BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (297 letters)

Database: pdb_polypeptide 
           202,155 sequences; 49,994,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3JRO:1:A|pdbid|entity|chain(s)|sequence                               581   e-166
3JRP:1:A|pdbid|entity|chain(s)|sequence                               553   e-157
4XMN:1:A|pdbid|entity|chain(s)|sequence                               540   e-154
4XMM:1:A|pdbid|entity|chain(s)|sequence                               540   e-154
4BZK:2:B|pdbid|entity|chain(s)|sequence                               540   e-154
3MZL:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         540   e-154
3MZK:1:A,D|pdbid|entity|chain(s)|sequence                             540   e-154
3IKO:1:A,D,G|pdbid|entity|chain(s)|sequence                           540   e-154
2PM6:2:B,D|pdbid|entity|chain(s)|sequence                             540   e-154
4BZK:3:F|pdbid|entity|chain(s)|sequence                               536   e-152
2PM9:2:B|pdbid|entity|chain(s)|sequence                               536   e-152
2PM7:2:B,D|pdbid|entity|chain(s)|sequence                             536   e-152
4BZJ:2:B|pdbid|entity|chain(s)|sequence                               527   e-150
4BZJ:3:F|pdbid|entity|chain(s)|sequence                               524   e-149
4L9O:1:A,B|pdbid|entity|chain(s)|sequence                             397   e-110
4YCZ:1:A|pdbid|entity|chain(s)|sequence                               324   1e-88
5A9Q:7:6,F,O,X|pdbid|entity|chain(s)|sequence                         258   1e-68
3BG1:1:A,D,E,H|pdbid|entity|chain(s)|sequence                         258   1e-68
3BG0:1:A,D,E,H|pdbid|entity|chain(s)|sequence                         258   1e-68
5A9Q:8:7,G,P,Y|pdbid|entity|chain(s)|sequence                         124   2e-28
3F3P:1:A,B,E,F,I,J|pdbid|entity|chain(s)|sequence                      87   4e-17
3F3G:1:A,B,E,F|pdbid|entity|chain(s)|sequence                          87   4e-17
3F3F:1:A,B,E,F|pdbid|entity|chain(s)|sequence                          87   4e-17
4XMM:3:C|pdbid|entity|chain(s)|sequence                                87   5e-17
3EWE:1:A,C|pdbid|entity|chain(s)|sequence                              87   5e-17
3FM0:1:A|pdbid|entity|chain(s)|sequence                                74   2e-13
1VYH:2:C,D,G,H,K,L,O,P,S,T|pdbid|entity|chain(s)|sequence              64   4e-10
5XJC:5:E|pdbid|entity|chain(s)|sequence                                60   6e-09
5O9Z:4:D|pdbid|entity|chain(s)|sequence                                60   6e-09
5MQF:6:F|pdbid|entity|chain(s)|sequence                                60   6e-09
3JCR:2:D|pdbid|entity|chain(s)|sequence                                60   6e-09
2YMU:1:A,B|pdbid|entity|chain(s)|sequence                              57   5e-08
5AFU:3:3,4|pdbid|entity|chain(s)|sequence                              52   2e-06
5NNZ:1:A,B|pdbid|entity|chain(s)|sequence                              50   4e-06
4WJS:1:A|pdbid|entity|chain(s)|sequence                                50   6e-06
1ERJ:1:A,B,C|pdbid|entity|chain(s)|sequence                            48   2e-05
3SHF:1:A|pdbid|entity|chain(s)|sequence                                47   4e-05
3SFZ:1:A|pdbid|entity|chain(s)|sequence                                47   4e-05
2HES:1:X|pdbid|entity|chain(s)|sequence                                46   8e-05
5MZH:1:A,B|pdbid|entity|chain(s)|sequence                              45   2e-04
2OVR:2:B|pdbid|entity|chain(s)|sequence                                45   2e-04
2OVQ:2:B|pdbid|entity|chain(s)|sequence                                45   2e-04
2OVP:2:B|pdbid|entity|chain(s)|sequence                                45   2e-04
5V4B:2:B|pdbid|entity|chain(s)|sequence                                45   2e-04
3UVO:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
3UVN:1:A,C|pdbid|entity|chain(s)|sequence                              44   4e-04
3UVM:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
3UVL:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
3UVK:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
3PSL:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2G99:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
3EMH:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
5A9Q:3:2,K,T,b|pdbid|entity|chain(s)|sequence                          44   4e-04
5EAR:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
5EAP:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
5EAM:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
5EAL:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
4QQE:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4QL1:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
4O45:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4IA9:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4A7J:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
3UR4:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
3SMR:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          44   4e-04
3P4F:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
2H14:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
2H13:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4CY2:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4CY1:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2G9A:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4Y7R:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4GMB:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4GM9:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
4GM8:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          44   4e-04
4GM3:1:A,B,C,D,E,F,G,H|pdbid|entity|chain(s)|sequence                  44   4e-04
2XL3:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2XL2:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
5VFC:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
5SXM:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
4EWR:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4ESG:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
4ES0:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4ERZ:1:A,B,C|pdbid|entity|chain(s)|sequence                            44   4e-04
4ERY:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
4ERQ:1:A,B,C|pdbid|entity|chain(s)|sequence                            44   4e-04
3EG6:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
2H6Q:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2H6N:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2H6K:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2H68:1:A,B|pdbid|entity|chain(s)|sequence                              44   4e-04
2O9K:1:A,C|pdbid|entity|chain(s)|sequence                              44   4e-04
2H9N:1:A,C|pdbid|entity|chain(s)|sequence                              44   4e-04
2H9M:1:A,C|pdbid|entity|chain(s)|sequence                              44   4e-04
5FVM:2:C,D|pdbid|entity|chain(s)|sequence                              44   4e-04
2GNQ:1:A|pdbid|entity|chain(s)|sequence                                44   4e-04
5WVE:1:A,C,E,G,I,K,M|pdbid|entity|chain(s)|sequence                    44   4e-04
5JUY:1:A,B,C,D,E,F,G|pdbid|entity|chain(s)|sequence                    44   4e-04
3JBT:1:A,C,E,G,I,K,M|pdbid|entity|chain(s)|sequence                    44   4e-04
3J2T:1:A,B,C,D,E,F,G|pdbid|entity|chain(s)|sequence                    44   4e-04
5JCS:30:q|pdbid|entity|chain(s)|sequence                               43   6e-04
5FL8:41:q|pdbid|entity|chain(s)|sequence                               43   6e-04
4WJU:1:A,B|pdbid|entity|chain(s)|sequence                              43   6e-04
4V7F:46:q|pdbid|entity|chain(s)|sequence                               43   6e-04
3JCT:50:x|pdbid|entity|chain(s)|sequence                               43   6e-04
3DM0:1:A|pdbid|entity|chain(s)|sequence                                43   6e-04
5XJC:23:W|pdbid|entity|chain(s)|sequence                               42   0.001
5MQF:5:E|pdbid|entity|chain(s)|sequence                                42   0.001
5WYK:18:BC|pdbid|entity|chain(s)|sequence                              42   0.001
5WYJ:18:BC|pdbid|entity|chain(s)|sequence                              42   0.001
5WSG:4:O|pdbid|entity|chain(s)|sequence                                42   0.001
5MQ0:9:J|pdbid|entity|chain(s)|sequence                                42   0.001
5MPS:9:J|pdbid|entity|chain(s)|sequence                                42   0.001
5LQW:9:K|pdbid|entity|chain(s)|sequence                                42   0.001
5LJ5:13:J|pdbid|entity|chain(s)|sequence                               42   0.001
5LJ3:12:J|pdbid|entity|chain(s)|sequence                               42   0.001
5GMK:10:O|pdbid|entity|chain(s)|sequence                               42   0.001
5GM6:14:O|pdbid|entity|chain(s)|sequence                               42   0.001
5T2A:57:7|pdbid|entity|chain(s)|sequence                               42   0.001
4WJV:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          41   0.002
3N0E:1:A|pdbid|entity|chain(s)|sequence                                41   0.002
5K1B:1:B|pdbid|entity|chain(s)|sequence                                41   0.002
5K1A:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          41   0.002
5CVN:1:A|pdbid|entity|chain(s)|sequence                                41   0.002
5CVL:1:A|pdbid|entity|chain(s)|sequence                                41   0.002
5K1C:2:B|pdbid|entity|chain(s)|sequence                                41   0.002
5CVO:1:A,D|pdbid|entity|chain(s)|sequence                              41   0.002
5L8W:2:B|pdbid|entity|chain(s)|sequence                                41   0.002
5L8E:1:A,B|pdbid|entity|chain(s)|sequence                              41   0.002
3N0D:1:A|pdbid|entity|chain(s)|sequence                                41   0.003
4CY5:1:A|pdbid|entity|chain(s)|sequence                                40   0.004
4CY3:1:A|pdbid|entity|chain(s)|sequence                                40   0.004
5M25:1:A|pdbid|entity|chain(s)|sequence                                40   0.004
5M23:1:A|pdbid|entity|chain(s)|sequence                                40   0.004
2B4E:1:A|pdbid|entity|chain(s)|sequence                                40   0.004
2AQ5:1:A|pdbid|entity|chain(s)|sequence                                40   0.004
2CO0:1:A|pdbid|entity|chain(s)|sequence                                39   0.008
2H9P:1:A|pdbid|entity|chain(s)|sequence                                39   0.009
2H9L:1:A|pdbid|entity|chain(s)|sequence                                39   0.009
3MXX:1:A|pdbid|entity|chain(s)|sequence                                39   0.009
2YBA:1:A,B|pdbid|entity|chain(s)|sequence                              38   0.017
2YB8:2:B|pdbid|entity|chain(s)|sequence                                38   0.017
3V7D:2:B,D|pdbid|entity|chain(s)|sequence                              38   0.017
3MKS:2:B,D|pdbid|entity|chain(s)|sequence                              38   0.017
1NEX:2:B,D|pdbid|entity|chain(s)|sequence                              38   0.017
3C9C:1:A|pdbid|entity|chain(s)|sequence                                38   0.018
3C99:1:A|pdbid|entity|chain(s)|sequence                                38   0.018
2XYI:1:A|pdbid|entity|chain(s)|sequence                                38   0.018
4V5O:27:AR,BR|pdbid|entity|chain(s)|sequence                           38   0.019
4BTS:28:AR,BR,CR,DR|pdbid|entity|chain(s)|sequence                     38   0.019
2CO0:3:C|pdbid|entity|chain(s)|sequence                                38   0.021
2CNX:1:A|pdbid|entity|chain(s)|sequence                                38   0.021
5NRL:15:H|pdbid|entity|chain(s)|sequence                               38   0.022
5GAP:6:H|pdbid|entity|chain(s)|sequence                                38   0.022
5GAN:4:H|pdbid|entity|chain(s)|sequence                                38   0.022
3JCM:2:B|pdbid|entity|chain(s)|sequence                                38   0.022
5NAF:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          38   0.024
4LG9:1:A|pdbid|entity|chain(s)|sequence                                38   0.024
5FXY:1:A,C,E,G|pdbid|entity|chain(s)|sequence                          38   0.027
4R7A:2:B|pdbid|entity|chain(s)|sequence                                38   0.027
4PC0:1:A,B|pdbid|entity|chain(s)|sequence                              38   0.027
4PBZ:1:A|pdbid|entity|chain(s)|sequence                                38   0.027
4PBY:1:A,B|pdbid|entity|chain(s)|sequence                              38   0.027
3GFC:1:A|pdbid|entity|chain(s)|sequence                                38   0.027
2XU7:1:A,B|pdbid|entity|chain(s)|sequence                              38   0.027
5FA5:2:B|pdbid|entity|chain(s)|sequence                                37   0.028
3CFV:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.029
3CFS:1:B|pdbid|entity|chain(s)|sequence                                37   0.029
3OW8:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          37   0.031
4XYI:1:A|pdbid|entity|chain(s)|sequence                                37   0.033
4XYH:1:A|pdbid|entity|chain(s)|sequence                                37   0.033
5EMM:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
5EML:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
5EMK:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
5EMJ:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
5C9Z:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
4X63:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
4X61:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
4X60:2:B|pdbid|entity|chain(s)|sequence                                37   0.034
5I2T:1:A|pdbid|entity|chain(s)|sequence                                37   0.035
5WYK:16:BA|pdbid|entity|chain(s)|sequence                              37   0.036
5WYJ:16:BA|pdbid|entity|chain(s)|sequence                              37   0.036
4GQB:2:B|pdbid|entity|chain(s)|sequence                                37   0.036
4V6W:2:Ag|pdbid|entity|chain(s)|sequence                               37   0.041
4XF2:3:C,V|pdbid|entity|chain(s)|sequence                              36   0.062
4XEI:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9U:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9S:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9P:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9N:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9L:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9K:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
2P9I:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
1U2V:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
1TYQ:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
1K8K:3:C|pdbid|entity|chain(s)|sequence                                36   0.062
5O9Z:6:F|pdbid|entity|chain(s)|sequence                                36   0.064
3JCR:23:L|pdbid|entity|chain(s)|sequence                               36   0.064
4JD2:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3ULE:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3UKU:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3UKR:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3RSE:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3DXM:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3DXK:3:C|pdbid|entity|chain(s)|sequence                                36   0.079
3JAQ:36:g|pdbid|entity|chain(s)|sequence                               36   0.083
3JAP:36:g|pdbid|entity|chain(s)|sequence                               36   0.083
3JAM:34:g|pdbid|entity|chain(s)|sequence                               36   0.083
3J81:32:g|pdbid|entity|chain(s)|sequence                               36   0.083
3J80:34:g|pdbid|entity|chain(s)|sequence                               36   0.083
5IT9:33:g|pdbid|entity|chain(s)|sequence                               36   0.088
5IT7:80:g|pdbid|entity|chain(s)|sequence                               36   0.088
3W15:1:A|pdbid|entity|chain(s)|sequence                                36   0.10 
3JB9:25:g|pdbid|entity|chain(s)|sequence                               35   0.12 
4V8M:8:A7|pdbid|entity|chain(s)|sequence                               35   0.13 
3JB9:11:K|pdbid|entity|chain(s)|sequence                               35   0.13 
4OZU:1:A|pdbid|entity|chain(s)|sequence                                35   0.14 
5M2N:1:A|pdbid|entity|chain(s)|sequence                                35   0.14 
4XFV:1:A|pdbid|entity|chain(s)|sequence                                35   0.14 
4AOW:1:A,B,C|pdbid|entity|chain(s)|sequence                            35   0.16 
4D6V:1:A|pdbid|entity|chain(s)|sequence                                35   0.20 
3ODT:1:A,B|pdbid|entity|chain(s)|sequence                              35   0.21 
5OA3:37:g|pdbid|entity|chain(s)|sequence                               35   0.21 
5A2Q:35:g|pdbid|entity|chain(s)|sequence                               35   0.21 
5GVA:1:A|pdbid|entity|chain(s)|sequence                                35   0.21 
5VYC:9:g1,g2,g3,g4,g5,g6|pdbid|entity|chain(s)|sequence                35   0.22 
5T2C:78:AI|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZZ:84:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZY:82:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZX:84:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZW:84:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZV:84:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZU:83:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZT:84:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LZS:83:gg|pdbid|entity|chain(s)|sequence                              35   0.22 
5LKS:68:Sg|pdbid|entity|chain(s)|sequence                              35   0.22 
5FLX:34:g|pdbid|entity|chain(s)|sequence                               35   0.22 
5AJ0:82:Bg|pdbid|entity|chain(s)|sequence                              35   0.22 
4V6X:2:Ag|pdbid|entity|chain(s)|sequence                               35   0.22 
4V5Z:9:Aa|pdbid|entity|chain(s)|sequence                               35   0.22 
4UJE:37:Bg|pdbid|entity|chain(s)|sequence                              35   0.22 
4UJD:83:Cg|pdbid|entity|chain(s)|sequence                              35   0.22 
4UJC:83:Cg|pdbid|entity|chain(s)|sequence                              35   0.22 
4UG0:70:Sg|pdbid|entity|chain(s)|sequence                              35   0.22 
4KZZ:33:g|pdbid|entity|chain(s)|sequence                               35   0.22 
4KZY:33:g|pdbid|entity|chain(s)|sequence                               35   0.22 
4KZX:33:g|pdbid|entity|chain(s)|sequence                               35   0.22 
4D61:34:g|pdbid|entity|chain(s)|sequence                               35   0.22 
4D5L:34:g|pdbid|entity|chain(s)|sequence                               35   0.22 
3J7R:83:Sg|pdbid|entity|chain(s)|sequence                              35   0.22 
3J7P:82:Sg|pdbid|entity|chain(s)|sequence                              35   0.22 
5NZV:1:A,H|pdbid|entity|chain(s)|sequence                              34   0.23 
5NZU:1:A|pdbid|entity|chain(s)|sequence                                34   0.23 
5NZT:1:A|pdbid|entity|chain(s)|sequence                                34   0.23 
5NZS:1:A|pdbid|entity|chain(s)|sequence                                34   0.23 
5NZR:1:A|pdbid|entity|chain(s)|sequence                                34   0.23 
5A1Y:2:C,K|pdbid|entity|chain(s)|sequence                              34   0.23 
5A1X:2:C,K|pdbid|entity|chain(s)|sequence                              34   0.23 
5A1W:2:C|pdbid|entity|chain(s)|sequence                                34   0.23 
5A1V:2:C,K,T|pdbid|entity|chain(s)|sequence                            34   0.23 
5A1U:2:C|pdbid|entity|chain(s)|sequence                                34   0.23 
5K0Y:35:m|pdbid|entity|chain(s)|sequence                               34   0.24 
3JAN:86:Sg|pdbid|entity|chain(s)|sequence                              34   0.24 
3JAJ:87:Sg|pdbid|entity|chain(s)|sequence                              34   0.24 
3JAI:84:gg|pdbid|entity|chain(s)|sequence                              34   0.24 
3JAH:84:gg|pdbid|entity|chain(s)|sequence                              34   0.24 
3JAG:84:gg|pdbid|entity|chain(s)|sequence                              34   0.24 
5NUV:1:A|pdbid|entity|chain(s)|sequence                                34   0.27 
5LCW:15:R|pdbid|entity|chain(s)|sequence                               34   0.27 
5KHU:14:R,S|pdbid|entity|chain(s)|sequence                             34   0.27 
5KHR:14:R|pdbid|entity|chain(s)|sequence                               34   0.27 
5G04:14:R|pdbid|entity|chain(s)|sequence                               34   0.27 
5VLJ:2:B,C|pdbid|entity|chain(s)|sequence                              34   0.30 
5VH9:2:B|pdbid|entity|chain(s)|sequence                                34   0.30 
1PEV:1:A|pdbid|entity|chain(s)|sequence                                34   0.33 
1NR0:1:A|pdbid|entity|chain(s)|sequence                                34   0.33 
4GGD:1:A,B|pdbid|entity|chain(s)|sequence                              34   0.34 
5HQG:1:A|pdbid|entity|chain(s)|sequence                                34   0.34 
5IGQ:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence                      34   0.35 
4GGA:1:A|pdbid|entity|chain(s)|sequence                                34   0.35 
5LCW:14:Q|pdbid|entity|chain(s)|sequence                               34   0.36 
5XJC:36:q,r,s,t|pdbid|entity|chain(s)|sequence                         34   0.39 
5MQF:7:G,H,I,J|pdbid|entity|chain(s)|sequence                          34   0.39 
5NZV:4:C,J|pdbid|entity|chain(s)|sequence                              33   0.40 
5NZU:3:C|pdbid|entity|chain(s)|sequence                                33   0.40 
5NZT:4:C,H|pdbid|entity|chain(s)|sequence                              33   0.40 
5NZS:3:C|pdbid|entity|chain(s)|sequence                                33   0.40 
5NZR:3:C|pdbid|entity|chain(s)|sequence                                33   0.40 
5A1Y:3:D,L|pdbid|entity|chain(s)|sequence                              33   0.40 
5A1X:3:D,L|pdbid|entity|chain(s)|sequence                              33   0.40 
5A1W:3:D|pdbid|entity|chain(s)|sequence                                33   0.40 
5A1V:3:D,L,U|pdbid|entity|chain(s)|sequence                            33   0.40 
5A1U:3:D|pdbid|entity|chain(s)|sequence                                33   0.40 
3MKQ:1:A,C,E|pdbid|entity|chain(s)|sequence                            33   0.49 
4N14:1:A|pdbid|entity|chain(s)|sequence                                33   0.50 
4GGC:1:A|pdbid|entity|chain(s)|sequence                                33   0.50 
1P22:1:A|pdbid|entity|chain(s)|sequence                                33   0.52 
4LG8:1:A|pdbid|entity|chain(s)|sequence                                33   0.54 
5K1C:3:C|pdbid|entity|chain(s)|sequence                                33   0.57 
5K19:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   0.57 
2YNP:1:A|pdbid|entity|chain(s)|sequence                                33   0.58 
5TF2:1:A|pdbid|entity|chain(s)|sequence                                33   0.61 
4J86:1:A,B|pdbid|entity|chain(s)|sequence                              33   0.72 
4J84:1:A,B|pdbid|entity|chain(s)|sequence                              33   0.72 
4J82:1:A,B|pdbid|entity|chain(s)|sequence                              33   0.72 
4J81:1:A,B|pdbid|entity|chain(s)|sequence                              33   0.72 
4J79:1:A|pdbid|entity|chain(s)|sequence                                33   0.72 
4J78:1:A|pdbid|entity|chain(s)|sequence                                33   0.72 
4J77:2:A,B|pdbid|entity|chain(s)|sequence                              33   0.72 
4J73:1:A|pdbid|entity|chain(s)|sequence                                33   0.72 
2YNO:1:A,B|pdbid|entity|chain(s)|sequence                              33   0.77 
2YNN:1:A|pdbid|entity|chain(s)|sequence                                33   0.77 
4A11:2:B|pdbid|entity|chain(s)|sequence                                32   0.91 
4V7E:10:Bg|pdbid|entity|chain(s)|sequence                              32   0.94 
4V3P:1:Sa|pdbid|entity|chain(s)|sequence                               32   0.94 
4AEZ:1:A,D,G|pdbid|entity|chain(s)|sequence                            32   1.1  
4J8G:1:A,B|pdbid|entity|chain(s)|sequence                              32   1.2  
4J8B:1:A|pdbid|entity|chain(s)|sequence                                32   1.2  
4J87:1:A|pdbid|entity|chain(s)|sequence                                32   1.2  
5L9U:14:R|pdbid|entity|chain(s)|sequence                               32   1.4  
5L9T:14:R|pdbid|entity|chain(s)|sequence                               32   1.4  
4UI9:15:R|pdbid|entity|chain(s)|sequence                               32   1.4  
3ZWL:1:B,D|pdbid|entity|chain(s)|sequence                              32   1.4  
5XJC:20:T|pdbid|entity|chain(s)|sequence                               32   1.6  
5MQF:4:D|pdbid|entity|chain(s)|sequence                                32   1.6  
5A5U:3:I|pdbid|entity|chain(s)|sequence                                32   1.6  
4U1E:1:I|pdbid|entity|chain(s)|sequence                                32   1.6  
3JAQ:45:q|pdbid|entity|chain(s)|sequence                               32   1.6  
3JAP:45:q|pdbid|entity|chain(s)|sequence                               32   1.6  
5MC6:16:O|pdbid|entity|chain(s)|sequence                               32   1.7  
5JUU:49:WA|pdbid|entity|chain(s)|sequence                              32   1.7  
5JUT:49:WA|pdbid|entity|chain(s)|sequence                              32   1.7  
5JUS:49:WA|pdbid|entity|chain(s)|sequence                              32   1.7  
5JUP:49:WA|pdbid|entity|chain(s)|sequence                              32   1.7  
5JUO:49:WA|pdbid|entity|chain(s)|sequence                              32   1.7  
4V8Z:7:A6|pdbid|entity|chain(s)|sequence                               32   1.7  
4V8Y:7:A6|pdbid|entity|chain(s)|sequence                               32   1.7  
4V88:34:Ag,Cg|pdbid|entity|chain(s)|sequence                           32   1.7  
4V7R:21:AT,CT|pdbid|entity|chain(s)|sequence                           32   1.7  
4V6I:1:Aa|pdbid|entity|chain(s)|sequence                               32   1.7  
3J78:45:RC|pdbid|entity|chain(s)|sequence                              32   1.7  
3J77:45:RC|pdbid|entity|chain(s)|sequence                              32   1.7  
3J6Y:79:RA|pdbid|entity|chain(s)|sequence                              32   1.7  
3J6X:79:RA|pdbid|entity|chain(s)|sequence                              32   1.7  
3FRX:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          32   1.7  
2PBI:2:B,D|pdbid|entity|chain(s)|sequence                              32   1.7  
5TGM:34:SR|pdbid|entity|chain(s)|sequence                              32   1.7  
5TGM:83:sR|pdbid|entity|chain(s)|sequence                              32   1.7  
5TGA:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5TBW:81:Rb,h|pdbid|entity|chain(s)|sequence                            32   1.7  
5MEI:81:h,sR|pdbid|entity|chain(s)|sequence                            32   1.7  
5M1J:14:g2|pdbid|entity|chain(s)|sequence                              32   1.7  
5LYB:83:sR|pdbid|entity|chain(s)|sequence                              32   1.7  
5LYB:34:SR|pdbid|entity|chain(s)|sequence                              32   1.7  
5I4L:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5FCJ:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5FCI:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5DGV:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5DGF:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5DGE:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5DC3:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
5DAT:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4V92:35:Bg|pdbid|entity|chain(s)|sequence                              32   1.7  
4UER:28:R|pdbid|entity|chain(s)|sequence                               32   1.7  
4U6F:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U56:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U55:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U53:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U52:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U51:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U50:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4Z:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4Y:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4U:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4R:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4Q:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4O:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U4N:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U3U:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U3N:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
4U3M:34:SR,sR|pdbid|entity|chain(s)|sequence                           32   1.7  
3RFH:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          32   1.7  
3RFG:1:A,B|pdbid|entity|chain(s)|sequence                              32   1.7  
1TRJ:3:A|pdbid|entity|chain(s)|sequence                                32   1.7  
4V7H:17:AR|pdbid|entity|chain(s)|sequence                              31   2.1  
4YVD:1:A|pdbid|entity|chain(s)|sequence                                31   2.6  
5GXI:1:A|pdbid|entity|chain(s)|sequence                                31   2.6  
5GXH:1:A|pdbid|entity|chain(s)|sequence                                31   2.6  
5THA:1:A|pdbid|entity|chain(s)|sequence                                31   2.6  
5TEF:1:A|pdbid|entity|chain(s)|sequence                                31   2.6  
5TEE:1:A|pdbid|entity|chain(s)|sequence                                31   2.6  
5H1M:1:A|pdbid|entity|chain(s)|sequence                                31   2.8  
5H1L:1:A|pdbid|entity|chain(s)|sequence                                31   2.8  
5H1K:1:A,B|pdbid|entity|chain(s)|sequence                              31   2.8  
5H1J:1:A|pdbid|entity|chain(s)|sequence                                31   2.8  
5H3U:1:A,B|pdbid|entity|chain(s)|sequence                              31   2.9  
5H3T:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          31   2.9  
5H3S:1:A,B|pdbid|entity|chain(s)|sequence                              31   2.9  
4O9D:1:A,B|pdbid|entity|chain(s)|sequence                              30   3.4  
4BZK:1:A,C|pdbid|entity|chain(s)|sequence                              30   3.5  
4BZJ:1:A,C|pdbid|entity|chain(s)|sequence                              30   3.5  
3DWL:2:C,H|pdbid|entity|chain(s)|sequence                              30   4.0  
5WSG:21:n|pdbid|entity|chain(s)|sequence                               30   4.5  
5MQ0:21:o|pdbid|entity|chain(s)|sequence                               30   4.5  
5MPS:21:o|pdbid|entity|chain(s)|sequence                               30   4.5  
5GMK:24:n|pdbid|entity|chain(s)|sequence                               30   4.5  
5GM6:36:n|pdbid|entity|chain(s)|sequence                               30   4.5  
5WYK:5:3F|pdbid|entity|chain(s)|sequence                               30   6.2  
5WYJ:5:3F|pdbid|entity|chain(s)|sequence                               30   6.2  
5TZS:39:g|pdbid|entity|chain(s)|sequence                               30   6.2  
5JPQ:11:Y|pdbid|entity|chain(s)|sequence                               30   6.2  
4J0X:1:A,B|pdbid|entity|chain(s)|sequence                              30   6.2  
5CXB:1:A|pdbid|entity|chain(s)|sequence                                30   6.3  
5CXC:1:A|pdbid|entity|chain(s)|sequence                                30   6.8  
5CYK:1:A|pdbid|entity|chain(s)|sequence                                30   7.0  
5EM2:2:B,D|pdbid|entity|chain(s)|sequence                              30   7.1  
4U7A:1:A|pdbid|entity|chain(s)|sequence                                29   7.7  
5WYK:17:BB|pdbid|entity|chain(s)|sequence                              29   7.9  
5WYJ:17:BB|pdbid|entity|chain(s)|sequence                              29   7.9  
>3JRO:1:A|pdbid|entity|chain(s)|sequence
          Length = 753

