Positives = 432/447 (96%)

Query: 109 ATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGK 168
           ATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGK
Sbjct: 307 ATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGK 366

Query: 169 SGVSIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKT 228
           SGVSIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKT
Sbjct: 367 SGVSIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKT 426

Query: 229 SSDYNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNS 288
           SSDYNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNS
Sbjct: 427 SSDYNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNS 486

Query: 289 SNEIEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGG 348
           SNEIEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGG
Sbjct: 487 SNEIEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGG 546

Query: 349 CSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHL 408
           CSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHL
Sbjct: 547 CSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHL 606

Query: 409 DKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSK 468
           DKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSK
Sbjct: 607 DKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSK 666

Query: 469 ETSDXXXXXXXXXXXXXXXHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHIL 528
           ETSD               HGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHIL
Sbjct: 667 ETSDEATFAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHIL 726

Query: 529 NRLKIPSQLIFNAQALKDRYEGNYLSE 555
           NRLKIPSQLIFNAQALKDRYEGNYLSE
Sbjct: 727 NRLKIPSQLIFNAQALKDRYEGNYLSE 753
>3BG1:2:B,C,F,G|pdbid|entity|chain(s)|sequence
          Length = 442

 Score =  806 bits (2082), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/428 (96%), Positives = 413/428 (96%)

Query: 126 FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL 185
           FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL
Sbjct: 15  FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL 74

Query: 186 FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV 245
           FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV
Sbjct: 75  FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV 134

Query: 246 SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV 305
           SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV
Sbjct: 135 SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV 194

Query: 306 RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS 365
           RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS
Sbjct: 195 RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS 254

Query: 366 PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL 425
           PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL
Sbjct: 255 PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL 314

Query: 426 YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDXXXXXXXXXXXXX 485
           YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSD             
Sbjct: 315 YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFA 374

Query: 486 XXHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK 545
             HGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK
Sbjct: 375 QLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK 434

Query: 546 DRYEGNYL 553
           DRYEGNYL
Sbjct: 435 DRYEGNYL 442
>3BG0:2:B,C,F,G|pdbid|entity|chain(s)|sequence
          Length = 442

 Score =  806 bits (2082), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/428 (96%), Positives = 413/428 (96%)

Query: 126 FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL 185
           FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL
Sbjct: 15  FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL 74

Query: 186 FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV 245
           FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV
Sbjct: 75  FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV 134

Query: 246 SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV 305
           SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV
Sbjct: 135 SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV 194

Query: 306 RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS 365
           RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS
Sbjct: 195 RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS 254

Query: 366 PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL 425
           PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL
Sbjct: 255 PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL 314

Query: 426 YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDXXXXXXXXXXXXX 485
           YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSD             
Sbjct: 315 YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFA 374

Query: 486 XXHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK 545
             HGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK
Sbjct: 375 QLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK 434

Query: 546 DRYEGNYL 553
           DRYEGNYL
Sbjct: 435 DRYEGNYL 442
>3IKO:2:B,E,H|pdbid|entity|chain(s)|sequence
          Length = 442

 Score =  805 bits (2079), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/428 (96%), Positives = 413/428 (96%)

Query: 126 FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL 185
           FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL
Sbjct: 15  FSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFL 74

Query: 186 FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV 245
           FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV
Sbjct: 75  FDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV 134

Query: 246 SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV 305
           SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV
Sbjct: 135 SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVV 194

Query: 306 RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS 365
           RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS
Sbjct: 195 RASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGS 254

Query: 366 PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL 425
           PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL
Sbjct: 255 PFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQL 314

Query: 426 YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDXXXXXXXXXXXXX 485
           YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSD             
Sbjct: 315 YAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFA 374

Query: 486 XXHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK 545
             HGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK
Sbjct: 375 QLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK 434

Query: 546 DRYEGNYL 553
           DRYEGNYL
Sbjct: 435 DRYEGNYL 442
>3JRP:1:A|pdbid|entity|chain(s)|sequence
          Length = 379

 Score =  149 bits (377), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/71 (100%), Positives = 71/71 (100%)

Query: 109 ATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGK 168
           ATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGK
Sbjct: 309 ATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGK 368

Query: 169 SGVSIKRLPTE 179
           SGVSIKRLPTE
Sbjct: 369 SGVSIKRLPTE 379
>5UPR:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 265

 Score = 32.7 bits (73), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 199 TIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKTDNDQVKM 258
           T+E R+S       ++  +  + L+ + +   + + WK   I ++PV   +     +   
Sbjct: 141 TLEERES------GQTQKVLSEQLEAVRQAVPEADAWKSIVIAYEPV---WAIGTGKTAT 191

Query: 259 ALLKKERHCRLTSWIVSQIGPEIEEKIR 286
           A L +E H  + +W+   + P++ E  R
Sbjct: 192 AALAQETHRDIRNWLAQAVSPKVAEATR 219
>1Y6Z:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 263

 Score = 30.8 bits (68), Expect = 9.1,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 608 DKWSVSINVFEVYLKL-VLDNVETQETIDSLI------SG-MKIFYDQY-KHCREVAACC 658
           DKW+  +N F  YLK+ V+++ E QE I SL+      SG  K   D Y ++ +E   C 
Sbjct: 145 DKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEFYSINSGDKKTDLDSYIENMKEDQKCI 204

Query: 659 NVMSQEIVSKILEKNNPSIGDSKA 682
             +S E  +K   +N+PS+   KA
Sbjct: 205 YYISGE--NKKTAQNSPSLEKLKA 226
  Database: pdb_polypeptide
    Posted date:  Sep 15, 2017  6:19 PM
  Number of letters in database: 49,994,932
  Number of sequences in database:  202,155
  
Lambda     K      H
   0.316    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 202155
Number of Hits to DB: 67,481,794
Number of extensions: 2800693
Number of successful extensions: 6368
Number of sequences better than 10.0: 10
Number of HSP's gapped: 6536
Number of HSP's successfully gapped: 10
Length of query: 712
Length of database: 49,994,932
Length adjustment: 114
Effective length of query: 598
Effective length of database: 26,949,262
Effective search space: 16115658676
Effective search space used: 16115658676
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)