 Score =  581 bits (1497), Expect = e-166,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>3JRP:1:A|pdbid|entity|chain(s)|sequence
          Length = 379

 Score =  553 bits (1426), Expect = e-157,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 3   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 62

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 63  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 122

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 123 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 182

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 183 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 242

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 243 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 299
>4XMN:1:A|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>4XMM:1:A|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>4BZK:2:B|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>3MZL:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>3MZK:1:A,D|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>3IKO:1:A,D,G|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>2PM6:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  540 bits (1392), Expect = e-154,   Method: Composition-based stats.
 Identities = 284/297 (95%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>4BZK:3:F|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  536 bits (1382), Expect = e-152,   Method: Composition-based stats.
 Identities = 278/297 (93%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNE+IHDAV+DYYGKR+ATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNEMIHDAVMDYYGKRMATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKV+IWKEENGRWSQI             QWAPHEYGP+LLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVMIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPMLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSY+ASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYMASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>2PM9:2:B|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  536 bits (1382), Expect = e-152,   Method: Composition-based stats.
 Identities = 278/297 (93%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNE+IHDAV+DYYGKR+ATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNEMIHDAVMDYYGKRMATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKV+IWKEENGRWSQI             QWAPHEYGP+LLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVMIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPMLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSY+ASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYMASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>2PM7:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 297

 Score =  536 bits (1382), Expect = e-152,   Method: Composition-based stats.
 Identities = 278/297 (93%), Positives = 284/297 (95%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60
           MVVIANAHNE+IHDAV+DYYGKR+ATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
Sbjct: 1   MVVIANAHNEMIHDAVMDYYGKRMATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD 60

Query: 61  WAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS 120
           WAHPKFGTILASCSYDGKV+IWKEENGRWSQI             QWAPHEYGP+LLVAS
Sbjct: 61  WAHPKFGTILASCSYDGKVMIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPMLLVAS 120

Query: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180
           SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
Sbjct: 121 SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN 180

Query: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSY+ASVSQDRTCIIWTQDNEQ
Sbjct: 181 LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYMASVSQDRTCIIWTQDNEQ 240

Query: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
           GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sbjct: 241 GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
>4BZJ:2:B|pdbid|entity|chain(s)|sequence
          Length = 291

 Score =  527 bits (1358), Expect = e-150,   Method: Composition-based stats.
 Identities = 278/291 (95%), Positives = 278/291 (95%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW
Sbjct: 1   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 60

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASS 121
           AHPKFGTILASCSYDGKVLIWKEENGRWSQI             QWAPHEYGPLLLVASS
Sbjct: 61  AHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASS 120

Query: 122 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL 181
           DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL
Sbjct: 121 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL 180

Query: 182 VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQG 241
           VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQG
Sbjct: 181 VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQG 240

Query: 242 PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPA 292
           PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPA
Sbjct: 241 PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPA 291
>4BZJ:3:F|pdbid|entity|chain(s)|sequence
          Length = 291

 Score =  524 bits (1350), Expect = e-149,   Method: Composition-based stats.
 Identities = 272/291 (93%), Positives = 278/291 (95%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           VVIANAHNE+IHDAV+DYYGKR+ATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW
Sbjct: 1   VVIANAHNEMIHDAVMDYYGKRMATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 60

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASS 121
           AHPKFGTILASCSYDGKV+IWKEENGRWSQI             QWAPHEYGP+LLVASS
Sbjct: 61  AHPKFGTILASCSYDGKVMIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPMLLVASS 120

Query: 122 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL 181
           DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL
Sbjct: 121 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL 180

Query: 182 VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQG 241
           VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSY+ASVSQDRTCIIWTQDNEQG
Sbjct: 181 VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYMASVSQDRTCIIWTQDNEQG 240

Query: 242 PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPA 292
           PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPA
Sbjct: 241 PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPA 291
>4L9O:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 349

 Score =  397 bits (1020), Expect = e-110,   Method: Composition-based stats.
 Identities = 192/296 (64%), Positives = 236/296 (79%), Gaps = 8/296 (2%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V I NAH++LIHDAVLDYYG+RLATCSSDKTIKIFE++GE  +L++TL GHEGPVW+V W
Sbjct: 62  VTIGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIDGENQRLVETLIGHEGPVWQVAW 121

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASS 121
           AHPKFG ILASCSYDGKVLIWKE+NG W+++              WAPHEYGP+LL ASS
Sbjct: 122 AHPKFGVILASCSYDGKVLIWKEDNGVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASS 181

Query: 122 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL 181
           DGK+S+VEFK+ G   PI+I  HAIGVN+ASWAP ++ ++        +R+FV+GG DNL
Sbjct: 182 DGKISIVEFKDGGALEPIVIQGHAIGVNAASWAPISLPDN--------TRRFVSGGCDNL 233

Query: 182 VKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQG 241
           VKIW+Y+  A+T++ E   +GHSDWVRDVAWSP+ L +SY+A+ SQDRT +IWT+D +  
Sbjct: 234 VKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSRLSKSYIATASQDRTVLIWTKDGKSN 293

Query: 242 PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297
            W+K  L +EKFPDV WRASWSLSGNVLA+SGGDNKVTLWKEN++GKWE AGEV Q
Sbjct: 294 KWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKENIQGKWESAGEVDQ 349
>4YCZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 876

 Score =  324 bits (830), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 173/295 (58%), Positives = 205/295 (69%), Gaps = 11/295 (3%)

Query: 3   VIANA-HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           VIAN+ H+++IHDAVLDYYG+RLATCSSD+TIKIFE+EGET +L +TL GH+G VW V W
Sbjct: 11  VIANSGHDDMIHDAVLDYYGRRLATCSSDRTIKIFEIEGETQRLTETLKGHDGAVWCVSW 70

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASS 121
           AHPK+G ILAS  YDGKVLIW+E NG W +I              W+PHE G LL  ASS
Sbjct: 71  AHPKYGNILASAGYDGKVLIWRELNGAWQRIFDFALHKASVNVVSWSPHEAGCLLACASS 130

Query: 122 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPAT----IEEDGEHNGTKESRKFVTGG 177
           DG VSV+EF++N      I  AH +GVNS SWAPAT    I        +  +R+FVTGG
Sbjct: 131 DGNVSVLEFRDNSWEHS-IFHAHGLGVNSVSWAPATSPGSIVSSKPGPKSTGNRRFVTGG 189

Query: 178 ADNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQ 236
           +DN +KIW Y+    TY LE   L GH+DWVRDVAWSPTVL +SY+AS S+DRT  IWT 
Sbjct: 190 SDNALKIWAYDPATNTYKLEREPLTGHTDWVRDVAWSPTVLQKSYIASASEDRTVRIWTS 249

Query: 237 DNEQG-PWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWE 290
           D      W   +L    F   +WR SWSLSGNVLA SGGDNKVTLWKENL+G+WE
Sbjct: 250 DPANPLQWNCKVL---NFDAAVWRVSWSLSGNVLAASGGDNKVTLWKENLKGEWE 301
>5A9Q:7:6,F,O,X|pdbid|entity|chain(s)|sequence
          Length = 322

 Score =  258 bits (658), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 145/301 (48%), Positives = 193/301 (64%), Gaps = 10/301 (3%)

Query: 4   IANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAH 63
           +  +H ++IHDA +DYYG RLATCSSD+++KIF+V      LI  L GHEGPVW+V WAH
Sbjct: 8   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAH 67

Query: 64  PKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG 123
           P +G ILASCSYD KV+IW+EENG W +               WAPH+YG +L   SSDG
Sbjct: 68  PMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDG 127

Query: 124 KVSVVEFKENGT-TSPIIIDAHAIGVNSASWAPATIEED--GEHNGTKES--RKFVTGGA 178
            +S++ +   G      I +AH IG N+ SWAPA +        +G K +  ++F +GG 
Sbjct: 128 AISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGC 187

Query: 179 DNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV-LLRSYLASVSQDRTCIIWTQD 237
           DNL+K+WK   D Q +  E  LE HSDWVRDVAW+P++ L  S +AS SQD    IWT D
Sbjct: 188 DNLIKLWKEEEDGQ-WKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCD 246

Query: 238 N-EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVH 296
           +     W   LL   KF DV+W  SWS++ N+LA+SGGDNKVTLWKE+++G+W    +V+
Sbjct: 247 DASSNTWSPKLL--HKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN 304

Query: 297 Q 297
           +
Sbjct: 305 K 305

 Score = 35.8 bits (81), Expect = 0.094,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 83/238 (34%), Gaps = 54/238 (22%)

Query: 20  YGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           YG  LA+CS D+ + I+  E  T +      GH+  V  V WA   +G ILA  S DG +
Sbjct: 70  YGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAI 129

Query: 80  -LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSP 138
            L+     G+W                 WAP      L+   S  K + ++   +G    
Sbjct: 130 SLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDN 189

Query: 139 II----------------IDAHAIGVNSASWAP---------ATIEEDG--------EHN 165
           +I                ++AH+  V   +WAP         A+  +DG        + +
Sbjct: 190 LIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDAS 249

Query: 166 GTKESRKFV--------------------TGGADNLVKIWKYNSDAQTYVLESTLEGH 203
               S K +                      G DN V +WK + D Q   +    +G 
Sbjct: 250 SNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQ 307
>3BG1:1:A,D,E,H|pdbid|entity|chain(s)|sequence
          Length = 316

 Score =  258 bits (658), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 145/301 (48%), Positives = 193/301 (64%), Gaps = 10/301 (3%)

Query: 4   IANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAH 63
           +  +H ++IHDA +DYYG RLATCSSD+++KIF+V      LI  L GHEGPVW+V WAH
Sbjct: 8   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAH 67

Query: 64  PKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG 123
           P +G ILASCSYD KV+IW+EENG W +               WAPH+YG +L   SSDG
Sbjct: 68  PMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDG 127

Query: 124 KVSVVEFKENGT-TSPIIIDAHAIGVNSASWAPATIEED--GEHNGTKES--RKFVTGGA 178
            +S++ +   G      I +AH IG N+ SWAPA +        +G K +  ++F +GG 
Sbjct: 128 AISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGC 187

Query: 179 DNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV-LLRSYLASVSQDRTCIIWTQD 237
           DNL+K+WK   D Q +  E  LE HSDWVRDVAW+P++ L  S +AS SQD    IWT D
Sbjct: 188 DNLIKLWKEEEDGQ-WKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCD 246

Query: 238 N-EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVH 296
           +     W   LL   KF DV+W  SWS++ N+LA+SGGDNKVTLWKE+++G+W    +V+
Sbjct: 247 DASSNTWSPKLL--HKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN 304

Query: 297 Q 297
           +
Sbjct: 305 K 305

 Score = 35.8 bits (81), Expect = 0.095,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 83/238 (34%), Gaps = 54/238 (22%)

Query: 20  YGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           YG  LA+CS D+ + I+  E  T +      GH+  V  V WA   +G ILA  S DG +
Sbjct: 70  YGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAI 129

Query: 80  -LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSP 138
            L+     G+W                 WAP      L+   S  K + ++   +G    
Sbjct: 130 SLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDN 189

Query: 139 II----------------IDAHAIGVNSASWAP---------ATIEEDG--------EHN 165
           +I                ++AH+  V   +WAP         A+  +DG        + +
Sbjct: 190 LIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDAS 249

Query: 166 GTKESRKFV--------------------TGGADNLVKIWKYNSDAQTYVLESTLEGH 203
               S K +                      G DN V +WK + D Q   +    +G 
Sbjct: 250 SNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQ 307
>3BG0:1:A,D,E,H|pdbid|entity|chain(s)|sequence
          Length = 316

 Score =  258 bits (658), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 145/301 (48%), Positives = 193/301 (64%), Gaps = 10/301 (3%)

Query: 4   IANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAH 63
           +  +H ++IHDA +DYYG RLATCSSD+++KIF+V      LI  L GHEGPVW+V WAH
Sbjct: 8   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAH 67

Query: 64  PKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG 123
           P +G ILASCSYD KV+IW+EENG W +               WAPH+YG +L   SSDG
Sbjct: 68  PMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDG 127

Query: 124 KVSVVEFKENGT-TSPIIIDAHAIGVNSASWAPATIEED--GEHNGTKES--RKFVTGGA 178
            +S++ +   G      I +AH IG N+ SWAPA +        +G K +  ++F +GG 
Sbjct: 128 AISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGC 187

Query: 179 DNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV-LLRSYLASVSQDRTCIIWTQD 237
           DNL+K+WK   D Q +  E  LE HSDWVRDVAW+P++ L  S +AS SQD    IWT D
Sbjct: 188 DNLIKLWKEEEDGQ-WKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCD 246

Query: 238 N-EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVH 296
           +     W   LL   KF DV+W  SWS++ N+LA+SGGDNKVTLWKE+++G+W    +V+
Sbjct: 247 DASSNTWSPKLL--HKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN 304

Query: 297 Q 297
           +
Sbjct: 305 K 305

 Score = 35.8 bits (81), Expect = 0.095,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 83/238 (34%), Gaps = 54/238 (22%)

Query: 20  YGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           YG  LA+CS D+ + I+  E  T +      GH+  V  V WA   +G ILA  S DG +
Sbjct: 70  YGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAI 129

Query: 80  -LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSP 138
            L+     G+W                 WAP      L+   S  K + ++   +G    
Sbjct: 130 SLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDN 189

Query: 139 II----------------IDAHAIGVNSASWAP---------ATIEEDG--------EHN 165
           +I                ++AH+  V   +WAP         A+  +DG        + +
Sbjct: 190 LIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDAS 249

Query: 166 GTKESRKFV--------------------TGGADNLVKIWKYNSDAQTYVLESTLEGH 203
               S K +                      G DN V +WK + D Q   +    +G 
Sbjct: 250 SNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQ 307
>5A9Q:8:7,G,P,Y|pdbid|entity|chain(s)|sequence
          Length = 360

 Score =  124 bits (312), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 97/322 (30%), Positives = 153/322 (47%), Gaps = 43/322 (13%)

Query: 4   IANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWRVDW 61
           IA  H +LIHD   D++G+R+ATCSSD+++K+++    G+ H      T H G VWRV W
Sbjct: 7   IAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKT-HSGSVWRVTW 65

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGR----------WSQIXXXXXXXXXXXXXQWAPHE 111
           AHP+FG +LASCS+D    +W+E  G           W +              ++AP  
Sbjct: 66  AHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKH 125

Query: 112 YGPLLLVASSDGKVSVVEFKENGTTSPIIIDAH---AIGVNSASWAPATIEEDGEHNGTK 168
            G +L   S+DG V + E  +    S   +       +  +  SW P++         ++
Sbjct: 126 MGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSS---------SR 176

Query: 169 ESRKFVTGGADN-------LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSY 221
                +  G+D+        V+I++YN + + Y    TL   +D V D+A++P  L RS+
Sbjct: 177 AHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPN-LGRSF 235

Query: 222 --LASVSQDRTCIIWTQDNEQ-----GPWKKTLLKEEKFPD---VLWRASWSLSGNVLAL 271
             LA  ++D          ++     GP K  +    +F +    +WR SW+++G VLA 
Sbjct: 236 HILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLAS 295

Query: 272 SGGDNKVTLWKENLEGKWEPAG 293
           SG D  V LWK N    W+  G
Sbjct: 296 SGDDGCVRLWKANYMDNWKCTG 317
>3F3P:1:A,B,E,F,I,J|pdbid|entity|chain(s)|sequence
          Length = 351

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 32/231 (13%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETH--KLIDTLTGHEGPVWRVDWAH 63
           + H++L+HD V D+YG+ +ATCSSD+ IK+F+++ +T   +L D+   H+  +  +DWA 
Sbjct: 8   SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWAS 67

Query: 64  PKFGTILASCSYDGKVLIWKEE-------NGRWSQIXXXXXXXXXXXXXQWAPHEYGPLL 116
           P++G I+AS SYD  V +W+E+         RW+++             ++AP   G  L
Sbjct: 68  PEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKL 127

Query: 117 LVASSDGKVSVVEFKENGTTSPIIIDA-----------HAIGVNSASWAPATIEEDGEHN 165
               +DG + + +  E        + +           H       SW P+    +    
Sbjct: 128 ACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPE---- 183

Query: 166 GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV 216
                 K      +  + I++   D + +V  + L GH   +R ++W+P++
Sbjct: 184 ------KLAVSALEQAI-IYQRGKDGKLHV-AAKLPGHKSLIRSISWAPSI 226

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 171 RKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRT 230
           R   T  +D  +K++K + D   + L  +   H   +  + W+     R  +AS S D+T
Sbjct: 24  RHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGR-IIASASYDKT 82

Query: 231 CIIWTQDNEQ 240
             +W +D +Q
Sbjct: 83  VKLWEEDPDQ 92

 Score = 33.1 bits (74), Expect = 0.64,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 52  HEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           H G VW V W     GTIL+S   DGKV +WK
Sbjct: 305 HNGEVWSVSWNLT--GTILSSAGDDGKVRLWK 334
>3F3G:1:A,B,E,F|pdbid|entity|chain(s)|sequence
          Length = 351

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 32/231 (13%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETH--KLIDTLTGHEGPVWRVDWAH 63
           + H++L+HD V D+YG+ +ATCSSD+ IK+F+++ +T   +L D+   H+  +  +DWA 
Sbjct: 8   SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWAS 67

Query: 64  PKFGTILASCSYDGKVLIWKEE-------NGRWSQIXXXXXXXXXXXXXQWAPHEYGPLL 116
           P++G I+AS SYD  V +W+E+         RW+++             ++AP   G  L
Sbjct: 68  PEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKL 127

Query: 117 LVASSDGKVSVVEFKENGTTSPIIIDA-----------HAIGVNSASWAPATIEEDGEHN 165
               +DG + + +  E        + +           H       SW P+    +    
Sbjct: 128 ACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPE---- 183

Query: 166 GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV 216
                 K      +  + I++   D + +V  + L GH   +R ++W+P++
Sbjct: 184 ------KLAVSALEQAI-IYQRGKDGKLHV-AAKLPGHKSLIRSISWAPSI 226

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 171 RKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRT 230
           R   T  +D  +K++K + D   + L  +   H   +  + W+     R  +AS S D+T
Sbjct: 24  RHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGR-IIASASYDKT 82

Query: 231 CIIWTQDNEQ 240
             +W +D +Q
Sbjct: 83  VKLWEEDPDQ 92

 Score = 33.1 bits (74), Expect = 0.64,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 52  HEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           H G VW V W     GTIL+S   DGKV +WK
Sbjct: 305 HNGEVWSVSWNLT--GTILSSAGDDGKVRLWK 334
>3F3F:1:A,B,E,F|pdbid|entity|chain(s)|sequence
          Length = 351

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 32/231 (13%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETH--KLIDTLTGHEGPVWRVDWAH 63
           + H++L+HD V D+YG+ +ATCSSD+ IK+F+++ +T   +L D+   H+  +  +DWA 
Sbjct: 8   SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWAS 67

Query: 64  PKFGTILASCSYDGKVLIWKEE-------NGRWSQIXXXXXXXXXXXXXQWAPHEYGPLL 116
           P++G I+AS SYD  V +W+E+         RW+++             ++AP   G  L
Sbjct: 68  PEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKL 127

Query: 117 LVASSDGKVSVVEFKENGTTSPIIIDA-----------HAIGVNSASWAPATIEEDGEHN 165
               +DG + + +  E        + +           H       SW P+    +    
Sbjct: 128 ACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPE---- 183

Query: 166 GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV 216
                 K      +  + I++   D + +V  + L GH   +R ++W+P++
Sbjct: 184 ------KLAVSALEQAI-IYQRGKDGKLHV-AAKLPGHKSLIRSISWAPSI 226

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 171 RKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRT 230
           R   T  +D  +K++K + D   + L  +   H   +  + W+     R  +AS S D+T
Sbjct: 24  RHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGR-IIASASYDKT 82

Query: 231 CIIWTQDNEQ 240
             +W +D +Q
Sbjct: 83  VKLWEEDPDQ 92

 Score = 33.1 bits (74), Expect = 0.64,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 52  HEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           H G VW V W     GTIL+S   DGKV +WK
Sbjct: 305 HNGEVWSVSWNLT--GTILSSAGDDGKVRLWK 334
>4XMM:3:C|pdbid|entity|chain(s)|sequence
          Length = 349

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 32/231 (13%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETH--KLIDTLTGHEGPVWRVDWAH 63
           + H++L+HD V D+YG+ +ATCSSD+ IK+F+++ +T   +L D+   H+  +  +DWA 
Sbjct: 6   SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWAS 65

Query: 64  PKFGTILASCSYDGKVLIWKEE-------NGRWSQIXXXXXXXXXXXXXQWAPHEYGPLL 116
           P++G I+AS SYD  V +W+E+         RW+++             ++AP   G  L
Sbjct: 66  PEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKL 125

Query: 117 LVASSDGKVSVVEFKENGTTSPIIIDA-----------HAIGVNSASWAPATIEEDGEHN 165
               +DG + + +  E        + +           H       SW P+    +    
Sbjct: 126 ACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPE---- 181

Query: 166 GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV 216
                 K      +  + I++   D + +V  + L GH   +R ++W+P++
Sbjct: 182 ------KLAVSALEQAI-IYQRGKDGKLHV-AAKLPGHKSLIRSISWAPSI 224

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 171 RKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRT 230
           R   T  +D  +K++K + D   + L  +   H   +  + W+     R  +AS S D+T
Sbjct: 22  RHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGR-IIASASYDKT 80

Query: 231 CIIWTQDNEQ 240
             +W +D +Q
Sbjct: 81  VKLWEEDPDQ 90

 Score = 33.1 bits (74), Expect = 0.65,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 52  HEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           H G VW V W     GTIL+S   DGKV +WK
Sbjct: 303 HNGEVWSVSWNLT--GTILSSAGDDGKVRLWK 332
>3EWE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 349

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 32/231 (13%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETH--KLIDTLTGHEGPVWRVDWAH 63
           + H++L+HD V D+YG+ +ATCSSD+ IK+F+++ +T   +L D+   H+  +  +DWA 
Sbjct: 6   SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWAS 65

Query: 64  PKFGTILASCSYDGKVLIWKEE-------NGRWSQIXXXXXXXXXXXXXQWAPHEYGPLL 116
           P++G I+AS SYD  V +W+E+         RW+++             ++AP   G  L
Sbjct: 66  PEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKL 125

Query: 117 LVASSDGKVSVVEFKENGTTSPIIIDA-----------HAIGVNSASWAPATIEEDGEHN 165
               +DG + + +  E        + +           H       SW P+    +    
Sbjct: 126 ACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPE---- 181

Query: 166 GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV 216
                 K      +  + I++   D + +V  + L GH   +R ++W+P++
Sbjct: 182 ------KLAVSALEQAI-IYQRGKDGKLHV-AAKLPGHKSLIRSISWAPSI 224

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 171 RKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRT 230
           R   T  +D  +K++K + D   + L  +   H   +  + W+     R  +AS S D+T
Sbjct: 22  RHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGR-IIASASYDKT 80

Query: 231 CIIWTQDNEQ 240
             +W +D +Q
Sbjct: 81  VKLWEEDPDQ 90

 Score = 33.1 bits (74), Expect = 0.65,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 52  HEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           H G VW V W     GTIL+S   DGKV +WK
Sbjct: 303 HNGEVWSVSWNLT--GTILSSAGDDGKVRLWK 332
>3FM0:1:A|pdbid|entity|chain(s)|sequence
          Length = 345

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 75/277 (27%), Positives = 115/277 (41%), Gaps = 35/277 (12%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLT-GHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           G  LA+C  D+ I+I+  EG++      L+ GH+  V +V W+    G  LAS S+D   
Sbjct: 28  GTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS--PCGNYLASASFDATT 85

Query: 80  LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPI 139
            IWK+    +  +              WAP   G LL   S D  V V E  E      +
Sbjct: 86  CIWKKNQDDFECVTTLEGHENEVKSVAWAPS--GNLLATCSRDKSVWVWEVDEEDEYECV 143

Query: 140 -IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLES 198
            ++++H   V    W P+                  +   D+ VK+++   D   +V  +
Sbjct: 144 SVLNSHTQDVKHVVWHPS-------------QELLASASYDDTVKLYREEED--DWVCCA 188

Query: 199 TLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQ---DNEQG--------PWKKTL 247
           TLEGH   V  +A+ P+      LAS S DRT  IW Q    NEQG         WK   
Sbjct: 189 TLEGHESTVWSLAFDPS---GQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCIC 245

Query: 248 LKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
                    ++  +W      LA + GD+ + +++E+
Sbjct: 246 TLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQED 282

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 55/222 (24%), Positives = 88/222 (39%), Gaps = 23/222 (10%)

Query: 67  GTILASCSYDGKVLIWKEENGRW-SQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
           GT+LASC  D ++ IW  E   W  +               W+P   G  L  AS D   
Sbjct: 28  GTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSP--CGNYLASASFDATT 85

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + +  ++       ++ H   V S +WAP+                  T   D  V +W
Sbjct: 86  CIWKKNQDDFECVTTLEGHENEVKSVAWAPS-------------GNLLATCSRDKSVWVW 132

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
           + + + + Y   S L  H+  V+ V W P+   +  LAS S D T  ++ ++ +      
Sbjct: 133 EVDEEDE-YECVSVLNSHTQDVKHVVWHPS---QELLASASYDDTVKLYREEEDDWVCCA 188

Query: 246 TLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEG 287
           TL   E     +W  ++  SG  LA    D  V +W++ L G
Sbjct: 189 TL---EGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPG 227

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 61/115 (53%), Gaps = 9/115 (7%)

Query: 177 GADNLVKIWKYNSDAQTYVLESTL-EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT 235
           G D  ++IW   ++  +++ +S L EGH   VR VAWSP     +YLAS S D T  IW 
Sbjct: 35  GGDRRIRIW--GTEGDSWICKSVLSEGHQRTVRKVAWSPC---GNYLASASFDATTCIWK 89

Query: 236 QDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWE 290
           ++ +      TL   E   + +   +W+ SGN+LA    D  V +W+ + E ++E
Sbjct: 90  KNQDDFECVTTL---EGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYE 141

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 69/298 (23%), Positives = 112/298 (37%), Gaps = 38/298 (12%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWA 62
           V++  H   +        G  LA+ S D T  I++   +  + + TL GHE  V  V WA
Sbjct: 55  VLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWA 114

Query: 63  HPKFGTILASCSYDGKVLIWK-EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASS 121
               G +LA+CS D  V +W+ +E   +  +              W P +   LL  AS 
Sbjct: 115 PS--GNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQ--ELLASASY 170

Query: 122 DGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNL 181
           D  V +   +E+       ++ H   V S ++ P+              ++  +   D  
Sbjct: 171 DDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPS-------------GQRLASCSDDRT 217

Query: 182 VKIWKY-----------NSDAQTYVLESTLEG-HSDWVRDVAWSPTVLLRSYLASVSQDR 229
           V+IW+            +    ++    TL G HS  + D+AW     L   LA+   D 
Sbjct: 218 VRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQ---LTGALATACGDD 274

Query: 230 TCIIWTQDNEQGPWKKTL-----LKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK 282
              ++ +D    P + T      L +    DV   A       +LA    D +V  WK
Sbjct: 275 AIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWK 332

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V + N+H + +   V     + LA+ S D T+K++  E +      TL GHE  VW +  
Sbjct: 143 VSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSL-- 200

Query: 62  AHPKFGTILASCSYDGKVLIWKE 84
           A    G  LASCS D  V IW++
Sbjct: 201 AFDPSGQRLASCSDDRTVRIWRQ 223
>1VYH:2:C,D,G,H,K,L,O,P,S,T|pdbid|entity|chain(s)|sequence
          Length = 410

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 81/292 (27%), Positives = 129/292 (44%), Gaps = 47/292 (16%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H + + D   D+ GK LA+CS+D TIK+++ +G   + I T+ GH+  V  V    P  
Sbjct: 148 GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG--FECIRTMHGHDHNVSSVS-IMPN- 203

Query: 67  GTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWA----PHEYGPLLLVASSD 122
           G  + S S D  + +W+ + G   +              +W     P++ G L+   S+D
Sbjct: 204 GDHIVSASRDKTIKMWEVQTGYCVK--------TFTGHREWVRMVRPNQDGTLIASCSND 255

Query: 123 G--KVSVVEFKENGTTSPIIIDAHAIGVNSASWAP-ATIEEDGEHNG--TKESRK----F 173
              +V VV  KE        +  H   V   SWAP ++     E  G  TK+S K     
Sbjct: 256 QTVRVWVVATKECKAE----LREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFL 311

Query: 174 VTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCII 233
           ++G  D  +K+W    D  T +   TL GH +WVR V +        ++ S + D+T  +
Sbjct: 312 LSGSRDKTIKMW----DVSTGMCLMTLVGHDNWVRGVLFHSG---GKFILSCADDKTLRV 364

Query: 234 WTQDNEQGPWKKTLLKEEKFP---DVLWRASWSLSGNVLALSGGDNKVTLWK 282
           W   N++    KTL   E F    D    A + ++G+V      D  V +W+
Sbjct: 365 WDYKNKR--CMKTLNAHEHFVTSLDFHKTAPYVVTGSV------DQTVKVWE 408

 Score = 35.4 bits (80), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 174 VTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCII 233
           V+   D  +K+W Y    +T   E TL+GH+D V+D+++  +  L   LAS S D T  +
Sbjct: 124 VSASEDATIKVWDY----ETGDFERTLKGHTDSVQDISFDHSGKL---LASCSADMTIKL 176

Query: 234 W 234
           W
Sbjct: 177 W 177
>5XJC:5:E|pdbid|entity|chain(s)|sequence
          Length = 357

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 69/267 (25%), Positives = 102/267 (38%), Gaps = 38/267 (14%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  LA+   D+ I ++ V G+      TL GH G V  + +     G++L S S D  V 
Sbjct: 78  GSTLASAGFDRLILLWNVYGDCDNYA-TLKGHSGAVMELHYNTD--GSMLFSASTDKTVA 134

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGP-LLLVASSDGKVSVVEFKENGTTSPI 139
           +W  E G                     P   GP L+   S DG V + + ++       
Sbjct: 135 VWDSETGE----RVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTF 190

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
                 + V                N T  S + ++GG DN +K+W    +  TY    T
Sbjct: 191 QNTYQVLAVT--------------FNDT--SDQIISGGIDNDIKVWDLRQNKLTY----T 230

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLK-----EEKFP 254
           + GH+D V  ++ S      SYL S + D T  +W  D      K+  +K        F 
Sbjct: 231 MRGHADSVTGLSLSSE---GSYLLSNAMDNTVRVW--DVRPFAPKERCVKIFQGNVHNFE 285

Query: 255 DVLWRASWSLSGNVLALSGGDNKVTLW 281
             L R SWS  G+ +A    D  V +W
Sbjct: 286 KNLLRCSWSPDGSKIAAGSADRFVYVW 312
>5O9Z:4:D|pdbid|entity|chain(s)|sequence
          Length = 357

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 69/267 (25%), Positives = 102/267 (38%), Gaps = 38/267 (14%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  LA+   D+ I ++ V G+      TL GH G V  + +     G++L S S D  V 
Sbjct: 78  GSTLASAGFDRLILLWNVYGDCDNYA-TLKGHSGAVMELHYNTD--GSMLFSASTDKTVA 134

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGP-LLLVASSDGKVSVVEFKENGTTSPI 139
           +W  E G                     P   GP L+   S DG V + + ++       
Sbjct: 135 VWDSETGE----RVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTF 190

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
                 + V                N T  S + ++GG DN +K+W    +  TY    T
Sbjct: 191 QNTYQVLAVT--------------FNDT--SDQIISGGIDNDIKVWDLRQNKLTY----T 230

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLK-----EEKFP 254
           + GH+D V  ++ S      SYL S + D T  +W  D      K+  +K        F 
Sbjct: 231 MRGHADSVTGLSLSSE---GSYLLSNAMDNTVRVW--DVRPFAPKERCVKIFQGNVHNFE 285

Query: 255 DVLWRASWSLSGNVLALSGGDNKVTLW 281
             L R SWS  G+ +A    D  V +W
Sbjct: 286 KNLLRCSWSPDGSKIAAGSADRFVYVW 312
>5MQF:6:F|pdbid|entity|chain(s)|sequence
          Length = 357

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 69/267 (25%), Positives = 102/267 (38%), Gaps = 38/267 (14%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  LA+   D+ I ++ V G+      TL GH G V  + +     G++L S S D  V 
Sbjct: 78  GSTLASAGFDRLILLWNVYGDCDNYA-TLKGHSGAVMELHYNTD--GSMLFSASTDKTVA 134

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGP-LLLVASSDGKVSVVEFKENGTTSPI 139
           +W  E G                     P   GP L+   S DG V + + ++       
Sbjct: 135 VWDSETGE----RVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTF 190

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
                 + V                N T  S + ++GG DN +K+W    +  TY    T
Sbjct: 191 QNTYQVLAVT--------------FNDT--SDQIISGGIDNDIKVWDLRQNKLTY----T 230

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLK-----EEKFP 254
           + GH+D V  ++ S      SYL S + D T  +W  D      K+  +K        F 
Sbjct: 231 MRGHADSVTGLSLSSE---GSYLLSNAMDNTVRVW--DVRPFAPKERCVKIFQGNVHNFE 285

Query: 255 DVLWRASWSLSGNVLALSGGDNKVTLW 281
             L R SWS  G+ +A    D  V +W
Sbjct: 286 KNLLRCSWSPDGSKIAAGSADRFVYVW 312
>3JCR:2:D|pdbid|entity|chain(s)|sequence
          Length = 357

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 69/267 (25%), Positives = 102/267 (38%), Gaps = 38/267 (14%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  LA+   D+ I ++ V G+      TL GH G V  + +     G++L S S D  V 
Sbjct: 78  GSTLASAGFDRLILLWNVYGDCDNYA-TLKGHSGAVMELHYNTD--GSMLFSASTDKTVA 134

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGP-LLLVASSDGKVSVVEFKENGTTSPI 139
           +W  E G                     P   GP L+   S DG V + + ++       
Sbjct: 135 VWDSETGE----RVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTF 190

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
                 + V                N T  S + ++GG DN +K+W    +  TY    T
Sbjct: 191 QNTYQVLAVT--------------FNDT--SDQIISGGIDNDIKVWDLRQNKLTY----T 230

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLK-----EEKFP 254
           + GH+D V  ++ S      SYL S + D T  +W  D      K+  +K        F 
Sbjct: 231 MRGHADSVTGLSLSSE---GSYLLSNAMDNTVRVW--DVRPFAPKERCVKIFQGNVHNFE 285

Query: 255 DVLWRASWSLSGNVLALSGGDNKVTLW 281
             L R SWS  G+ +A    D  V +W
Sbjct: 286 KNLLRCSWSPDGSKIAAGSADRFVYVW 312
>2YMU:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 577

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 71/261 (27%), Positives = 105/261 (40%), Gaps = 40/261 (15%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G+ +A+ S DKT+K++   G+   L+ TLTGH   V  V  A    G  +AS S D  V 
Sbjct: 356 GQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVRGV--AFSPDGQTIASASDDKTVK 410

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPII 140
           +W   NG+  Q               W          +AS+    +V  +  NG     +
Sbjct: 411 LWNR-NGQLLQTLTGHSSSV------WGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTL 463

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
              H+  V   +++P             + +   +   D  VK+W  N       L  TL
Sbjct: 464 T-GHSSSVRGVAFSP-------------DGQTIASASDDKTVKLWNRNGQ-----LLQTL 504

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GHS  VR VA+SP       +AS S D+T  +W   N  G   +TL         +W  
Sbjct: 505 TGHSSSVRGVAFSPD---GQTIASASDDKTVKLW---NRNGQLLQTLTGHSS---SVWGV 555

Query: 261 SWSLSGNVLALSGGDNKVTLW 281
           ++S  G  +A +  D  V LW
Sbjct: 556 AFSPDGQTIASASSDKTVKLW 576

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 76/278 (27%), Positives = 112/278 (40%), Gaps = 40/278 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
           AH+  +        G+ +A+ S DKT+K++   G+   L+ TLTGH   VW V  A    
Sbjct: 14  AHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVWGV--AFSPD 68

Query: 67  GTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVS 126
           G  +AS S D  V +W   NG+  Q               ++P   G  +  AS D  V 
Sbjct: 69  GQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVA--FSPD--GQTIASASDDKTVK 123

Query: 127 VVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           +  +  NG     +      G +S+ W  A          + + +   +   D  VK+W 
Sbjct: 124 L--WNRNGQLLQTL-----TGHSSSVWGVAF---------SPDGQTIASASDDKTVKLWN 167

Query: 187 YNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKT 246
            N       L  TL GHS  V  VA+SP       +AS S D+T  +W   N  G   +T
Sbjct: 168 RNGQ-----LLQTLTGHSSSVWGVAFSPD---GQTIASASDDKTVKLW---NRNGQLLQT 216

Query: 247 LLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
           L         +   ++S  G  +A +  D  V LW  N
Sbjct: 217 LTGHSS---SVRGVAFSPDGQTIASASDDKTVKLWNRN 251

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 72/264 (27%), Positives = 108/264 (40%), Gaps = 40/264 (15%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G+ +A+ S DKT+K++   G+   L+ TLTGH   VW V  A    G  +AS S D  V 
Sbjct: 274 GQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVWGV--AFSPDGQTIASASDDKTVK 328

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPII 140
           +W   NG+   +              ++P   G  +  AS D  V +  +  NG     +
Sbjct: 329 LWN-RNGQ--HLQTLTGHSSSVWGVAFSPD--GQTIASASDDKTVKL--WNRNGQLLQTL 381

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
              H+  V   +++P             + +   +   D  VK+W  N       L  TL
Sbjct: 382 T-GHSSSVRGVAFSP-------------DGQTIASASDDKTVKLWNRNGQ-----LLQTL 422

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GHS  V  VA+SP       +AS S D+T  +W   N  G   +TL         +   
Sbjct: 423 TGHSSSVWGVAFSPD---DQTIASASDDKTVKLW---NRNGQLLQTLTGHSS---SVRGV 473

Query: 261 SWSLSGNVLALSGGDNKVTLWKEN 284
           ++S  G  +A +  D  V LW  N
Sbjct: 474 AFSPDGQTIASASDDKTVKLWNRN 497

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 73/278 (26%), Positives = 108/278 (38%), Gaps = 40/278 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H+  +        G+ +A+ S DKT+K++   G+   L+ TLTGH   V  V  A    
Sbjct: 219 GHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVNGV--AFRPD 273

Query: 67  GTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVS 126
           G  +AS S D  V +W   NG+  Q               W          +AS+    +
Sbjct: 274 GQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSV------WGVAFSPDGQTIASASDDKT 326

Query: 127 VVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V  +  NG     +      G +S+ W  A          + + +   +   D  VK+W 
Sbjct: 327 VKLWNRNGQHLQTL-----TGHSSSVWGVAF---------SPDGQTIASASDDKTVKLWN 372

Query: 187 YNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKT 246
            N       L  TL GHS  VR VA+SP       +AS S D+T  +W   N  G   +T
Sbjct: 373 RNGQ-----LLQTLTGHSSSVRGVAFSPD---GQTIASASDDKTVKLW---NRNGQLLQT 421

Query: 247 LLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
           L         +W  ++S     +A +  D  V LW  N
Sbjct: 422 LTGHSS---SVWGVAFSPDDQTIASASDDKTVKLWNRN 456

 Score = 38.9 bits (89), Expect = 0.012,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H+  +        G+ +A+ S DKT+K++   G+   L+ TLTGH   VW V  A    
Sbjct: 506 GHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVWGV--AFSPD 560

Query: 67  GTILASCSYDGKVLIW 82
           G  +AS S D  V +W
Sbjct: 561 GQTIASASSDKTVKLW 576

 Score = 37.4 bits (85), Expect = 0.033,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 39/85 (45%), Gaps = 9/85 (10%)

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWR 259
           LE HS  VR VA+SP       +AS S D+T  +W   N  G   +TL         +W 
Sbjct: 12  LEAHSSSVRGVAFSPD---GQTIASASDDKTVKLW---NRNGQLLQTLTGHSS---SVWG 62

Query: 260 ASWSLSGNVLALSGGDNKVTLWKEN 284
            ++S  G  +A +  D  V LW  N
Sbjct: 63  VAFSPDGQTIASASDDKTVKLWNRN 87

 Score = 33.5 bits (75), Expect = 0.41,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H+  +        G+ +A+ S DKT+K++   G+   L+ TLTGH   V  V  A    
Sbjct: 465 GHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVRGV--AFSPD 519

Query: 67  GTILASCSYDGKVLIWKEENGRWSQ 91
           G  +AS S D  V +W   NG+  Q
Sbjct: 520 GQTIASASDDKTVKLWN-RNGQLLQ 543
>5AFU:3:3,4|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 73/265 (27%), Positives = 106/265 (40%), Gaps = 37/265 (13%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           GK LAT + D+ I+I+++E    K++  L GHE  ++ +D+  P  G  L S S D  V 
Sbjct: 116 GKFLATGAEDRLIRIWDIE--NRKIVMILQGHEQDIYSLDY-FPS-GDKLVSGSGDRTVR 171

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPII 140
           IW    G   Q                +P + G  +   S D  V V +  E G     +
Sbjct: 172 IWDLRTG---QCSLTLSIEDGVTTVAVSPGD-GKYIAAGSLDRAVRVWD-SETGFLVERL 226

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
              H   V S  +             T++ +  V+G  D  VK+W    +  TY+     
Sbjct: 227 DTGHKDSVYSVVF-------------TRDGQSVVSGSLDRSVKLWNLTCEV-TYI----- 267

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GH D+V  VA   T     Y+ S S+DR  + W  D + G     L         +  A
Sbjct: 268 -GHKDFVLSVA---TTQNDEYILSGSKDRGVLFW--DKKSGNPLLMLQGHRNSVISVAVA 321

Query: 261 SWSLSG---NVLALSGGDNKVTLWK 282
           + S  G   NV A   GD K  +WK
Sbjct: 322 NGSSLGPEYNVFATGSGDCKARIWK 346

 Score = 31.6 bits (70), Expect = 1.5,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 1   MVVIANAHNELIHDAVLDYY--GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWR 58
           +V+I   H + I+   LDY+  G +L + S D+T++I+++   T +   TL+  +G    
Sbjct: 138 IVMILQGHEQDIYS--LDYFPSGDKLVSGSGDRTVRIWDLR--TGQCSLTLSIEDGVTTV 193

Query: 59  VDWAHPKFGTILASCSYDGKVLIWKEENG 87
                P  G  +A+ S D  V +W  E G
Sbjct: 194 A--VSPGDGKYIAAGSLDRAVRVWDSETG 220

 Score = 30.0 bits (66), Expect = 5.2,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 46/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + +   TG  D L++IW    D +   +   L+GH   +  + + P+      L S S
Sbjct: 113 SPDGKFLATGAEDRLIRIW----DIENRKIVMILQGHEQDIYSLDYFPS---GDKLVSGS 165

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
            DRT  IW  D   G    TL  E+    V   A     G  +A    D  V +W
Sbjct: 166 GDRTVRIW--DLRTGQCSLTLSIEDGVTTV---AVSPGDGKYIAAGSLDRAVRVW 215
>5NNZ:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 415

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V     H++ I D+  DY GK +AT S+D T +IF     T K I  L GHEG + ++ +
Sbjct: 296 VATLTGHDDEILDSCFDYTGKLIATASADGTARIF--SAATRKCIAKLEGHEGEISKISF 353

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGRWSQI 92
            +P+ G  L + S D    IW  + G+  Q+
Sbjct: 354 -NPQ-GNHLLTGSSDKTARIWDAQTGQCLQV 382

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 68/264 (25%), Positives = 107/264 (40%), Gaps = 39/264 (14%)

Query: 20  YGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           YG ++AT S DKT K++ V  ET K   T  GH   +  + + +P+  T++A+ S D   
Sbjct: 146 YGDKIATGSFDKTCKLWSV--ETGKCYHTFRGHTAEIVCLSF-NPQ-STLVATGSMDTTA 201

Query: 80  LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPI 139
            +W  +NG                    + +  G  ++  S D  V VV   + G    I
Sbjct: 202 KLWDIQNGE----EVYTLRGHSAEIISLSFNTSGDRIITGSFDHTV-VVWDADTGRKVNI 256

Query: 140 IIDAHAIGVNSAS--WAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLE 197
           +I  H   ++SAS  W  + I               +TG  D   K+W    DA      
Sbjct: 257 LI-GHCAEISSASFNWDCSLI---------------LTGSMDKTCKLW----DATNGKCV 296

Query: 198 STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVL 257
           +TL GH D + D  +  T  L   +A+ S D T  I++        +K + K E     +
Sbjct: 297 ATLTGHDDEILDSCFDYTGKL---IATASADGTARIFSAAT-----RKCIAKLEGHEGEI 348

Query: 258 WRASWSLSGNVLALSGGDNKVTLW 281
            + S++  GN L     D    +W
Sbjct: 349 SKISFNPQGNHLLTGSSDKTARIW 372

 Score = 32.3 bits (72), Expect = 0.98,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 168 KESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQ 227
           K    F+TG  D   K+W   S  +     +TLEGH + V  +A++        +A+ S 
Sbjct: 102 KSGSCFITGSYDRTCKLWDTASGEEL----NTLEGHRNVVYAIAFNNP--YGDKIATGSF 155

Query: 228 DRTCIIWT 235
           D+TC +W+
Sbjct: 156 DKTCKLWS 163
>4WJS:1:A|pdbid|entity|chain(s)|sequence
          Length = 485

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 76/316 (24%), Positives = 107/316 (33%), Gaps = 75/316 (23%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           RLAT S D T +I++ +  T K   TL GH G V  V W+    G  LA+CS D  V +W
Sbjct: 129 RLATGSGDNTARIWDTDSGTPKF--TLKGHTGWVLGVSWSPD--GKYLATCSMDTTVRVW 184

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEY---GPLLLVASSDGKVSVVEFKENGTTSPI 139
             E+G+                  W P+     G   L ++S      +     G T   
Sbjct: 185 DPESGKQVN-QEFRGHAKWVLALAWQPYHLWRDGTARLASASKDCTVRIWLVNTGRTEH- 242

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V+   W    +                TG  D  V++W    DA    L   
Sbjct: 243 VLSGHKGSVSCVKWGGTDL--------------IYTGSHDRSVRVW----DAVKGTLVHN 284

Query: 200 LEGHSDWVRDVAWSPTVLLRS------------------------------------YLA 223
              H  WV  +A S   +LR+                                     L 
Sbjct: 285 FTAHGHWVNHIALSSDHVLRTAYHDHTKEVPGTEEERRAKAKERFEKAAKIKGKVAERLV 344

Query: 224 SVSQDRTCIIWT-QDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK 282
           S S D T  +W   +N   P  + L  + K   V     +S  G ++A +G DN   LW 
Sbjct: 345 SASDDFTMYLWDPTNNGSKPVARLLGHQNKVNHV----QFSPDGTLIASAGWDNSTKLWN 400

Query: 283 -------ENLEGKWEP 291
                  +NL G   P
Sbjct: 401 ARDGKFIKNLRGHVAP 416

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 170 SRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDR 229
           S +  TG  DN  +IW  +S    +    TL+GH+ WV  V+WSP      YLA+ S D 
Sbjct: 127 SSRLATGSGDNTARIWDTDSGTPKF----TLKGHTGWVLGVSWSPD---GKYLATCSMDT 179

Query: 230 TCIIWTQDNEQG 241
           T  +W  D E G
Sbjct: 180 TVRVW--DPESG 189

 Score = 33.9 bits (76), Expect = 0.35,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + T S D T+K++ V   T KL   L GHE  V+ VDWA    G ++AS   D  V  W+
Sbjct: 429 VVTGSKDCTLKVWNVR--TGKLAMDLPGHEDEVYAVDWAAD--GELVASGGKDKAVRTWR 484

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
            +RL + S D T+ +++      K +  L GH+  V  V ++    GT++AS  +D    
Sbjct: 340 AERLVSASDDFTMYLWDPTNNGSKPVARLLGHQNKVNHVQFSPD--GTLIASAGWDNSTK 397

Query: 81  IWKEENGRW 89
           +W   +G++
Sbjct: 398 LWNARDGKF 406

 Score = 30.4 bits (67), Expect = 3.6,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF---GTI-LASCSYD 76
           GK LATCS D T+++++ E    ++     GH   V  + W        GT  LAS S D
Sbjct: 169 GKYLATCSMDTTVRVWDPE-SGKQVNQEFRGHAKWVLALAWQPYHLWRDGTARLASASKD 227

Query: 77  GKVLIWKEENGRWSQI 92
             V IW    GR   +
Sbjct: 228 CTVRIWLVNTGRTEHV 243

 Score = 30.0 bits (66), Expect = 5.2,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 65/167 (38%), Gaps = 25/167 (14%)

Query: 116 LLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVT 175
           L+ AS D  + + +   NG+     +  H   VN   ++P         +GT       +
Sbjct: 343 LVSASDDFTMYLWDPTNNGSKPVARLLGHQNKVNHVQFSP---------DGTL----IAS 389

Query: 176 GGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT 235
            G DN  K+W    +A+       L GH   V   AWS    L   + + S+D T  +W 
Sbjct: 390 AGWDNSTKLW----NARDGKFIKNLRGHVAPVYQCAWSADSRL---VVTGSKDCTLKVW- 441

Query: 236 QDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK 282
            +   G     L   E   D ++   W+  G ++A  G D  V  W+
Sbjct: 442 -NVRTGKLAMDLPGHE---DEVYAVDWAADGELVASGGKDKAVRTWR 484
>1ERJ:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 393

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 74/273 (27%), Positives = 109/273 (39%), Gaps = 32/273 (11%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           GK LAT + D+ I+I+++E    K++  L GHE  ++ +D+  P  G  L S S D  V 
Sbjct: 135 GKFLATGAEDRLIRIWDIE--NRKIVMILQGHEQDIYSLDY-FPS-GDKLVSGSGDRTVR 190

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPII 140
           IW    G   Q                +P + G  +   S D  V V +  E G     +
Sbjct: 191 IWDLRTG---QCSLTLSIEDGVTTVAVSPGD-GKYIAAGSLDRAVRVWD-SETGFLVERL 245

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYN-----SDAQTY- 194
              +  G        + +        T++ +  V+G  D  VK+W        SD++T  
Sbjct: 246 DSENESGTGHKDSVYSVV-------FTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPN 298

Query: 195 --VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEK 252
               E T  GH D+V  VA   T     Y+ S S+DR  + W  D + G     L     
Sbjct: 299 SGTCEVTYIGHKDFVLSVA---TTQNDEYILSGSKDRGVLFW--DKKSGNPLLMLQGHRN 353

Query: 253 FPDVLWRASWSLSG---NVLALSGGDNKVTLWK 282
               +  A+ S  G   NV A   GD K  +WK
Sbjct: 354 SVISVAVANGSSLGPEYNVFATGSGDCKARIWK 386

 Score = 29.6 bits (65), Expect = 6.6,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 46/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + +   TG  D L++IW    D +   +   L+GH   +  + + P+      L S S
Sbjct: 132 SPDGKFLATGAEDRLIRIW----DIENRKIVMILQGHEQDIYSLDYFPS---GDKLVSGS 184

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
            DRT  IW  D   G    TL  E+    V   A     G  +A    D  V +W
Sbjct: 185 GDRTVRIW--DLRTGQCSLTLSIEDGVTTV---AVSPGDGKYIAAGSLDRAVRVW 234
>3SHF:1:A|pdbid|entity|chain(s)|sequence
          Length = 1256

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 6/87 (6%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE-GETHKLIDTLTGHEGPVWRVDW 61
           ++   H + ++ A     G+R+A+C +DKT+++F+ E GE  KL+D +  HE  V  +  
Sbjct: 616 LVVRPHTDAVYHACFSQDGQRIASCGADKTLQVFKAETGE--KLLD-IKAHEDEV--LCC 670

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGR 88
           A     + +A+CS D KV IW    G+
Sbjct: 671 AFSSDDSYIATCSADKKVKIWDSATGK 697
>3SFZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 1249

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 6/87 (6%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE-GETHKLIDTLTGHEGPVWRVDW 61
           ++   H + ++ A     G+R+A+C +DKT+++F+ E GE  KL+D +  HE  V  +  
Sbjct: 609 LVVRPHTDAVYHACFSQDGQRIASCGADKTLQVFKAETGE--KLLD-IKAHEDEV--LCC 663

Query: 62  AHPKFGTILASCSYDGKVLIWKEENGR 88
           A     + +A+CS D KV IW    G+
Sbjct: 664 AFSSDDSYIATCSADKKVKIWDSATGK 690
>2HES:1:X|pdbid|entity|chain(s)|sequence
          Length = 330

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWR 58
           ++ I   H   +        G  LATCS DK++ I+E +  GE ++ I  L  H   V  
Sbjct: 99  LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158

Query: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRW 89
           V W HP    +LAS SYD  V IWK+ +  W
Sbjct: 159 VIW-HPS-EALLASSSYDDTVRIWKDYDDDW 187

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 69/288 (23%), Positives = 117/288 (40%), Gaps = 37/288 (12%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTL--TGHEGPVWRVDWAHPKFGTILASCS 74
            D+    LAT S+D+ IK+  V+ +   LID L  T H+  +  V W      ++LA+ S
Sbjct: 20  FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWR--PHTSLLAAGS 77

Query: 75  YDGKVLIWKEENG-----RWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVE 129
           +D  V IW +E           +              W+   Y   L   S D  V + E
Sbjct: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY--YLATCSRDKSVWIWE 135

Query: 130 FKENGTTSPII--IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK- 186
             E+G     I  +  H+  V    W P+                  +   D+ V+IWK 
Sbjct: 136 TDESGEEYECISVLQEHSQDVKHVIWHPS-------------EALLASSSYDDTVRIWKD 182

Query: 187 YNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKT 246
           Y+ D +   + +  EG + W  D   +  V     L S S D T  +W    +    ++ 
Sbjct: 183 YDDDWECVAVLNGHEG-TVWSSDFDKTEGVF---RLCSGSDDSTVRVWKYMGDDEDDQQE 238

Query: 247 LLKEEKFPDV----LWRASWSLSGNVLALSGGDNKVTLWKENLEGKWE 290
            + E   PDV    ++  +W  +G ++A  G D  + +++E ++G+W+
Sbjct: 239 WVCEAILPDVHKRQVYNVAWGFNG-LIASVGADGVLAVYEE-VDGEWK 284

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 96/247 (38%), Gaps = 34/247 (13%)

Query: 45  LIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW--KEENGRWSQIXXXXXXXXXX 102
           LI +L  ++  +W  D++      ILA+ S D K+ +   K ++     +          
Sbjct: 6   LIKSLKLYKEKIWSFDFSQ----GILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAI 61

Query: 103 XXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTS-----PIIIDAHAIGVNSASWAPAT 157
               W PH    LL   S D  VS+   +E+   +       II+ H   V   +W+   
Sbjct: 62  RSVAWRPHT--SLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS--- 116

Query: 158 IEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVL 217
              DG +          T   D  V IW+ +   + Y   S L+ HS  V+ V W P+  
Sbjct: 117 --NDGYY--------LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEA 166

Query: 218 LRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGG--D 275
           L   LAS S D T  IW   ++       L   E     +W + +  +  V  L  G  D
Sbjct: 167 L---LASSSYDDTVRIWKDYDDDWECVAVLNGHE---GTVWSSDFDKTEGVFRLCSGSDD 220

Query: 276 NKVTLWK 282
           + V +WK
Sbjct: 221 STVRVWK 227
>5MZH:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 452

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 66/294 (22%), Positives = 115/294 (39%), Gaps = 55/294 (18%)

Query: 20  YGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           YG ++ T S DKT K+++    T +L  TL GH+  +  + + +P+  TI+A+ S D   
Sbjct: 148 YGDKIVTGSFDKTCKLWD--AYTGQLYYTLKGHQTEIVCLSF-NPQ-STIIATGSMDNTA 203

Query: 80  LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSD----------------- 122
            +W  E G+                     +  G L++  S D                 
Sbjct: 204 KLWDVETGQ----ERATLAGHRAEIVSLGFNTGGDLIVTGSFDHDSRLWDVRTGQCVHVL 259

Query: 123 ----GKVSVVEFKENGTTSPIIIDAHAIGVNSASW----------APATIEEDGEHNGTK 168
               G+VS  +F   GT    ++ + +I   S  W               +E  +     
Sbjct: 260 SGHRGEVSSTQFNYAGT----LVVSGSIDCTSRLWDVRSGRCLSVKQGHTDEVLDVAFDA 315

Query: 169 ESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQD 228
              K V+  AD   +++       T V + TL GH   +  VA++P     + L + S D
Sbjct: 316 AGTKMVSASADGSARLYH----TLTGVCQHTLVGHEGEISKVAFNPQ---GTRLITASSD 368

Query: 229 RTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK 282
           +TC +W  D + G   + L   E   D ++  +++  G+ +     DN   +WK
Sbjct: 369 KTCRLW--DCDTGECLQVL---EGHTDEIFSCAFNYEGDFIITGSKDNTCRIWK 417

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 168 KESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQ 227
           K   +F+TG  D   K+W   +  + +    TLEGH + V  +A++        + + S 
Sbjct: 104 KSGDRFITGSYDRTCKVWNTFTGEEVF----TLEGHKNVVYAIAFNNP--YGDKIVTGSF 157

Query: 228 DRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           D+TC +W  D   G    TL   +     L   S++    ++A    DN   LW
Sbjct: 158 DKTCKLW--DAYTGQLYYTLKGHQTEIVCL---SFNPQSTIIATGSMDNTAKLW 206
>2OVR:2:B|pdbid|entity|chain(s)|sequence
          Length = 445

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 100/265 (37%), Gaps = 45/265 (16%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L + G R+ + S D T+K++     T K + TL GH G V    W+      I+ S S D
Sbjct: 125 LQFCGNRIVSGSDDNTLKVWS--AVTGKCLRTLVGHTGGV----WSSQMRDNIIISGSTD 178

Query: 77  GKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTT 136
             + +W  E G                      H +   ++  S D  + V +  E G  
Sbjct: 179 RTLKVWNAETGECIHTLYGHTSTVR------CMHLHEKRVVSGSRDATLRVWDI-ETGQC 231

Query: 137 SPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVL 196
             +++  H   V    +               + R+ V+G  D +VK+W    D +T   
Sbjct: 232 LHVLM-GHVAAVRCVQY---------------DGRRVVSGAYDFMVKVW----DPETETC 271

Query: 197 ESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDV 256
             TL+GH++ V  + +        ++ S S D +  +W  D E G    TL   +     
Sbjct: 272 LHTLQGHTNRVYSLQFDGI-----HVVSGSLDTSIRVW--DVETGNCIHTLTGHQSLT-- 322

Query: 257 LWRASWSLSGNVLALSGGDNKVTLW 281
              +   L  N+L     D+ V +W
Sbjct: 323 ---SGMELKDNILVSGNADSTVKIW 344
>2OVQ:2:B|pdbid|entity|chain(s)|sequence
          Length = 445

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 100/265 (37%), Gaps = 45/265 (16%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L + G R+ + S D T+K++     T K + TL GH G V    W+      I+ S S D
Sbjct: 125 LQFCGNRIVSGSDDNTLKVWS--AVTGKCLRTLVGHTGGV----WSSQMRDNIIISGSTD 178

Query: 77  GKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTT 136
             + +W  E G                      H +   ++  S D  + V +  E G  
Sbjct: 179 RTLKVWNAETGECIHTLYGHTSTVR------CMHLHEKRVVSGSRDATLRVWDI-ETGQC 231

Query: 137 SPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVL 196
             +++  H   V    +               + R+ V+G  D +VK+W    D +T   
Sbjct: 232 LHVLM-GHVAAVRCVQY---------------DGRRVVSGAYDFMVKVW----DPETETC 271

Query: 197 ESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDV 256
             TL+GH++ V  + +        ++ S S D +  +W  D E G    TL   +     
Sbjct: 272 LHTLQGHTNRVYSLQFDGI-----HVVSGSLDTSIRVW--DVETGNCIHTLTGHQSLT-- 322

Query: 257 LWRASWSLSGNVLALSGGDNKVTLW 281
              +   L  N+L     D+ V +W
Sbjct: 323 ---SGMELKDNILVSGNADSTVKIW 344
>2OVP:2:B|pdbid|entity|chain(s)|sequence
          Length = 445

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 100/265 (37%), Gaps = 45/265 (16%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L + G R+ + S D T+K++     T K + TL GH G V    W+      I+ S S D
Sbjct: 125 LQFCGNRIVSGSDDNTLKVWS--AVTGKCLRTLVGHTGGV----WSSQMRDNIIISGSTD 178

Query: 77  GKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTT 136
             + +W  E G                      H +   ++  S D  + V +  E G  
Sbjct: 179 RTLKVWNAETGECIHTLYGHTSTVR------CMHLHEKRVVSGSRDATLRVWDI-ETGQC 231

Query: 137 SPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVL 196
             +++  H   V    +               + R+ V+G  D +VK+W    D +T   
Sbjct: 232 LHVLM-GHVAAVRCVQY---------------DGRRVVSGAYDFMVKVW----DPETETC 271

Query: 197 ESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDV 256
             TL+GH++ V  + +        ++ S S D +  +W  D E G    TL   +     
Sbjct: 272 LHTLQGHTNRVYSLQFDGI-----HVVSGSLDTSIRVW--DVETGNCIHTLTGHQSLT-- 322

Query: 257 LWRASWSLSGNVLALSGGDNKVTLW 281
              +   L  N+L     D+ V +W
Sbjct: 323 ---SGMELKDNILVSGNADSTVKIW 344
>5V4B:2:B|pdbid|entity|chain(s)|sequence
          Length = 444

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 100/265 (37%), Gaps = 45/265 (16%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L + G R+ + S D T+K++     T K + TL GH G V    W+      I+ S S D
Sbjct: 125 LQFCGNRIVSGSDDNTLKVWS--AVTGKCLRTLVGHTGGV----WSSQMRDNIIISGSTD 178

Query: 77  GKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTT 136
             + +W  E G                      H +   ++  S D  + V +  E G  
Sbjct: 179 RTLKVWNAETGECIHTLYGHTSTVR------CMHLHEKRVVSGSRDATLRVWDI-ETGQC 231

Query: 137 SPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVL 196
             +++  H   V    +               + R+ V+G  D +VK+W    D +T   
Sbjct: 232 LHVLM-GHVAAVRCVQY---------------DGRRVVSGAYDFMVKVW----DPETETC 271

Query: 197 ESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDV 256
             TL+GH++ V  + +        ++ S S D +  +W  D E G    TL   +     
Sbjct: 272 LHTLQGHTNRVYSLQFDGI-----HVVSGSLDTSIRVW--DVETGNCIHTLTGHQSLT-- 322

Query: 257 LWRASWSLSGNVLALSGGDNKVTLW 281
              +   L  N+L     D+ V +W
Sbjct: 323 ---SGMELKDNILVSGNADSTVKIW 344
>3UVO:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>3UVN:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>3UVM:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>3UVL:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>3UVK:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>3PSL:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>2G99:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 308

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 118 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 173

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 174 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 209

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 210 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 265

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 266 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 307

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 34  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 86

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 87  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 141

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 142 PAHSDPVSAVH 152

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 9   YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 63

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 64  ISDV----AWSSDSNLLVSASDDKTLKIW 88

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 17  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 73

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 74  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 127

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 128 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 172

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 173 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 224

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 225 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 265
>3EMH:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 38.1 bits (87), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.42,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>5A9Q:3:2,K,T,b|pdbid|entity|chain(s)|sequence
          Length = 326

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 144 HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGH 203
           H + V+  +W+P T       +      KF T  AD  +KI  + SD Q       LEGH
Sbjct: 71  HGVRVDGIAWSPET-----RLDSLPPVIKFCTSAAD--MKIRLFTSDLQDKNEYKVLEGH 123

Query: 204 SDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
           +D++  + + P       +ASVS D TC IW  +  Q
Sbjct: 124 TDFINGLVFDPKE--GQEIASVSDDHTCRIWNLEGVQ 158
>5EAR:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>5EAP:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>5EAM:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>5EAL:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4QQE:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4QL1:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4O45:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4IA9:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4A7J:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 128 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 183

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 184 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 219

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 220 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 275

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 276 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 317

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 44  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 96

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 97  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 151

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 152 PAHSDPVSAVH 162

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 19  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 73

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 74  ISDV----AWSSDSNLLVSASDDKTLKIW 98

 Score = 31.2 bits (69), Expect = 2.5,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 27  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 83

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 84  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 137

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 138 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 182

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 183 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 234

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 235 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 275
>3UR4:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>3SMR:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>3P4F:1:A|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 127 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 182

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 183 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 218

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 219 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 274

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 275 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 316

 Score = 38.1 bits (87), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 43  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 95

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 96  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 150

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 151 PAHSDPVSAVH 161

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 18  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 72

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 73  ISDV----AWSSDSNLLVSASDDKTLKIW 97

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 26  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 82

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 83  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 136

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 137 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 181

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 182 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 233

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 234 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 274
>2H14:1:A|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 127 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 182

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 183 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 218

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 219 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 274

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 275 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 316

 Score = 38.1 bits (87), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 43  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 95

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 96  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 150

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 151 PAHSDPVSAVH 161

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 18  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 72

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 73  ISDV----AWSSDSNLLVSASDDKTLKIW 97

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 26  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 82

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 83  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 136

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 137 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 181

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 182 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 233

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 234 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 274
>2H13:1:A|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 127 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 182

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 183 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 218

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 219 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 274

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 275 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 316

 Score = 38.1 bits (87), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 43  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 95

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 96  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 150

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 151 PAHSDPVSAVH 161

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 18  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 72

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 73  ISDV----AWSSDSNLLVSASDDKTLKIW 97

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 26  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 82

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 83  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 136

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 137 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 181

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 182 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 233

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 234 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 274
>4CY2:1:A|pdbid|entity|chain(s)|sequence
          Length = 316

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 126 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 181

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 182 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 217

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 218 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 273

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 274 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 315

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 42  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 94

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 95  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 149

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 150 PAHSDPVSAVH 160

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 17  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 71

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 72  ISDV----AWSSDSNLLVSASDDKTLKIW 96

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 25  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 81

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 82  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 135

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 136 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 180

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 181 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 232

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 233 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 273
>4CY1:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 316

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 124 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 179

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 180 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 215

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 216 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 271

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 272 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 313

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 40  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 92

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 93  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 147

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 148 PAHSDPVSAVH 158

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 15  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 69

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 70  ISDV----AWSSDSNLLVSASDDKTLKIW 94

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 23  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 79

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 80  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 133

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 134 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 178

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 179 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 230

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 231 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 271
>2G9A:1:A|pdbid|entity|chain(s)|sequence
          Length = 311

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 121 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 176

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 177 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 212

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 213 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 268

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 269 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 310

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 37  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 89

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 90  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 144

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 145 PAHSDPVSAVH 155

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 12  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 66

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 67  ISDV----AWSSDSNLLVSASDDKTLKIW 91

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 20  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 76

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 77  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 130

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 131 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 175

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 176 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 227

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 228 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 268
>4Y7R:1:A|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.44,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>4GMB:1:A|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.44,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>4GM9:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.44,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>4GM8:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.44,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>4GM3:1:A,B,C,D,E,F,G,H|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.44,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>2XL3:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 334

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 144 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 199

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 200 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 235

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 236 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 291

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 292 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 333

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 60  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 112

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 113 IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 167

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 168 PAHSDPVSAVH 178

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 35  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 89

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 90  ISDV----AWSSDSNLLVSASDDKTLKIW 114

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 43  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 99

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 100 --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 153

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 154 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 198

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 199 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 250

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 251 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 291
>2XL2:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 334

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 144 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 199

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 200 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 235

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 236 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 291

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 292 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 333

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 60  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 112

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 113 IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 167

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 168 PAHSDPVSAVH 178

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 35  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 89

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 90  ISDV----AWSSDSNLLVSASDDKTLKIW 114

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 43  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 99

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 100 --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 153

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 154 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 198

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 199 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 250

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 251 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 291
>5VFC:1:A|pdbid|entity|chain(s)|sequence
          Length = 311

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 121 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 176

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 177 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 212

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 213 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 268

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 269 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 310

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 37  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 89

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 90  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 144

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 145 PAHSDPVSAVH 155

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 12  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 66

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 67  ISDV----AWSSDSNLLVSASDDKTLKIW 91

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 20  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 76

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 77  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 130

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 131 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 175

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 176 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 227

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 228 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 268
>5SXM:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 125 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 180

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 181 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 216

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 217 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 272

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 273 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 314

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 41  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 93

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 94  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 148

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 149 PAHSDPVSAVH 159

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 30.8 bits (68), Expect = 2.7,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 134

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 135 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 179

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 180 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 231

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 232 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 272
>4EWR:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4ESG:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4ES0:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4ERZ:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4ERY:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>4ERQ:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>3EG6:1:A|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>2H6Q:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>2H6N:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>2H6K:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>2H68:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 122 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 177

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 178 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 213

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 214 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 269

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 270 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 311

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 38  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 90

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 91  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 145

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 146 PAHSDPVSAVH 156

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 13  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 67

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 68  ISDV----AWSSDSNLLVSASDDKTLKIW 92

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 21  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 77

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 78  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 131

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 132 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 176

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 177 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 228

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 229 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 269
>2O9K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>2H9N:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>2H9M:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 123 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 178

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 179 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 214

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 215 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 270

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 271 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 312

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 39  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 91

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 92  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 146

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 147 PAHSDPVSAVH 157

 Score = 33.5 bits (75), Expect = 0.45,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 14  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 68

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 69  ISDV----AWSSDSNLLVSASDDKTLKIW 93

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 22  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 78

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 79  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 132

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 133 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 177

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 178 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 229

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 230 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 270
>5FVM:2:C,D|pdbid|entity|chain(s)|sequence
          Length = 303

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 53/217 (24%), Positives = 88/217 (40%), Gaps = 35/217 (16%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D TIK+++V   +   +     H  PV  V   HP  G ++ SC  DG + IW 
Sbjct: 90  MVSSSEDGTIKVWDVRSPS---VQRNYKHNAPVNEVA-IHPNQGELI-SCDQDGNIRIWD 144

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLL-LVASSDGKVSVVEFKENGTTSPIIID 142
               + +               Q  P +  PL  L  +SDG + +V     G      + 
Sbjct: 145 LGENQCTN--------------QLTPEDNTPLQSLSVASDGSM-LVAGNNKGNCYVWRMP 189

Query: 143 AHAIGVNSASWAPATIEEDGEHNGTK-----ESRKFVTGGADNLVKIWKYNSDAQTYVLE 197
            H    ++++  P T  +      T+     + +   T  AD+  ++W    +   Y LE
Sbjct: 190 HHT---DASTLEPVTKFKSHTKYITRVLLSADVKNLATCSADHTARVWNIEDN---YQLE 243

Query: 198 STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
           +TL+GH  WV D A+S      +YL +   D    +W
Sbjct: 244 TTLDGHQRWVWDCAFSAD---SAYLVTACSDHYVRLW 277

 Score = 37.0 bits (84), Expect = 0.041,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
           +H + I   +L    K LATCS+D T +++ +E + ++L  TL GH+  VW  D A    
Sbjct: 205 SHTKYITRVLLSADVKNLATCSADHTARVWNIE-DNYQLETTLDGHQRWVW--DCAFSAD 261

Query: 67  GTILASCSYDGKVLIW 82
              L +   D  V +W
Sbjct: 262 SAYLVTACSDHYVRLW 277
>2GNQ:1:A|pdbid|entity|chain(s)|sequence
          Length = 336

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 146 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 201

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 202 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 237

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 238 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 293

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 294 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLWKSD 335

 Score = 37.7 bits (86), Expect = 0.025,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 62  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 114

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 115 IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 169

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 170 PAHSDPVSAVH 180

 Score = 33.5 bits (75), Expect = 0.47,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 37  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 91

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 92  ISDV----AWSSDSNLLVSASDDKTLKIW 116

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 45  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 101

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 102 --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 155

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 156 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 200

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 201 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 252

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 253 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 293
>5WVE:1:A,C,E,G,I,K,M|pdbid|entity|chain(s)|sequence
          Length = 1248

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE-GETHKLIDTLTGHEGPVWRVDW 61
           ++   H + ++ A     G+R+A+C +DKT+++F+ E GE  KL++ +  HE  V  +  
Sbjct: 609 LVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGE--KLLE-IKAHEDEV--LCC 663

Query: 62  AHPKFGTILASCSYDGKVLIWKEENG 87
           A       +A+CS D KV IW    G
Sbjct: 664 AFSTDDRFIATCSVDKKVKIWNSMTG 689

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 93/225 (41%), Gaps = 45/225 (20%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG---TILASCSYDGKVL 80
           LAT SSD  +K++++  +  +  +T+ GH   V      H +F     +LASCS DG + 
Sbjct: 716 LATGSSDCFLKLWDLNQKECR--NTMFGHTNSV-----NHCRFSPDDKLLASCSADGTLK 768

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQ-----------WAPHEYGPLLLVASSDGKVSVVE 129
           +W   +    +              Q           W+    G  ++VA+ + K+ + +
Sbjct: 769 LWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSAD--GARIMVAAKN-KIFLFD 825

Query: 130 FKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNS 189
              +G    I    H+  +    ++P             ++   V   +   V++W  N+
Sbjct: 826 IHTSGLLGEIHTGHHST-IQYCDFSP-------------QNHLAVVALSQYCVELW--NT 869

Query: 190 DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
           D+++ V +    GH  WV  V +SP     S+L S S D+T  +W
Sbjct: 870 DSRSKVADC--RGHLSWVHGVMFSPDG--SSFLTS-SDDQTIRLW 909
>5JUY:1:A,B,C,D,E,F,G|pdbid|entity|chain(s)|sequence
          Length = 1248

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE-GETHKLIDTLTGHEGPVWRVDW 61
           ++   H + ++ A     G+R+A+C +DKT+++F+ E GE  KL++ +  HE  V  +  
Sbjct: 609 LVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGE--KLLE-IKAHEDEV--LCC 663

Query: 62  AHPKFGTILASCSYDGKVLIWKEENG 87
           A       +A+CS D KV IW    G
Sbjct: 664 AFSTDDRFIATCSVDKKVKIWNSMTG 689

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 93/225 (41%), Gaps = 45/225 (20%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG---TILASCSYDGKVL 80
           LAT SSD  +K++++  +  +  +T+ GH   V      H +F     +LASCS DG + 
Sbjct: 716 LATGSSDCFLKLWDLNQKECR--NTMFGHTNSV-----NHCRFSPDDKLLASCSADGTLK 768

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQ-----------WAPHEYGPLLLVASSDGKVSVVE 129
           +W   +    +              Q           W+    G  ++VA+ + K+ + +
Sbjct: 769 LWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSAD--GARIMVAAKN-KIFLFD 825

Query: 130 FKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNS 189
              +G    I    H+  +    ++P             ++   V   +   V++W  N+
Sbjct: 826 IHTSGLLGEIHTGHHST-IQYCDFSP-------------QNHLAVVALSQYCVELW--NT 869

Query: 190 DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
           D+++ V +    GH  WV  V +SP     S+L S S D+T  +W
Sbjct: 870 DSRSKVADC--RGHLSWVHGVMFSPDG--SSFLTS-SDDQTIRLW 909
>3JBT:1:A,C,E,G,I,K,M|pdbid|entity|chain(s)|sequence
          Length = 1260

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE-GETHKLIDTLTGHEGPVWRVDW 61
           ++   H + ++ A     G+R+A+C +DKT+++F+ E GE  KL++ +  HE  V  +  
Sbjct: 609 LVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGE--KLLE-IKAHEDEV--LCC 663

Query: 62  AHPKFGTILASCSYDGKVLIWKEENG 87
           A       +A+CS D KV IW    G
Sbjct: 664 AFSTDDRFIATCSVDKKVKIWNSMTG 689

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 93/225 (41%), Gaps = 45/225 (20%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG---TILASCSYDGKVL 80
           LAT SSD  +K++++  +  +  +T+ GH   V      H +F     +LASCS DG + 
Sbjct: 716 LATGSSDCFLKLWDLNQKECR--NTMFGHTNSV-----NHCRFSPDDKLLASCSADGTLK 768

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQ-----------WAPHEYGPLLLVASSDGKVSVVE 129
           +W   +    +              Q           W+    G  ++VA+ + K+ + +
Sbjct: 769 LWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSAD--GARIMVAAKN-KIFLFD 825

Query: 130 FKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNS 189
              +G    I    H+  +    ++P             ++   V   +   V++W  N+
Sbjct: 826 IHTSGLLGEIHTGHHST-IQYCDFSP-------------QNHLAVVALSQYCVELW--NT 869

Query: 190 DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
           D+++ V +    GH  WV  V +SP     S+L S S D+T  +W
Sbjct: 870 DSRSKVADC--RGHLSWVHGVMFSPDG--SSFLTS-SDDQTIRLW 909
>3J2T:1:A,B,C,D,E,F,G|pdbid|entity|chain(s)|sequence
          Length = 1263

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 3   VIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE-GETHKLIDTLTGHEGPVWRVDW 61
           ++   H + ++ A     G+R+A+C +DKT+++F+ E GE  KL++ +  HE  V  +  
Sbjct: 615 LVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGE--KLLE-IKAHEDEV--LCC 669

Query: 62  AHPKFGTILASCSYDGKVLIWKEENG 87
           A       +A+CS D KV IW    G
Sbjct: 670 AFSTDDRFIATCSVDKKVKIWNSMTG 695

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 93/225 (41%), Gaps = 45/225 (20%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG---TILASCSYDGKVL 80
           LAT SSD  +K++++  +  +  +T+ GH   V      H +F     +LASCS DG + 
Sbjct: 722 LATGSSDCFLKLWDLNQKECR--NTMFGHTNSV-----NHCRFSPDDKLLASCSADGTLK 774

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQ-----------WAPHEYGPLLLVASSDGKVSVVE 129
           +W   +    +              Q           W+    G  ++VA+ + K+ + +
Sbjct: 775 LWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSAD--GARIMVAAKN-KIFLFD 831

Query: 130 FKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNS 189
              +G    I    H+  +    ++P             ++   V   +   V++W  N+
Sbjct: 832 IHTSGLLGEIHTGHHST-IQYCDFSP-------------QNHLAVVALSQYCVELW--NT 875

Query: 190 DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
           D+++ V +    GH  WV  V +SP     S+L S S D+T  +W
Sbjct: 876 DSRSKVADC--RGHLSWVHGVMFSPDG--SSFLTS-SDDQTIRLW 915
>5JCS:30:q|pdbid|entity|chain(s)|sequence
          Length = 515

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 19/106 (17%)

Query: 135 TTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           T S   I  H   +  +++AP T            S + VTG  DN  +IW    D  T 
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHT------------SSRMVTGAGDNTARIW----DCDTQ 176

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
               TL+GH +WV  V+WSP       +A+ S D T  +W   + Q
Sbjct: 177 TPMHTLKGHYNWVLCVSWSPD---GEVIATGSMDNTIRLWDPKSGQ 219

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 135 TTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQT 193
           T +P+  +  H   V   SW+P     DGE           TG  DN +++W   S    
Sbjct: 175 TQTPMHTLKGHYNWVLCVSWSP-----DGE--------VIATGSMDNTIRLWDPKSGQ-- 219

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLL----RSYLASVSQDRTCIIW 234
             L   L GHS W+  ++W P  L+    +  LAS S+D T  IW
Sbjct: 220 -CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+   DN +K+W    D +     ST  GH   V  VAWS    L   L S S
Sbjct: 411 SPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQVAWSSDCRL---LVSCS 463

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +D T  +W         +K  +      D ++   WS+ G  +   G D  V LW
Sbjct: 464 KDTTLKVWDVRT-----RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H +L++       G+ + + S D +IK+++  G   K I T  GH   V++V W+    
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD--GRDGKFISTFRGHVASVYQVAWSSD-- 455

Query: 67  GTILASCSYDGKVLIW 82
             +L SCS D  + +W
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.061,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 18/135 (13%)

Query: 107 WAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNG 166
           W+P   G ++   S D  + + + K +G      +  H+  + S SW P  + + G    
Sbjct: 194 WSPD--GEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 250

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
              S K      D  +KIW    D  + V + T+ GH++ V  V W    LL S     S
Sbjct: 251 LASSSK------DGTIKIW----DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSG----S 296

Query: 227 QDRTCIIWTQDNEQG 241
            DRT  +W   N QG
Sbjct: 297 HDRTVRVW-DINSQG 310

 Score = 33.9 bits (76), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           L +CS D T+K+++V   T KL   L GH+  V+ VDW+    G  + S   D  V +W
Sbjct: 459 LVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEVYTVDWSVD--GKRVCSGGKDKMVRLW 513
>5FL8:41:q|pdbid|entity|chain(s)|sequence
          Length = 515

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 19/106 (17%)

Query: 135 TTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           T S   I  H   +  +++AP T            S + VTG  DN  +IW    D  T 
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHT------------SSRMVTGAGDNTARIW----DCDTQ 176

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
               TL+GH +WV  V+WSP       +A+ S D T  +W   + Q
Sbjct: 177 TPMHTLKGHYNWVLCVSWSPD---GEVIATGSMDNTIRLWDPKSGQ 219

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 135 TTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQT 193
           T +P+  +  H   V   SW+P     DGE           TG  DN +++W   S    
Sbjct: 175 TQTPMHTLKGHYNWVLCVSWSP-----DGE--------VIATGSMDNTIRLWDPKSGQ-- 219

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLL----RSYLASVSQDRTCIIW 234
             L   L GHS W+  ++W P  L+    +  LAS S+D T  IW
Sbjct: 220 -CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+   DN +K+W    D +     ST  GH   V  VAWS    L   L S S
Sbjct: 411 SPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQVAWSSDCRL---LVSCS 463

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +D T  +W         +K  +      D ++   WS+ G  +   G D  V LW
Sbjct: 464 KDTTLKVWDVRT-----RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H +L++       G+ + + S D +IK+++  G   K I T  GH   V++V W+    
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD--GRDGKFISTFRGHVASVYQVAWSSD-- 455

Query: 67  GTILASCSYDGKVLIW 82
             +L SCS D  + +W
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.061,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 18/135 (13%)

Query: 107 WAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNG 166
           W+P   G ++   S D  + + + K +G      +  H+  + S SW P  + + G    
Sbjct: 194 WSPD--GEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 250

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
              S K      D  +KIW    D  + V + T+ GH++ V  V W    LL S     S
Sbjct: 251 LASSSK------DGTIKIW----DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSG----S 296

Query: 227 QDRTCIIWTQDNEQG 241
            DRT  +W   N QG
Sbjct: 297 HDRTVRVW-DINSQG 310

 Score = 33.9 bits (76), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           L +CS D T+K+++V   T KL   L GH+  V+ VDW+    G  + S   D  V +W
Sbjct: 459 LVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEVYTVDWSVD--GKRVCSGGKDKMVRLW 513
>4WJU:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 515

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 19/106 (17%)

Query: 135 TTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           T S   I  H   +  +++AP T            S + VTG  DN  +IW    D  T 
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHT------------SSRMVTGAGDNTARIW----DCDTQ 176

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
               TL+GH +WV  V+WSP       +A+ S D T  +W   + Q
Sbjct: 177 TPMHTLKGHYNWVLCVSWSPD---GEVIATGSMDNTIRLWDPKSGQ 219

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 135 TTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQT 193
           T +P+  +  H   V   SW+P     DGE           TG  DN +++W   S    
Sbjct: 175 TQTPMHTLKGHYNWVLCVSWSP-----DGE--------VIATGSMDNTIRLWDPKSGQ-- 219

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLL----RSYLASVSQDRTCIIW 234
             L   L GHS W+  ++W P  L+    +  LAS S+D T  IW
Sbjct: 220 -CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+   DN +K+W    D +     ST  GH   V  VAWS    L   L S S
Sbjct: 411 SPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQVAWSSDCRL---LVSCS 463

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +D T  +W         +K  +      D ++   WS+ G  +   G D  V LW
Sbjct: 464 KDTTLKVWDVRT-----RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H +L++       G+ + + S D +IK+++  G   K I T  GH   V++V W+    
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD--GRDGKFISTFRGHVASVYQVAWSSD-- 455

Query: 67  GTILASCSYDGKVLIW 82
             +L SCS D  + +W
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.061,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 18/135 (13%)

Query: 107 WAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNG 166
           W+P   G ++   S D  + + + K +G      +  H+  + S SW P  + + G    
Sbjct: 194 WSPD--GEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 250

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
              S K      D  +KIW    D  + V + T+ GH++ V  V W    LL S     S
Sbjct: 251 LASSSK------DGTIKIW----DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSG----S 296

Query: 227 QDRTCIIWTQDNEQG 241
            DRT  +W   N QG
Sbjct: 297 HDRTVRVW-DINSQG 310

 Score = 33.9 bits (76), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           L +CS D T+K+++V   T KL   L GH+  V+ VDW+    G  + S   D  V +W
Sbjct: 459 LVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEVYTVDWSVD--GKRVCSGGKDKMVRLW 513
>4V7F:46:q|pdbid|entity|chain(s)|sequence
          Length = 515

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 19/106 (17%)

Query: 135 TTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           T S   I  H   +  +++AP T            S + VTG  DN  +IW    D  T 
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHT------------SSRMVTGAGDNTARIW----DCDTQ 176

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
               TL+GH +WV  V+WSP       +A+ S D T  +W   + Q
Sbjct: 177 TPMHTLKGHYNWVLCVSWSPD---GEVIATGSMDNTIRLWDPKSGQ 219

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 135 TTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQT 193
           T +P+  +  H   V   SW+P     DGE           TG  DN +++W   S    
Sbjct: 175 TQTPMHTLKGHYNWVLCVSWSP-----DGE--------VIATGSMDNTIRLWDPKSGQ-- 219

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLL----RSYLASVSQDRTCIIW 234
             L   L GHS W+  ++W P  L+    +  LAS S+D T  IW
Sbjct: 220 -CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+   DN +K+W    D +     ST  GH   V  VAWS    L   L S S
Sbjct: 411 SPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQVAWSSDCRL---LVSCS 463

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +D T  +W         +K  +      D ++   WS+ G  +   G D  V LW
Sbjct: 464 KDTTLKVWDVRT-----RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H +L++       G+ + + S D +IK+++  G   K I T  GH   V++V W+    
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD--GRDGKFISTFRGHVASVYQVAWSSD-- 455

Query: 67  GTILASCSYDGKVLIW 82
             +L SCS D  + +W
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.061,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 18/135 (13%)

Query: 107 WAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNG 166
           W+P   G ++   S D  + + + K +G      +  H+  + S SW P  + + G    
Sbjct: 194 WSPD--GEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 250

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
              S K      D  +KIW    D  + V + T+ GH++ V  V W    LL S     S
Sbjct: 251 LASSSK------DGTIKIW----DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSG----S 296

Query: 227 QDRTCIIWTQDNEQG 241
            DRT  +W   N QG
Sbjct: 297 HDRTVRVW-DINSQG 310

 Score = 33.9 bits (76), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           L +CS D T+K+++V   T KL   L GH+  V+ VDW+    G  + S   D  V +W
Sbjct: 459 LVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEVYTVDWSVD--GKRVCSGGKDKMVRLW 513
>3JCT:50:x|pdbid|entity|chain(s)|sequence
          Length = 515

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 19/106 (17%)

Query: 135 TTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           T S   I  H   +  +++AP T            S + VTG  DN  +IW    D  T 
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHT------------SSRMVTGAGDNTARIW----DCDTQ 176

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ 240
               TL+GH +WV  V+WSP       +A+ S D T  +W   + Q
Sbjct: 177 TPMHTLKGHYNWVLCVSWSPD---GEVIATGSMDNTIRLWDPKSGQ 219

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 135 TTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQT 193
           T +P+  +  H   V   SW+P     DGE           TG  DN +++W   S    
Sbjct: 175 TQTPMHTLKGHYNWVLCVSWSP-----DGE--------VIATGSMDNTIRLWDPKSGQ-- 219

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLL----RSYLASVSQDRTCIIW 234
             L   L GHS W+  ++W P  L+    +  LAS S+D T  IW
Sbjct: 220 -CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+   DN +K+W    D +     ST  GH   V  VAWS    L   L S S
Sbjct: 411 SPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQVAWSSDCRL---LVSCS 463

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +D T  +W         +K  +      D ++   WS+ G  +   G D  V LW
Sbjct: 464 KDTTLKVWDVRT-----RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H +L++       G+ + + S D +IK+++  G   K I T  GH   V++V W+    
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD--GRDGKFISTFRGHVASVYQVAWSSD-- 455

Query: 67  GTILASCSYDGKVLIW 82
             +L SCS D  + +W
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.061,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 18/135 (13%)

Query: 107 WAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNG 166
           W+P   G ++   S D  + + + K +G      +  H+  + S SW P  + + G    
Sbjct: 194 WSPD--GEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 250

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
              S K      D  +KIW    D  + V + T+ GH++ V  V W    LL S     S
Sbjct: 251 LASSSK------DGTIKIW----DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSG----S 296

Query: 227 QDRTCIIWTQDNEQG 241
            DRT  +W   N QG
Sbjct: 297 HDRTVRVW-DINSQG 310

 Score = 33.9 bits (76), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           L +CS D T+K+++V   T KL   L GH+  V+ VDW+    G  + S   D  V +W
Sbjct: 459 LVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEVYTVDWSVD--GKRVCSGGKDKMVRLW 513
>3DM0:1:A|pdbid|entity|chain(s)|sequence
          Length = 694

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 169 ESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQD 228
           ++R+ V+   D  +K+W    + + Y +    EGH DWV  V +SP   L+  + S S D
Sbjct: 483 DNRQIVSASRDRTIKLWNTLGECK-YTISEGGEGHRDWVSCVRFSPNT-LQPTIVSASWD 540

Query: 229 RTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +T  +W   N +   + TL     +   +   + S  G++ A  G D  V LW
Sbjct: 541 KTVKVWNLSNCK--LRSTLAGHTGYVSTV---AVSPDGSLCASGGKDGVVLLW 588
>5XJC:23:W|pdbid|entity|chain(s)|sequence
          Length = 579

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 63/263 (23%), Positives = 102/263 (38%), Gaps = 30/263 (11%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  L +CS D  IK++EV GE  + + T  GH   V   D      GT   S +YD  + 
Sbjct: 301 GHLLLSCSMDCKIKLWEVYGE-RRCLRTFIGHSKAV--RDICFNTAGTQFLSAAYDRYLK 357

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS-SDGKVSVVEFKENGTTSPI 139
           +W  E G   Q              ++ P E    L VA  SD K+   + +        
Sbjct: 358 LWDTETG---QCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQE- 413

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQ-TYVLES 198
             D H   VN+  +               E+R+FV+   D  +++W+++      Y+ E 
Sbjct: 414 -YDRHLGAVNTIVF-------------VDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEP 459

Query: 199 TLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLW 258
           ++  HS  +  V  SP      +LA  S D   +I+   N     KK + K         
Sbjct: 460 SM--HS--MPAVTLSPN---GKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYAC 512

Query: 259 RASWSLSGNVLALSGGDNKVTLW 281
           +  +S   + +    G+ K+ +W
Sbjct: 513 QVDFSPDMSYVISGDGNGKLNIW 535
>5MQF:5:E|pdbid|entity|chain(s)|sequence
          Length = 579

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 63/263 (23%), Positives = 102/263 (38%), Gaps = 30/263 (11%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  L +CS D  IK++EV GE  + + T  GH   V   D      GT   S +YD  + 
Sbjct: 301 GHLLLSCSMDCKIKLWEVYGE-RRCLRTFIGHSKAV--RDICFNTAGTQFLSAAYDRYLK 357

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVAS-SDGKVSVVEFKENGTTSPI 139
           +W  E G   Q              ++ P E    L VA  SD K+   + +        
Sbjct: 358 LWDTETG---QCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQE- 413

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQ-TYVLES 198
             D H   VN+  +               E+R+FV+   D  +++W+++      Y+ E 
Sbjct: 414 -YDRHLGAVNTIVF-------------VDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEP 459

Query: 199 TLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLW 258
           ++  HS  +  V  SP      +LA  S D   +I+   N     KK + K         
Sbjct: 460 SM--HS--MPAVTLSPN---GKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYAC 512

Query: 259 RASWSLSGNVLALSGGDNKVTLW 281
           +  +S   + +    G+ K+ +W
Sbjct: 513 QVDFSPDMSYVISGDGNGKLNIW 535
>5WYK:18:BC|pdbid|entity|chain(s)|sequence
          Length = 817

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H   + D     Y K LAT S DKT+KI+ +  +T  ++ TL GH   V R  + + +  
Sbjct: 532 HKRGLWDVSFCQYDKLLATSSGDKTVKIWSL--DTFSVMKTLEGHTNAVQRCSFINKQ-- 587

Query: 68  TILASCSYDGKVLIWKEENG 87
             L SC  DG + IW   +G
Sbjct: 588 KQLISCGADGLIKIWDCSSG 607

 Score = 38.9 bits (89), Expect = 0.012,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFP 254
           V E T   H   +  ++ SP     S  A+ S D+TC IW  +N  G  + TL   ++  
Sbjct: 482 VSEYTRHAHEKDINALSVSPN---DSIFATASYDKTCKIWNLEN--GELEATLANHKRG- 535

Query: 255 DVLWRASWSLSGNVLALSGGDNKVTLW 281
             LW  S+     +LA S GD  V +W
Sbjct: 536 --LWDVSFCQYDKLLATSSGDKTVKIW 560

 Score = 32.7 bits (73), Expect = 0.79,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
            AT S DKT KI+ +  E  +L  TL  H+  +W V +   ++  +LA+ S D  V IW
Sbjct: 506 FATASYDKTCKIWNL--ENGELEATLANHKRGLWDVSFC--QYDKLLATSSGDKTVKIW 560

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 12/113 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             T   D  VKIW  +    T+ +  TLEGH++ V+  ++   +  +  L S   D    
Sbjct: 548 LATSSGDKTVKIWSLD----TFSVMKTLEGHTNAVQRCSF---INKQKQLISCGADGLIK 600

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENL 285
           IW  D   G   KTL   +   + LW  S    G+++  +  D     WK+  
Sbjct: 601 IW--DCSSGECLKTL---DGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCT 648

 Score = 30.4 bits (67), Expect = 3.8,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 50/140 (35%), Gaps = 27/140 (19%)

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPH--EYGPLLLVASSDGKV 125
           +I A+ SYD    IW  ENG                   W     +Y  LL  +S D  V
Sbjct: 504 SIFATASYDKTCKIWNLENGELEATLANHKRGL------WDVSFCQYDKLLATSSGDKTV 557

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            +             ++ H   V   S+               + ++ ++ GAD L+KIW
Sbjct: 558 KIWSLDTFSVMK--TLEGHTNAVQRCSF-------------INKQKQLISCGADGLIKIW 602

Query: 186 KYNSDAQTYVLESTLEGHSD 205
               D  +     TL+GH++
Sbjct: 603 ----DCSSGECLKTLDGHNN 618
>5WYJ:18:BC|pdbid|entity|chain(s)|sequence
          Length = 817

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H   + D     Y K LAT S DKT+KI+ +  +T  ++ TL GH   V R  + + +  
Sbjct: 532 HKRGLWDVSFCQYDKLLATSSGDKTVKIWSL--DTFSVMKTLEGHTNAVQRCSFINKQ-- 587

Query: 68  TILASCSYDGKVLIWKEENG 87
             L SC  DG + IW   +G
Sbjct: 588 KQLISCGADGLIKIWDCSSG 607

 Score = 38.9 bits (89), Expect = 0.012,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFP 254
           V E T   H   +  ++ SP     S  A+ S D+TC IW  +N  G  + TL   ++  
Sbjct: 482 VSEYTRHAHEKDINALSVSPN---DSIFATASYDKTCKIWNLEN--GELEATLANHKRG- 535

Query: 255 DVLWRASWSLSGNVLALSGGDNKVTLW 281
             LW  S+     +LA S GD  V +W
Sbjct: 536 --LWDVSFCQYDKLLATSSGDKTVKIW 560

 Score = 32.7 bits (73), Expect = 0.79,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
            AT S DKT KI+ +  E  +L  TL  H+  +W V +   ++  +LA+ S D  V IW
Sbjct: 506 FATASYDKTCKIWNL--ENGELEATLANHKRGLWDVSFC--QYDKLLATSSGDKTVKIW 560

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 12/113 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             T   D  VKIW  +    T+ +  TLEGH++ V+  ++   +  +  L S   D    
Sbjct: 548 LATSSGDKTVKIWSLD----TFSVMKTLEGHTNAVQRCSF---INKQKQLISCGADGLIK 600

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENL 285
           IW  D   G   KTL   +   + LW  S    G+++  +  D     WK+  
Sbjct: 601 IW--DCSSGECLKTL---DGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCT 648

 Score = 30.4 bits (67), Expect = 3.8,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 50/140 (35%), Gaps = 27/140 (19%)

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPH--EYGPLLLVASSDGKV 125
           +I A+ SYD    IW  ENG                   W     +Y  LL  +S D  V
Sbjct: 504 SIFATASYDKTCKIWNLENGELEATLANHKRGL------WDVSFCQYDKLLATSSGDKTV 557

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            +             ++ H   V   S+               + ++ ++ GAD L+KIW
Sbjct: 558 KIWSLDTFSVMK--TLEGHTNAVQRCSF-------------INKQKQLISCGADGLIKIW 602

Query: 186 KYNSDAQTYVLESTLEGHSD 205
               D  +     TL+GH++
Sbjct: 603 ----DCSSGECLKTLDGHNN 618
>5WSG:4:O|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5MQ0:9:J|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5MPS:9:J|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5LQW:9:K|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5LJ5:13:J|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5LJ3:12:J|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5GMK:10:O|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5GM6:14:O|pdbid|entity|chain(s)|sequence
          Length = 451

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F+TG  D  +K+W    D  T  L++TL GH   VRDVA S       YL SVS+D+T  
Sbjct: 155 FITGSNDTTMKVW----DLATGKLKTTLAGHVMTVRDVAVSDR---HPYLFSVSEDKTVK 207

Query: 233 IWTQDNEQ 240
            W  +  Q
Sbjct: 208 CWDLEKNQ 215
>5T2A:57:7|pdbid|entity|chain(s)|sequence
          Length = 312

 Score = 42.0 bits (97), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 9/115 (7%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+ G DN+V++W    D     L    +GH DWV  + +SP+ L    + S S
Sbjct: 116 SPDDRLIVSAGRDNVVRVWNVAGDCMHEFLR---DGHKDWVSSICFSPS-LEHPIVVSGS 171

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
            D T  +W  +   G  ++TL     +   +   + S  G++ A  G D    LW
Sbjct: 172 WDNTIKVWNVNG--GKCERTLKGHSNYVSTV---TVSPDGSLCASGGKDGVALLW 221
>4WJV:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 381

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 170 SRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDR 229
           S + VTG  DN  +IW    D  T     TL+GH +WV  V+WSP       +A+ S D 
Sbjct: 22  SSRMVTGAGDNTARIW----DCDTQTPMHTLKGHYNWVLCVSWSPD---GEVIATGSMDN 74

Query: 230 TCIIWTQDNEQ 240
           T  +W   + Q
Sbjct: 75  TIRLWDPKSGQ 85

 Score = 39.7 bits (91), Expect = 0.006,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + + R  V+   DN +K+W    D +     ST  GH   V  VAWS    L   L S S
Sbjct: 277 SPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQVAWSSDCRL---LVSCS 329

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
           +D T  +W         +K  +      D ++   WS+ G  +   G D  V LW
Sbjct: 330 KDTTLKVWDVRT-----RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 379

 Score = 39.7 bits (91), Expect = 0.006,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 135 TTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQT 193
           T +P+  +  H   V   SW+P     DGE           TG  DN +++W   S    
Sbjct: 41  TQTPMHTLKGHYNWVLCVSWSP-----DGE--------VIATGSMDNTIRLWDPKSGQ-- 85

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLL----RSYLASVSQDRTCIIW 234
             L   L GHS W+  ++W P  L+    +  LAS S+D T  IW
Sbjct: 86  -CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 129

 Score = 37.0 bits (84), Expect = 0.045,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
            H +L++       G+ + + S D +IK+++  G   K I T  GH   V++V W+    
Sbjct: 266 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD--GRDGKFISTFRGHVASVYQVAWSSD-- 321

Query: 67  GTILASCSYDGKVLIW 82
             +L SCS D  + +W
Sbjct: 322 CRLLVSCSKDTTLKVW 337

 Score = 35.0 bits (79), Expect = 0.15,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 18/135 (13%)

Query: 107 WAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNG 166
           W+P   G ++   S D  + + + K +G      +  H+  + S SW P  + + G    
Sbjct: 60  WSPD--GEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 116

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
              S K      D  +KIW    D  + V + T+ GH++ V  V W    LL S     S
Sbjct: 117 LASSSK------DGTIKIW----DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSG----S 162

Query: 227 QDRTCIIWTQDNEQG 241
            DRT  +W   N QG
Sbjct: 163 HDRTVRVW-DINSQG 176

 Score = 33.1 bits (74), Expect = 0.62,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           L +CS D T+K+++V   T KL   L GH+  V+ VDW+    G  + S   D  V +W
Sbjct: 325 LVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEVYTVDWSVD--GKRVCSGGKDKMVRLW 379
>3N0E:1:A|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 53/223 (23%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 125 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 180

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 181 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 216

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 217 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 272

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  ++  D
Sbjct: 273 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLYKSD 314

 Score = 38.5 bits (88), Expect = 0.014,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 41  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 93

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 94  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 148

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 149 PAHSDPVSAVH 159

 Score = 33.9 bits (76), Expect = 0.31,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 134

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 135 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 179

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 180 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 231

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 232 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 272
>5K1B:1:B|pdbid|entity|chain(s)|sequence
          Length = 677

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 44  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 99

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 100 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 147

 Score = 32.7 bits (73), Expect = 0.87,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 74  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 129

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 130 --ELVASAGLDRQIFLW 144
>5K1A:2:B,D,F,H|pdbid|entity|chain(s)|sequence
          Length = 677

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 44  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 99

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 100 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 147

 Score = 32.7 bits (73), Expect = 0.87,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 74  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 129

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 130 --ELVASAGLDRQIFLW 144
>5CVN:1:A|pdbid|entity|chain(s)|sequence
          Length = 598

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 59  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 114

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 115 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 162

 Score = 32.3 bits (72), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 89  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 144

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 145 --ELVASAGLDRQIFLW 159
>5CVL:1:A|pdbid|entity|chain(s)|sequence
          Length = 598

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 59  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 114

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 115 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 162

 Score = 32.3 bits (72), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 89  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 144

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 145 --ELVASAGLDRQIFLW 159
>5K1C:2:B|pdbid|entity|chain(s)|sequence
          Length = 563

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 44  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 99

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 100 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 147

 Score = 32.3 bits (72), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 74  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 129

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 130 --ELVASAGLDRQIFLW 144
>5CVO:1:A,D|pdbid|entity|chain(s)|sequence
          Length = 677

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 44  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 99

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 100 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 147

 Score = 32.3 bits (72), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 74  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 129

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 130 --ELVASAGLDRQIFLW 144
>5L8W:2:B|pdbid|entity|chain(s)|sequence
          Length = 580

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 44  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 99

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 100 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 147

 Score = 32.3 bits (72), Expect = 0.96,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 74  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 129

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 130 --ELVASAGLDRQIFLW 144
>5L8E:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 580

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 172 KFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTC 231
           +  T G D++++IW  N   Q   + S +E H+DWV D+           L S S D T 
Sbjct: 44  RLFTAGRDSIIRIWSVNQHKQDPYIAS-MEHHTDWVNDIVLCCN---GKTLISASSDTTV 99

Query: 232 IIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            +W  +  +G    TL   + +   L   +++    ++A +G D ++ LW  N
Sbjct: 100 KVW--NAHKGFCMSTLRTHKDYVKAL---AYAKDKELVASAGLDRQIFLWDVN 147

 Score = 32.3 bits (72), Expect = 0.96,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHK--LIDTLTGHEGPVWRVDWAHPK 65
           H + ++D VL   GK L + SSD T+K++      HK   + TL  H+  V  + +A  K
Sbjct: 74  HTDWVNDIVLCCNGKTLISASSDTTVKVW----NAHKGFCMSTLRTHKDYVKALAYAKDK 129

Query: 66  FGTILASCSYDGKVLIW 82
              ++AS   D ++ +W
Sbjct: 130 --ELVASAGLDRQIFLW 144
>3N0D:1:A|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 40.8 bits (94), Expect = 0.003,   Method: Composition-based stats.
 Identities = 53/223 (23%), Positives = 90/223 (40%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V+  T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 125 IVSGSFDESVRIWDVK--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 180

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 181 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 216

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DNLV IW    + QT 
Sbjct: 217 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTK 272

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  ++  D
Sbjct: 273 EIVQKLQGHTDVVISTACHPTENIIAS-AALENDKTIKLFKSD 314

 Score = 38.5 bits (88), Expect = 0.014,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 41  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 93

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 94  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 148

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 149 PAHSDPVSAVH 159

 Score = 33.9 bits (76), Expect = 0.31,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 32.0 bits (71), Expect = 1.3,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 134

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 135 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 179

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 180 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 231

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 232 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 272
>4CY5:1:A|pdbid|entity|chain(s)|sequence
          Length = 316

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 89/223 (39%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V   T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 126 IVSGSFDESVRIWDVR--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 181

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 182 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 217

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DN+V IW    + Q+ 
Sbjct: 218 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIW----NLQSK 273

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 274 EVVQKLQGHTDTVLCTACHPTENIIAS-AALENDKTIKLWKSD 315

 Score = 34.3 bits (77), Expect = 0.25,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 42  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSRL---LVSGSDDKTLK 94

Query: 233 IW 234
           +W
Sbjct: 95  VW 96

 Score = 32.7 bits (73), Expect = 0.74,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 22/107 (20%)

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
           I  H +G++  +W             + +SR  V+G  D  +K+W+ ++         TL
Sbjct: 65  ISGHKLGISDVAW-------------SSDSRLLVSGSDDKTLKVWELSTGKSL----KTL 107

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTL 247
           +GHS++V    ++P   L   + S S D +  IW  D   G   KTL
Sbjct: 108 KGHSNYVFCCNFNPQSNL---IVSGSFDESVRIW--DVRTGKCLKTL 149

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 12/91 (13%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 17  YTLKFTLAGHTKAVSAVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 71

Query: 253 FPDVLWRASWSLSGNVLALSGGDNK-VTLWK 282
             DV W      S + L +SG D+K + +W+
Sbjct: 72  ISDVAWS-----SDSRLLVSGSDDKTLKVWE 97

 Score = 29.6 bits (65), Expect = 6.3,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 115/272 (42%), Gaps = 41/272 (15%)

Query: 21  GKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+      +L S S D  +
Sbjct: 39  GEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS--RLLVSGSDDKTL 93

Query: 80  LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPI 139
            +W+   G+   +              + P     L++  S D  V + + +        
Sbjct: 94  KVWELSTGK--SLKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESVRIWDVRTGKCLK-- 147

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
            + AH+  V++  +              ++    V+   D L +IW     A    L++ 
Sbjct: 148 TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW---DTASGQCLKTL 191

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLL--KEEKFPDVL 257
           ++  +  V  V +SP      Y+ + + D T  +W  D  +G   KT    K EK+    
Sbjct: 192 IDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLKTYTGHKNEKY---C 243

Query: 258 WRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
             A++S++G    +SG  DN V +W  NL+ K
Sbjct: 244 IFANFSVTGGKWIVSGSEDNMVYIW--NLQSK 273
>4CY3:1:A|pdbid|entity|chain(s)|sequence
          Length = 316

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 89/223 (39%), Gaps = 42/223 (18%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + + S D++++I++V   T K + TL  H  PV  V +   + G+++ S SYDG   IW 
Sbjct: 126 IVSGSFDESVRIWDVR--TGKCLKTLPAHSDPVSAVHFN--RDGSLIVSSSYDGLCRIWD 181

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDA 143
             +G+  +                         L+   +  VS V+F  NG         
Sbjct: 182 TASGQCLKT------------------------LIDDDNPPVSFVKFSPNGKYILAATLD 217

Query: 144 HAIGVNSASWAPATIEEDGEHN---------GTKESRKFVTGGADNLVKIWKYNSDAQTY 194
           + + +   S         G  N              +  V+G  DN+V IW    + Q+ 
Sbjct: 218 NTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIW----NLQSK 273

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
            +   L+GH+D V   A  PT  + +  A++  D+T  +W  D
Sbjct: 274 EVVQKLQGHTDTVLCTACHPTENIIAS-AALENDKTIKLWKSD 315

 Score = 34.3 bits (77), Expect = 0.25,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 42  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSRL---LVSGSDDKTLK 94

Query: 233 IW 234
           +W
Sbjct: 95  VW 96

 Score = 32.7 bits (73), Expect = 0.74,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 22/107 (20%)

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
           I  H +G++  +W             + +SR  V+G  D  +K+W+ ++         TL
Sbjct: 65  ISGHKLGISDVAW-------------SSDSRLLVSGSDDKTLKVWELSTGKSL----KTL 107

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTL 247
           +GHS++V    ++P   L   + S S D +  IW  D   G   KTL
Sbjct: 108 KGHSNYVFCCNFNPQSNL---IVSGSFDESVRIW--DVRTGKCLKTL 149

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 12/91 (13%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 17  YTLKFTLAGHTKAVSAVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 71

Query: 253 FPDVLWRASWSLSGNVLALSGGDNK-VTLWK 282
             DV W      S + L +SG D+K + +W+
Sbjct: 72  ISDVAWS-----SDSRLLVSGSDDKTLKVWE 97

 Score = 29.6 bits (65), Expect = 6.3,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 115/272 (42%), Gaps = 41/272 (15%)

Query: 21  GKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKV 79
           G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+      +L S S D  +
Sbjct: 39  GEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS--RLLVSGSDDKTL 93

Query: 80  LIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPI 139
            +W+   G+   +              + P     L++  S D  V + + +        
Sbjct: 94  KVWELSTGK--SLKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESVRIWDVRTGKCLK-- 147

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
            + AH+  V++  +              ++    V+   D L +IW     A    L++ 
Sbjct: 148 TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW---DTASGQCLKTL 191

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLL--KEEKFPDVL 257
           ++  +  V  V +SP      Y+ + + D T  +W  D  +G   KT    K EK+    
Sbjct: 192 IDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLKTYTGHKNEKY---C 243

Query: 258 WRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
             A++S++G    +SG  DN V +W  NL+ K
Sbjct: 244 IFANFSVTGGKWIVSGSEDNMVYIW--NLQSK 273
>5M25:1:A|pdbid|entity|chain(s)|sequence
          Length = 434

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 100/263 (38%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 184 SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 240

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G+  +                  +  G L++ +S DG  
Sbjct: 241 -SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 295

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 296 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 355

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DNLV IW    + QT  +   L+GH+D V   A  P
Sbjct: 356 KNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTKEIVQKLQGHTDVVISTACHP 411

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 412 TENIIAS-AALENDKTIKLWKSD 433

 Score = 39.7 bits (91), Expect = 0.007,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 70/180 (38%), Gaps = 35/180 (19%)

Query: 140 IIDAH--AIGVNSASWAPATIEED-------GEHNGTKESRKFVTGG-------ADNLVK 183
           II+AH   IG ++    P  ++ +         H     S KF   G       AD L+K
Sbjct: 111 IIEAHREQIGGSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK 170

Query: 184 IWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPW 243
           IW     A     E T+ GH   + DVAWS    L   L S S D+T  IW  D   G  
Sbjct: 171 IW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLKIW--DVSSGKC 221

Query: 244 KKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENLEGKWEPAGEVH 296
            KTL     +   ++  +++   N++     D  V +W        + L    +P   VH
Sbjct: 222 LKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVH 278

 Score = 32.7 bits (73), Expect = 0.76,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 143 GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 199

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 200 --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 253

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 254 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 298

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 299 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 350

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 351 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 391
>5M23:1:A|pdbid|entity|chain(s)|sequence
          Length = 434

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 100/263 (38%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 184 SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 240

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G+  +                  +  G L++ +S DG  
Sbjct: 241 -SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 295

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 296 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 355

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DNLV IW    + QT  +   L+GH+D V   A  P
Sbjct: 356 KNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTKEIVQKLQGHTDVVISTACHP 411

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 412 TENIIAS-AALENDKTIKLWKSD 433

 Score = 39.7 bits (91), Expect = 0.007,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 70/180 (38%), Gaps = 35/180 (19%)

Query: 140 IIDAH--AIGVNSASWAPATIEED-------GEHNGTKESRKFVTGG-------ADNLVK 183
           II+AH   IG ++    P  ++ +         H     S KF   G       AD L+K
Sbjct: 111 IIEAHREQIGGSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK 170

Query: 184 IWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPW 243
           IW     A     E T+ GH   + DVAWS    L   L S S D+T  IW  D   G  
Sbjct: 171 IW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLKIW--DVSSGKC 221

Query: 244 KKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENLEGKWEPAGEVH 296
            KTL     +   ++  +++   N++     D  V +W        + L    +P   VH
Sbjct: 222 LKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVH 278

 Score = 32.7 bits (73), Expect = 0.76,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 143 GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 199

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 200 --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 253

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 254 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 298

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 299 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 350

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 351 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 391
>2B4E:1:A|pdbid|entity|chain(s)|sequence
          Length = 402

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 67/174 (38%), Gaps = 24/174 (13%)

Query: 111 EYGPLLLVASSDGKVSVVEFKENGTTS---PIIIDAHAIGVNSASWAPATIEEDGEHNGT 167
           ++  L+  AS  G   V+   + G      P++   H   V   +W P        HN  
Sbjct: 45  KFMALICEASGGGAFLVLPLGKTGRVDKNVPLVC-GHTAPVLDIAWCP--------HN-- 93

Query: 168 KESRKFVTGGADNLVKIWKYNSDAQTYVLES---TLEGHSDWVRDVAWSPTVLLRSYLAS 224
                  +G  D  V +W+         L     TLEGH+  V  VAW PT   ++ L S
Sbjct: 94  --DNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTA--QNVLLS 149

Query: 225 VSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKV 278
              D   ++W  D   G    T L  +  PD ++   WS  G ++  S  D +V
Sbjct: 150 AGCDNVILVW--DVGTGAAVLT-LGPDVHPDTIYSVDWSRDGALICTSCRDKRV 200

 Score = 29.3 bits (64), Expect = 9.0,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 43/111 (38%), Gaps = 8/111 (7%)

Query: 24  LATCSSDKTIKIFEVEG-----ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGK 78
           +A+ S D T+ ++E+          + + TL GH   V  V W HP    +L S   D  
Sbjct: 97  IASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAW-HPTAQNVLLSAGCDNV 155

Query: 79  VLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVE 129
           +L+W    G                   W+    G L+  +  D +V V+E
Sbjct: 156 ILVWDVGTGAAVLTLGPDVHPDTIYSVDWS--RDGALICTSCRDKRVRVIE 204
>2AQ5:1:A|pdbid|entity|chain(s)|sequence
          Length = 402

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 67/174 (38%), Gaps = 24/174 (13%)

Query: 111 EYGPLLLVASSDGKVSVVEFKENGTTS---PIIIDAHAIGVNSASWAPATIEEDGEHNGT 167
           ++  L+  AS  G   V+   + G      P++   H   V   +W P        HN  
Sbjct: 45  KFMALICEASGGGAFLVLPLGKTGRVDKNVPLVC-GHTAPVLDIAWCP--------HN-- 93

Query: 168 KESRKFVTGGADNLVKIWKYNSDAQTYVLES---TLEGHSDWVRDVAWSPTVLLRSYLAS 224
                  +G  D  V +W+         L     TLEGH+  V  VAW PT   ++ L S
Sbjct: 94  --DNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTA--QNVLLS 149

Query: 225 VSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKV 278
              D   ++W  D   G    T L  +  PD ++   WS  G ++  S  D +V
Sbjct: 150 AGCDNVILVW--DVGTGAAVLT-LGPDVHPDTIYSVDWSRDGALICTSCRDKRV 200

 Score = 29.3 bits (64), Expect = 9.0,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 43/111 (38%), Gaps = 8/111 (7%)

Query: 24  LATCSSDKTIKIFEVEG-----ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGK 78
           +A+ S D T+ ++E+          + + TL GH   V  V W HP    +L S   D  
Sbjct: 97  IASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAW-HPTAQNVLLSAGCDNV 155

Query: 79  VLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVE 129
           +L+W    G                   W+    G L+  +  D +V V+E
Sbjct: 156 ILVWDVGTGAAVLTLGPDVHPDTIYSVDWS--RDGALICTSCRDKRVRVIE 204
>2CO0:1:A|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 39.3 bits (90), Expect = 0.008,   Method: Composition-based stats.
 Identities = 62/264 (23%), Positives = 106/264 (40%), Gaps = 46/264 (17%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 65  SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 121

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              ++ S S+D  V IW  + G   +                  +  G L++ +S DG  
Sbjct: 122 -SNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 176

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAP-------ATIEED------------GEHNG 166
            + +   +G     +ID     V+   ++P       AT++ D              + G
Sbjct: 177 RIWD-TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNDLKLWDYSKGKCLKTYTG 235

Query: 167 TKESRK-------------FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWS 213
            K  +               V+G  DN+V IW    + QT  +   L+GH+D V   A  
Sbjct: 236 HKNEKYCIFANFSVTGGKWIVSGSEDNMVYIW----NLQTKEIVQKLQGHTDVVISTACH 291

Query: 214 PTVLLRSYLASVSQDRTCIIWTQD 237
           PT  + +  A++  D+T  +W  D
Sbjct: 292 PTENIIAS-AALENDKTIKLWKSD 314

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 41  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 93

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 94  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTL 148

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 149 PAHSDPVSAVH 159

 Score = 32.3 bits (72), Expect = 0.90,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L  TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALMFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 30.0 bits (66), Expect = 5.4,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGR 88
              +L S S D  + IW   +G+
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGK 101
>2H9P:1:A|pdbid|entity|chain(s)|sequence
          Length = 329

 Score = 39.3 bits (90), Expect = 0.009,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 100/263 (38%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 79  SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 135

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G+  +                  +  G L++ +S DG  
Sbjct: 136 -SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 190

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 191 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 250

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DNLV IW    + QT  +   L+GH+D V   A  P
Sbjct: 251 KNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTKEIVQKLQGHTDVVISTACHP 306

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 307 TENIIAS-AALENDKTIKLWKSD 328

 Score = 38.1 bits (87), Expect = 0.019,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 55  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 107

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 108 IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 162

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 163 PAHSDPVSAVH 173

 Score = 33.9 bits (76), Expect = 0.39,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 30  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 84

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 85  ISDV----AWSSDSNLLVSASDDKTLKIW 109

 Score = 31.2 bits (69), Expect = 2.0,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 38  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 94

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 95  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 148

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 149 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 193

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 194 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 245

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 246 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 286
>2H9L:1:A|pdbid|entity|chain(s)|sequence
          Length = 329

 Score = 39.3 bits (90), Expect = 0.009,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 100/263 (38%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 79  SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 135

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G+  +                  +  G L++ +S DG  
Sbjct: 136 -SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 190

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 191 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 250

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DNLV IW    + QT  +   L+GH+D V   A  P
Sbjct: 251 KNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTKEIVQKLQGHTDVVISTACHP 306

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 307 TENIIAS-AALENDKTIKLWKSD 328

 Score = 38.1 bits (87), Expect = 0.019,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 55  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 107

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 108 IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL 162

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 163 PAHSDPVSAVH 173

 Score = 33.9 bits (76), Expect = 0.39,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 30  YALKFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 84

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 85  ISDV----AWSSDSNLLVSASDDKTLKIW 109

 Score = 31.2 bits (69), Expect = 2.0,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 38  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 94

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 95  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 148

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 149 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 193

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 194 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 245

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 246 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 286
>3MXX:1:A|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 39.3 bits (90), Expect = 0.009,   Method: Composition-based stats.
 Identities = 62/263 (23%), Positives = 100/263 (38%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 65  SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 121

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G+  +                  +  G L++ +S DG  
Sbjct: 122 -SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 176

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 177 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 236

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DNLV IW    + QT  +   L+GH+D V   A  P
Sbjct: 237 KNEKYCIFANFSVTGGKWIVSGSEDNLVYIW----NLQTKEIVQKLQGHTDVVISTACHP 292

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 293 TENIIAS-AALENDKTIKLWKSD 314

 Score = 37.7 bits (86), Expect = 0.025,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 52/126 (41%), Gaps = 19/126 (15%)

Query: 178 ADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQD 237
           AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  IW  D
Sbjct: 46  ADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLKIW--D 96

Query: 238 NEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENLEGKWE 290
              G   KTL     +   ++  +++   N++     D  V +W        + L    +
Sbjct: 97  VSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSD 153

Query: 291 PAGEVH 296
           P   VH
Sbjct: 154 PVSAVH 159

 Score = 32.7 bits (73), Expect = 0.83,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L+ TL GH+  V  V +SP      +LA+ S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALKFTLAGHTKAVSSVKFSPN---GEWLAASSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 117/286 (40%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA  S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLAASSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 134

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 135 RIWDVKTGKCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 179

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 180 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 231

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 232 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIW--NLQTK 272
>2YBA:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 422

 Score = 38.1 bits (87), Expect = 0.017,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 255 ADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYS------------EFILATGSA 302

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 303 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLHVWDLS 356

Query: 235 -------TQDNEQGP 242
                  T+D E GP
Sbjct: 357 KIGEEQSTEDAEDGP 371
>2YB8:2:B|pdbid|entity|chain(s)|sequence
          Length = 422

 Score = 38.1 bits (87), Expect = 0.017,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 255 ADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYS------------EFILATGSA 302

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 303 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLHVWDLS 356

Query: 235 -------TQDNEQGP 242
                  T+D E GP
Sbjct: 357 KIGEEQSTEDAEDGP 371
>3V7D:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 464

 Score = 38.1 bits (87), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L +    + T + DK I++++      K +  L+GH+G VW + +AH   G IL S S D
Sbjct: 128 LQFEDNYVITGADDKMIRVYD--SINKKFLLQLSGHDGGVWALKYAH---GGILVSGSTD 182

Query: 77  GKVLIWKEENG 87
             V +W  + G
Sbjct: 183 RTVRVWDIKKG 193
>3MKS:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 464

 Score = 38.1 bits (87), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L +    + T + DK I++++      K +  L+GH+G VW + +AH   G IL S S D
Sbjct: 128 LQFEDNYVITGADDKMIRVYD--SINKKFLLQLSGHDGGVWALKYAH---GGILVSGSTD 182

Query: 77  GKVLIWKEENG 87
             V +W  + G
Sbjct: 183 RTVRVWDIKKG 193
>1NEX:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 464

 Score = 38.1 bits (87), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYD 76
           L +    + T + DK I++++      K +  L+GH+G VW + +AH   G IL S S D
Sbjct: 128 LQFEDNYVITGADDKMIRVYD--SINKKFLLQLSGHDGGVWALKYAH---GGILVSGSTD 182

Query: 77  GKVLIWKEENG 87
             V +W  + G
Sbjct: 183 RTVRVWDIKKG 193
>3C9C:1:A|pdbid|entity|chain(s)|sequence
          Length = 432

 Score = 38.1 bits (87), Expect = 0.018,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 253 ADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYS------------EFILATGSA 300

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 301 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLHVWDLS 354

Query: 235 -------TQDNEQGP 242
                  T+D E GP
Sbjct: 355 KIGEEQSTEDAEDGP 369
>3C99:1:A|pdbid|entity|chain(s)|sequence
          Length = 432

 Score = 38.1 bits (87), Expect = 0.018,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 253 ADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYS------------EFILATGSA 300

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 301 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLHVWDLS 354

Query: 235 -------TQDNEQGP 242
                  T+D E GP
Sbjct: 355 KIGEEQSTEDAEDGP 369
>2XYI:1:A|pdbid|entity|chain(s)|sequence
          Length = 430

 Score = 38.1 bits (87), Expect = 0.018,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 251 ADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYS------------EFILATGSA 298

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 299 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLHVWDLS 352

Query: 235 -------TQDNEQGP 242
                  T+D E GP
Sbjct: 353 KIGEEQSTEDAEDGP 367
>4V5O:27:AR,BR|pdbid|entity|chain(s)|sequence
          Length = 343

 Score = 38.1 bits (87), Expect = 0.019,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 87/223 (39%), Gaps = 33/223 (14%)

Query: 69  ILASCSYDGKVLIWK---EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
           +L S S D  V+IWK   EE   +  I               A  +     + +S D  +
Sbjct: 41  VLISGSRDKTVMIWKLYEEEQNGYFGIPHKALTGHNHFVSDLALSQENCFAISSSWDKTL 100

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + +  GTT    +  H   V S +++P             ++R+ ++ GA+  +K+W
Sbjct: 101 RLWDLR-TGTTYKRFV-GHQSEVYSVAFSP-------------DNRQILSAGAEREIKLW 145

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVL-------LRSYLASVSQDRTCIIWTQDN 238
               + +    E   E HSDWV  V +SP +           Y ASV  D    +W   N
Sbjct: 146 NILGECKFSSAEK--ENHSDWVSCVRYSPIMKSANKVQPFAPYFASVGWDGRLKVW---N 200

Query: 239 EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
                + T    E   + L   S S +G  +A  G D K+ +W
Sbjct: 201 TNFQIRYTFKAHESNVNHL---SISPNGKYIATGGKDKKLLIW 240
>4BTS:28:AR,BR,CR,DR|pdbid|entity|chain(s)|sequence
          Length = 343

 Score = 38.1 bits (87), Expect = 0.019,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 87/223 (39%), Gaps = 33/223 (14%)

Query: 69  ILASCSYDGKVLIWK---EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
           +L S S D  V+IWK   EE   +  I               A  +     + +S D  +
Sbjct: 41  VLISGSRDKTVMIWKLYEEEQNGYFGIPHKALTGHNHFVSDLALSQENCFAISSSWDKTL 100

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + +  GTT    +  H   V S +++P             ++R+ ++ GA+  +K+W
Sbjct: 101 RLWDLR-TGTTYKRFV-GHQSEVYSVAFSP-------------DNRQILSAGAEREIKLW 145

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVL-------LRSYLASVSQDRTCIIWTQDN 238
               + +    E   E HSDWV  V +SP +           Y ASV  D    +W   N
Sbjct: 146 NILGECKFSSAEK--ENHSDWVSCVRYSPIMKSANKVQPFAPYFASVGWDGRLKVW---N 200

Query: 239 EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
                + T    E   + L   S S +G  +A  G D K+ +W
Sbjct: 201 TNFQIRYTFKAHESNVNHL---SISPNGKYIATGGKDKKLLIW 240
>2CO0:3:C|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 41  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 93

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 94  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTL 148

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 149 PAHSDPVSAVH 159

 Score = 37.0 bits (84), Expect = 0.044,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 99/263 (37%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 65  SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 121

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G   +                  +  G L++ +S DG  
Sbjct: 122 -SNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 176

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 177 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 236

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DN+V IW    + QT  +   L+GH+D V   A  P
Sbjct: 237 KNEKYCIFANFSVTGGKWIVSGSEDNMVYIW----NLQTKEIVQKLQGHTDVVISTACHP 292

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 293 TENIIAS-AALENDKTIKLWKSD 314

 Score = 32.3 bits (72), Expect = 0.90,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L  TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALMFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 31.2 bits (69), Expect = 2.5,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 134

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 135 RIWDVKTGMCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 179

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 180 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 231

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 232 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNMVYIW--NLQTK 272
>2CNX:1:A|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             +  AD L+KIW     A     E T+ GH   + DVAWS    L   L S S D+T  
Sbjct: 41  LASSSADKLIKIW----GAYDGKFEKTISGHKLGISDVAWSSDSNL---LVSASDDKTLK 93

Query: 233 IWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWK-------ENL 285
           IW  D   G   KTL     +   ++  +++   N++     D  V +W        + L
Sbjct: 94  IW--DVSSGKCLKTLKGHSNY---VFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTL 148

Query: 286 EGKWEPAGEVH 296
               +P   VH
Sbjct: 149 PAHSDPVSAVH 159

 Score = 37.0 bits (84), Expect = 0.044,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 99/263 (37%), Gaps = 44/263 (16%)

Query: 6   NAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           + H   I D         L + S DKT+KI++V   + K + TL GH   V+  ++ +P+
Sbjct: 65  SGHKLGISDVAWSSDSNLLVSASDDKTLKIWDV--SSGKCLKTLKGHSNYVFCCNF-NPQ 121

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDG-- 123
              ++ S S+D  V IW  + G   +                  +  G L++ +S DG  
Sbjct: 122 -SNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHF----NRDGSLIVSSSYDGLC 176

Query: 124 --------------------KVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGE 163
                                VS V+F  NG         + + +   S         G 
Sbjct: 177 RIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 236

Query: 164 HN---------GTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
            N              +  V+G  DN+V IW    + QT  +   L+GH+D V   A  P
Sbjct: 237 KNEKYCIFANFSVTGGKWIVSGSEDNMVYIW----NLQTKEIVQKLQGHTDVVISTACHP 292

Query: 215 TVLLRSYLASVSQDRTCIIWTQD 237
           T  + +  A++  D+T  +W  D
Sbjct: 293 TENIIAS-AALENDKTIKLWKSD 314

 Score = 32.3 bits (72), Expect = 0.90,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 10/89 (11%)

Query: 194 YVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEE-K 252
           Y L  TL GH+  V  V +SP      +LAS S D+   IW   +  G ++KT+   +  
Sbjct: 16  YALMFTLAGHTKAVSSVKFSPN---GEWLASSSADKLIKIWGAYD--GKFEKTISGHKLG 70

Query: 253 FPDVLWRASWSLSGNVLALSGGDNKVTLW 281
             DV    +WS   N+L  +  D  + +W
Sbjct: 71  ISDV----AWSSDSNLLVSASDDKTLKIW 95

 Score = 31.2 bits (69), Expect = 2.5,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIF-EVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
            H + +        G+ LA+ S+DK IKI+   +G+  K   T++GH+  +  V W+   
Sbjct: 24  GHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEK---TISGHKLGISDVAWSSDS 80

Query: 66  FGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKV 125
              +L S S D  + IW   +G+   +              + P     L++  S D  V
Sbjct: 81  --NLLVSASDDKTLKIWDVSSGKC--LKTLKGHSNYVFCCNFNPQS--NLIVSGSFDESV 134

Query: 126 SVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185
            + + K         + AH+  V++  +              ++    V+   D L +IW
Sbjct: 135 RIWDVKTGMCLK--TLPAHSDPVSAVHF-------------NRDGSLIVSSSYDGLCRIW 179

Query: 186 KYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKK 245
                A    L++ ++  +  V  V +SP      Y+ + + D T  +W  D  +G   K
Sbjct: 180 ---DTASGQCLKTLIDDDNPPVSFVKFSPN---GKYILAATLDNTLKLW--DYSKGKCLK 231

Query: 246 TLL--KEEKFPDVLWRASWSLSGNVLALSGG-DNKVTLWKENLEGK 288
           T    K EK+      A++S++G    +SG  DN V +W  NL+ K
Sbjct: 232 TYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNMVYIW--NLQTK 272
>5NRL:15:H|pdbid|entity|chain(s)|sequence
          Length = 465

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
           +D+H   + +  W P +            + + ++   D L+K ++Y+++     L   L
Sbjct: 214 LDSHVGKIGAIDWHPDS------------NNQMISCAEDGLIKNFQYSNEEGGLRLLGDL 261

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GH   + DV + P+     ++ S S D T  +W     Q      LL +E     ++  
Sbjct: 262 VGHERRISDVKYHPS---GKFIGSASHDMTWRLWDASTHQ-----ELLLQEGHDKGVFSL 313

Query: 261 SWSLSGNVLALSGGDNKVTLW 281
           S+   G+++   G D+   LW
Sbjct: 314 SFQCDGSLVCSGGMDSLSMLW 334

 Score = 30.0 bits (66), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 37/84 (44%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V+    H++ I+       G ++AT   D  I ++++       ++ +  H   V +V +
Sbjct: 342 VMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRF 401

Query: 62  AHPKFGTILASCSYDGKVLIWKEE 85
           +    G  L SC YD  + ++  +
Sbjct: 402 SKEDGGKKLVSCGYDNLINVYSSD 425
>5GAP:6:H|pdbid|entity|chain(s)|sequence
          Length = 465

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
           +D+H   + +  W P +            + + ++   D L+K ++Y+++     L   L
Sbjct: 214 LDSHVGKIGAIDWHPDS------------NNQMISCAEDGLIKNFQYSNEEGGLRLLGDL 261

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GH   + DV + P+     ++ S S D T  +W     Q      LL +E     ++  
Sbjct: 262 VGHERRISDVKYHPS---GKFIGSASHDMTWRLWDASTHQ-----ELLLQEGHDKGVFSL 313

Query: 261 SWSLSGNVLALSGGDNKVTLW 281
           S+   G+++   G D+   LW
Sbjct: 314 SFQCDGSLVCSGGMDSLSMLW 334

 Score = 30.0 bits (66), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 37/84 (44%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V+    H++ I+       G ++AT   D  I ++++       ++ +  H   V +V +
Sbjct: 342 VMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRF 401

Query: 62  AHPKFGTILASCSYDGKVLIWKEE 85
           +    G  L SC YD  + ++  +
Sbjct: 402 SKEDGGKKLVSCGYDNLINVYSSD 425
>5GAN:4:H|pdbid|entity|chain(s)|sequence
          Length = 465

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
           +D+H   + +  W P +            + + ++   D L+K ++Y+++     L   L
Sbjct: 214 LDSHVGKIGAIDWHPDS------------NNQMISCAEDGLIKNFQYSNEEGGLRLLGDL 261

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GH   + DV + P+     ++ S S D T  +W     Q      LL +E     ++  
Sbjct: 262 VGHERRISDVKYHPS---GKFIGSASHDMTWRLWDASTHQ-----ELLLQEGHDKGVFSL 313

Query: 261 SWSLSGNVLALSGGDNKVTLW 281
           S+   G+++   G D+   LW
Sbjct: 314 SFQCDGSLVCSGGMDSLSMLW 334

 Score = 30.0 bits (66), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 37/84 (44%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V+    H++ I+       G ++AT   D  I ++++       ++ +  H   V +V +
Sbjct: 342 VMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRF 401

Query: 62  AHPKFGTILASCSYDGKVLIWKEE 85
           +    G  L SC YD  + ++  +
Sbjct: 402 SKEDGGKKLVSCGYDNLINVYSSD 425
>3JCM:2:B|pdbid|entity|chain(s)|sequence
          Length = 465

 Score = 37.7 bits (86), Expect = 0.022,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTL 200
           +D+H   + +  W P +            + + ++   D L+K ++Y+++     L   L
Sbjct: 214 LDSHVGKIGAIDWHPDS------------NNQMISCAEDGLIKNFQYSNEEGGLRLLGDL 261

Query: 201 EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260
            GH   + DV + P+     ++ S S D T  +W     Q      LL +E     ++  
Sbjct: 262 VGHERRISDVKYHPS---GKFIGSASHDMTWRLWDASTHQ-----ELLLQEGHDKGVFSL 313

Query: 261 SWSLSGNVLALSGGDNKVTLW 281
           S+   G+++   G D+   LW
Sbjct: 314 SFQCDGSLVCSGGMDSLSMLW 334

 Score = 30.0 bits (66), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 37/84 (44%)

Query: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61
           V+    H++ I+       G ++AT   D  I ++++       ++ +  H   V +V +
Sbjct: 342 VMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRF 401

Query: 62  AHPKFGTILASCSYDGKVLIWKEE 85
           +    G  L SC YD  + ++  +
Sbjct: 402 SKEDGGKKLVSCGYDNLINVYSSD 425
>5NAF:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 402

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWA---- 62
            H   ++    D  G  LA+CS D T+KI+ ++ +    +  L  H   ++ + W+    
Sbjct: 235 GHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDN--CVHDLQAHNKEIYTIKWSPTGP 292

Query: 63  ---HPKFGTILASCSYDGKVLIWKEENG 87
              +P    +LAS S+D  V +W  + G
Sbjct: 293 GTNNPNANLMLASASFDSTVRLWDVDRG 320

 Score = 36.6 bits (83), Expect = 0.048,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 75/188 (39%), Gaps = 38/188 (20%)

Query: 56  VWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPL 115
           V  +DW     GT+LA+ SYDG   IW ++    S +                    GP+
Sbjct: 116 VTSLDWNSE--GTLLATGSYDGFARIWTKDGNLASTLG----------------QHKGPI 157

Query: 116 LLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSA---SWAPATIEEDGEHNGTKESRK 172
             +  +     ++    + TT  II DAH            APA ++ D + N T     
Sbjct: 158 FALKWNKKGNFILSAGVDKTT--IIWDAHTGEAKQQFPFHSAPA-LDVDWQSNNT----- 209

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F +   D  + + K   D        T +GH++ V  + W PT  L   LAS S D T  
Sbjct: 210 FASCSTDMCIHVCKLGQDRPI----KTFQGHTNEVNAIKWDPTGNL---LASCSDDMTLK 262

Query: 233 IWT--QDN 238
           IW+  QDN
Sbjct: 263 IWSMKQDN 270

 Score = 35.4 bits (80), Expect = 0.13,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           LA+ S D T+++++V+      I TLT H+ PV+ V  A    G  LAS S+D  V IW 
Sbjct: 303 LASASFDSTVRLWDVDRGI--CIHTLTKHQEPVYSV--AFSPDGRYLASGSFDKCVHIWN 358

Query: 84  EENG 87
            + G
Sbjct: 359 TQTG 362
>4LG9:1:A|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 7   AHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWA---- 62
            H   ++    D  G  LA+CS D T+KI+ ++ +    +  L  H   ++ + W+    
Sbjct: 233 GHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDN--CVHDLQAHNKEIYTIKWSPTGP 290

Query: 63  ---HPKFGTILASCSYDGKVLIWKEENG 87
              +P    +LAS S+D  V +W  + G
Sbjct: 291 GTNNPNANLMLASASFDSTVRLWDVDRG 318

 Score = 36.6 bits (83), Expect = 0.050,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 75/188 (39%), Gaps = 38/188 (20%)

Query: 56  VWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPL 115
           V  +DW     GT+LA+ SYDG   IW ++    S +                    GP+
Sbjct: 114 VTSLDWNSE--GTLLATGSYDGFARIWTKDGNLASTLG----------------QHKGPI 155

Query: 116 LLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSA---SWAPATIEEDGEHNGTKESRK 172
             +  +     ++    + TT  II DAH            APA ++ D + N T     
Sbjct: 156 FALKWNKKGNFILSAGVDKTT--IIWDAHTGEAKQQFPFHSAPA-LDVDWQSNNT----- 207

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F +   D  + + K   D        T +GH++ V  + W PT  L   LAS S D T  
Sbjct: 208 FASCSTDMCIHVCKLGQDRPI----KTFQGHTNEVNAIKWDPTGNL---LASCSDDMTLK 260

Query: 233 IWT--QDN 238
           IW+  QDN
Sbjct: 261 IWSMKQDN 268

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           LA+ S D T+++++V+      I T+T H+ PV+ V  A    G  LAS S+D  V IW 
Sbjct: 301 LASASFDSTVRLWDVDRGI--CIHTMTKHQEPVYSV--AFSPDGRYLASGSFDKCVHIWN 356

Query: 84  EENG 87
            + G
Sbjct: 357 TQTG 360
>5FXY:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>4R7A:2:B|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>4PC0:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>4PBZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>4PBY:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>3GFC:1:A|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>2XU7:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 425

 Score = 37.7 bits (86), Expect = 0.027,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 76/195 (38%), Gaps = 42/195 (21%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P   +DAH   VN  S+ P +                 TG A
Sbjct: 247 ADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYS------------EFILATGSA 294

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-- 235
           D  V +W    D +   L+  + E H D +  V WSP     + LAS   DR   +W   
Sbjct: 295 DKTVALW----DLRNLKLKLHSFESHKDEIFQVQWSPHN--ETILASSGTDRRLNVWDLS 348

Query: 236 --------QDNEQGPWKKTLL---KEEKFPDVLWRAS--WSLSGNVLALSGGDNKVTLWK 282
                   +D E GP +   +      K  D  W  +  W     V+     DN + +W+
Sbjct: 349 KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW-----VICSVSEDNIMQVWQ 403

Query: 283 --ENLEGKWEPAGEV 295
             EN+    +P G V
Sbjct: 404 MAENIYNDEDPEGSV 418
>5FA5:2:B|pdbid|entity|chain(s)|sequence
          Length = 367

 Score = 37.4 bits (85), Expect = 0.028,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 149 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 205

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 206 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 264

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 265 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 298

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 299 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 348
>3CFV:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 414

 Score = 37.4 bits (85), Expect = 0.029,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P  ++DAH   VN  S+ P +                 TG A
Sbjct: 249 ADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYS------------EFILATGSA 296

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  T E H D +  V WSP     + LAS   DR   +W   
Sbjct: 297 DKTVALW----DLRNLKLKLHTFESHKDEIFQVHWSPHN--ETILASSGTDRRLNVWDLS 350

Query: 235 -------TQDNEQGP 242
                   +D E GP
Sbjct: 351 KIGEEQSAEDAEDGP 365

 Score = 32.3 bits (72), Expect = 0.99,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 170 SRKFVTGGADNLVKIWKYNS---DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           S   ++   D+ V +W  N+   + +    ++   GHS  V DVAW   +L  S   SV+
Sbjct: 192 SGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWH--LLHESLFGSVA 249

Query: 227 QDRTCIIW-TQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
            D+  +IW T+ N     K + L +    +V   +    S  +LA    D  V LW
Sbjct: 250 DDQKLMIWDTRSNTTS--KPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW 303
>3CFS:1:B|pdbid|entity|chain(s)|sequence
          Length = 414

 Score = 37.4 bits (85), Expect = 0.029,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 30/135 (22%)

Query: 120 SSDGKVSVVEFKENGTTSPI-IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA 178
           + D K+ + + + N T+ P  ++DAH   VN  S+ P +                 TG A
Sbjct: 249 ADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYS------------EFILATGSA 296

Query: 179 DNLVKIWKYNSDAQTYVLE-STLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW--- 234
           D  V +W    D +   L+  T E H D +  V WSP     + LAS   DR   +W   
Sbjct: 297 DKTVALW----DLRNLKLKLHTFESHKDEIFQVHWSPHN--ETILASSGTDRRLNVWDLS 350

Query: 235 -------TQDNEQGP 242
                   +D E GP
Sbjct: 351 KIGEEQSAEDAEDGP 365

 Score = 32.3 bits (72), Expect = 0.99,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 170 SRKFVTGGADNLVKIWKYNS---DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           S   ++   D+ V +W  N+   + +    ++   GHS  V DVAW   +L  S   SV+
Sbjct: 192 SGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWH--LLHESLFGSVA 249

Query: 227 QDRTCIIW-TQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLW 281
            D+  +IW T+ N     K + L +    +V   +    S  +LA    D  V LW
Sbjct: 250 DDQKLMIWDTRSNTTS--KPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW 303
>3OW8:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 321

 Score = 37.4 bits (85), Expect = 0.031,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 87/231 (37%), Gaps = 63/231 (27%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83
           + T S D  +K+++   E   L  +L GH+  V  VD +H     I AS S D  + +W 
Sbjct: 51  VVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTL--PIAASSSLDAHIRLWD 108

Query: 84  EENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVV--------------- 128
            ENG+  QI              ++P      L   +  GKV++                
Sbjct: 109 LENGK--QIKSIDAGPVDAWTLAFSPDS--QYLATGTHVGKVNIFGVESGKKEYSLDTRG 164

Query: 129 ------------EFKENGTTSPII-------------IDAHAIGVNSASWAPATIEEDGE 163
                       ++  +G    II             ++ HA+ + S +++P        
Sbjct: 165 KFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-------- 216

Query: 164 HNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP 214
                +S+  VT   D  +KI+    D Q   L  TL GH+ WV +VA+ P
Sbjct: 217 -----DSQLLVTASDDGYIKIY----DVQHANLAGTLSGHASWVLNVAFCP 258

 Score = 33.1 bits (74), Expect = 0.67,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 165 NGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLAS 224
           N  + S   VTG  D+LVK+WK+  +     L+ +LEGH   V  V  S T+ +    AS
Sbjct: 43  NKKENSETVVTGSLDDLVKVWKWRDERLD--LQWSLEGHQLGVVSVDISHTLPIA---AS 97

Query: 225 VSQDRTCIIWTQDN 238
            S D    +W  +N
Sbjct: 98  SSLDAHIRLWDLEN 111
>4XYI:1:A|pdbid|entity|chain(s)|sequence
          Length = 430

 Score = 37.4 bits (85), Expect = 0.033,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           LAT S+D T+ ++++     +L  TL GHE  V+ V W+ P    IL + S D +V +W
Sbjct: 297 LATASADHTVALWDLRRLNQRL-HTLEGHEDEVYNVQWS-PHDEPILVTSSTDRRVCVW 353

 Score = 33.1 bits (74), Expect = 0.54,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             T  AD+ V +W      Q      TLEGH D V +V WSP       L + S DR   
Sbjct: 297 LATASADHTVALWDLRRLNQRL---HTLEGHEDEVYNVQWSPHD--EPILVTSSTDRRVC 351

Query: 233 IW 234
           +W
Sbjct: 352 VW 353
>4XYH:1:A|pdbid|entity|chain(s)|sequence
          Length = 430

 Score = 37.4 bits (85), Expect = 0.033,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           LAT S+D T+ ++++     +L  TL GHE  V+ V W+ P    IL + S D +V +W
Sbjct: 297 LATASADHTVALWDLRRLNQRL-HTLEGHEDEVYNVQWS-PHDEPILVTSSTDRRVCVW 353

 Score = 33.1 bits (74), Expect = 0.54,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
             T  AD+ V +W      Q      TLEGH D V +V WSP       L + S DR   
Sbjct: 297 LATASADHTVALWDLRRLNQRL---HTLEGHEDEVYNVQWSPHD--EPILVTSSTDRRVC 351

Query: 233 IW 234
           +W
Sbjct: 352 VW 353
>5EMM:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>5EML:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>5EMK:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>5EMJ:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>5C9Z:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>4X63:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>4X61:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>4X60:2:B|pdbid|entity|chain(s)|sequence
          Length = 350

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 132 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 188

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 189 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 247

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 248 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 281

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 282 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 331
>5I2T:1:A|pdbid|entity|chain(s)|sequence
          Length = 742

 Score = 37.4 bits (85), Expect = 0.035,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 2/42 (4%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           +T +L+D L+GHEGPV  + ++     ++LAS S+D  + IW
Sbjct: 486 QTGQLLDALSGHEGPVSCLSFSQEN--SVLASASWDKTIRIW 525

 Score = 29.3 bits (64), Expect = 8.4,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G R+ T S D  IK++++   +   + T   H   V  V +A  K G ++ S S DG V 
Sbjct: 382 GSRVVTASEDGKIKVWDI--TSGFCLATFEEHTSSVTAVQFA--KRGQVMFSSSLDGTVR 437

Query: 81  IW 82
            W
Sbjct: 438 AW 439
>5WYK:16:BA|pdbid|entity|chain(s)|sequence
          Length = 923

 Score = 37.4 bits (85), Expect = 0.036,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 2/42 (4%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           +T +L+D L+GHEGPV  + ++     ++LAS S+D  + IW
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQEN--SVLASASWDKTIRIW 500

 Score = 29.3 bits (64), Expect = 8.6,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G R+ T S D  IK++++   +   + T   H   V  V +A  K G ++ S S DG V 
Sbjct: 357 GSRVVTASEDGKIKVWDI--TSGFCLATFEEHTSSVTAVQFA--KRGQVMFSSSLDGTVR 412

Query: 81  IW 82
            W
Sbjct: 413 AW 414
>5WYJ:16:BA|pdbid|entity|chain(s)|sequence
          Length = 923

 Score = 37.4 bits (85), Expect = 0.036,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 2/42 (4%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           +T +L+D L+GHEGPV  + ++     ++LAS S+D  + IW
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQEN--SVLASASWDKTIRIW 500

 Score = 29.3 bits (64), Expect = 8.6,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G R+ T S D  IK++++   +   + T   H   V  V +A  K G ++ S S DG V 
Sbjct: 357 GSRVVTASEDGKIKVWDI--TSGFCLATFEEHTSSVTAVQFA--KRGQVMFSSSLDGTVR 412

Query: 81  IW 82
            W
Sbjct: 413 AW 414
>4GQB:2:B|pdbid|entity|chain(s)|sequence
          Length = 344

 Score = 37.0 bits (84), Expect = 0.036,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 8   HNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFG 67
           H++++    +   G +  + S D  IK++++  +   ++ +   H   V  V  A P   
Sbjct: 126 HDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV--VLSSYRAHAAQVTCVA-ASPHKD 182

Query: 68  TILASCSYDGKVLIWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSV 127
           ++  SCS D ++L+W     + +                W P +   + +    +G VS+
Sbjct: 183 SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQ-SEVFVFGDENGTVSL 241

Query: 128 VEFKENGTTSPIIIDA-HAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186
           V+ K   +TS ++  A H+  V    ++P ++              F+            
Sbjct: 242 VDTK---STSCVLSSAVHSQCVTGLVFSPHSV-------------PFLA----------S 275

Query: 187 YNSDAQTYVLESTL------EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            + D    VL+S+L      + H D+VRD  WSP  L  S L +V  D   +
Sbjct: 276 LSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSP--LNHSLLTTVGWDHQVV 325
>4V6W:2:Ag|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 37.0 bits (84), Expect = 0.041,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 9/118 (7%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + ++R+ V+G  D  +K+W   ++ +  + E   +GH+DWV  V +SP       + S  
Sbjct: 115 SADNRQIVSGSRDKTIKLWNTLAECKFTIQE---DGHTDWVSCVRFSPN-HSNPIIVSCG 170

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKEN 284
            DRT  +W   N      K           L   + S  G++    G D+K  LW  N
Sbjct: 171 WDRTVKVWNLAN-----CKLKNNHHGHNGYLNTVTVSPDGSLCTSGGKDSKALLWDLN 223

 Score = 31.2 bits (69), Expect = 2.1,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 13/97 (13%)

Query: 191 AQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT----QDNEQGPWKKT 246
           ++T  L  TL GH+ WV  +A +P       + S S+D+T I+W     +D   G  +K 
Sbjct: 2   SETLQLRGTLIGHNGWVTQIATNPKD--PDTIISASRDKTLIVWKLTRDEDTNYGYPQKR 59

Query: 247 LLKEEKF-PDVLWRASWSLSGNVLALSGG-DNKVTLW 281
           L     F  DV+     S  GN  ALSG  D  + LW
Sbjct: 60  LYGHSHFISDVV----LSSDGN-YALSGSWDQTLRLW 91
>4XF2:3:C,V|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>4XEI:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9U:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9S:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9P:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9N:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9L:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9K:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>2P9I:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>1U2V:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>1TYQ:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>1K8K:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.062,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  VDWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>5O9Z:6:F|pdbid|entity|chain(s)|sequence
          Length = 521

 Score = 36.2 bits (82), Expect = 0.064,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 7   AHNELIHDAVLD-YYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           AH  L+     +  +G  L T + D T KI+   G +   + TL GHEG V  +D +   
Sbjct: 446 AHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSP--LKTLAGHEGKVMGLDISSD- 502

Query: 66  FGTILASCSYDGKVLIWKEE 85
            G ++A+CSYD    +W  E
Sbjct: 503 -GQLIATCSYDRTFKLWMAE 521
>3JCR:23:L|pdbid|entity|chain(s)|sequence
          Length = 521

 Score = 36.2 bits (82), Expect = 0.064,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 7   AHNELIHDAVLD-YYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPK 65
           AH  L+     +  +G  L T + D T KI+   G +   + TL GHEG V  +D +   
Sbjct: 446 AHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSP--LKTLAGHEGKVMGLDISSD- 502

Query: 66  FGTILASCSYDGKVLIWKEE 85
            G ++A+CSYD    +W  E
Sbjct: 503 -GQLIATCSYDRTFKLWMAE 521
>4JD2:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3ULE:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3UKU:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3UKR:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3RSE:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3DXM:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3DXK:3:C|pdbid|entity|chain(s)|sequence
          Length = 372

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 23  RLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW 82
           ++A C ++  + I+E  G     +  L  H G V  +DWA P    I+ +C  D    +W
Sbjct: 22  QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWA-PDSNRIV-TCGTDRNAYVW 79

Query: 83  KEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKE 132
             +   W                +WAP+E      V S    +S+  F++
Sbjct: 80  TLKGRTWKPTLVILRINRAARCVRWAPNEKK--FAVGSGSRVISICYFEQ 127
>3JAQ:36:g|pdbid|entity|chain(s)|sequence
          Length = 326

 Score = 35.8 bits (81), Expect = 0.083,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 144 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 198

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 199 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 230

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 9   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 53
>3JAP:36:g|pdbid|entity|chain(s)|sequence
          Length = 326

 Score = 35.8 bits (81), Expect = 0.083,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 144 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 198

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 199 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 230

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 9   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 53
>3JAM:34:g|pdbid|entity|chain(s)|sequence
          Length = 326

 Score = 35.8 bits (81), Expect = 0.083,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 144 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 198

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 199 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 230

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 9   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 53
>3J81:32:g|pdbid|entity|chain(s)|sequence
          Length = 326

 Score = 35.8 bits (81), Expect = 0.083,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 144 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 198

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 199 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 230

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 9   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 53
>3J80:34:g|pdbid|entity|chain(s)|sequence
          Length = 326

 Score = 35.8 bits (81), Expect = 0.083,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 144 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 198

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 199 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 230

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 9   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 53
>5IT9:33:g|pdbid|entity|chain(s)|sequence
          Length = 324

 Score = 35.8 bits (81), Expect = 0.088,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 142 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 196

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 197 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 228

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 7   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 51
>5IT7:80:g|pdbid|entity|chain(s)|sequence
          Length = 324

 Score = 35.8 bits (81), Expect = 0.088,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 140 IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLEST 199
           ++  H   V     AP  +E DGE +  + +  FV+ G D +V+ W  N D  +Y +E+ 
Sbjct: 142 VLLGHTDWVTKVRVAPKNLE-DGEVDDGRIT--FVSAGMDKIVRSWSLNED--SYRIEAD 196

Query: 200 LEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234
             GH++++  V  SP     S  AS  +D    +W
Sbjct: 197 FIGHNNYINVVQPSPD---GSLAASAGKDGQIYVW 228

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 195 VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWT-QDNEQ 240
           VL  TLEGH+ WV   + S +    + L S S+D+T I W   +NEQ
Sbjct: 7   VLRGTLEGHNGWV--TSLSTSAAQPNLLVSGSRDKTLISWRLTENEQ 51
>3W15:1:A|pdbid|entity|chain(s)|sequence
          Length = 368

 Score = 35.8 bits (81), Expect = 0.10,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 50/127 (39%), Gaps = 22/127 (17%)

Query: 175 TGGADNLVKIWK---YNSDA----QTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQ 227
           TGG DN ++IW     N +      +  +      H   +R V WSP     + L S S 
Sbjct: 240 TGGVDNAIRIWDIRMLNKNPGQLHNSSCINEIPNAHGLAIRKVTWSPH--HSNILMSASY 297

Query: 228 DRTCIIWT-----------QDNEQGPWKKTLLKEEKFPDVLWRASWSLSGN--VLALSGG 274
           D TC IW            + N     K ++    +  + ++ A WSL G    +A +  
Sbjct: 298 DMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGADWSLWGKPGYVASTAW 357

Query: 275 DNKVTLW 281
           D  + +W
Sbjct: 358 DGNLFVW 364
>3JB9:25:g|pdbid|entity|chain(s)|sequence
          Length = 558

 Score = 35.4 bits (80), Expect = 0.12,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
            ++G  DN +KIW+   D     L  T +GH+  +RD+++S     RS+L S S D+T  
Sbjct: 282 LLSGSMDNQIKIWEVYHDRS---LLRTFQGHARPIRDLSFSQDG--RSFL-STSFDKTIK 335

Query: 233 IWTQDNEQG 241
           +W  D E G
Sbjct: 336 LW--DTELG 342

 Score = 34.7 bits (78), Expect = 0.20,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 72/174 (41%), Gaps = 30/174 (17%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G  L + S D  IKI+EV  +   L+ T  GH  P+   D +  + G    S S+D  + 
Sbjct: 279 GHLLLSGSMDNQIKIWEVYHD-RSLLRTFQGHARPI--RDLSFSQDGRSFLSTSFDKTIK 335

Query: 81  IWKEENGRWSQIXXXXXXXX--XXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSP 138
           +W  E G+                      P+E+    L  ++D ++   + +     SP
Sbjct: 336 LWDTELGKCLNCFNSDRLTNCVKFQVDPDKPNEF----LAGTADKRILQFDIR-----SP 386

Query: 139 III---DAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNS 189
            I+   D H  G+NS      T  E+G        ++FVT   D+ ++ W+Y +
Sbjct: 387 DIVQAYDHHLGGINSI-----TFLENG--------KRFVTTSDDSSMRFWEYGT 427
>4V8M:8:A7|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 35.4 bits (80), Expect = 0.13,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 174 VTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCII 233
           V+GG DNLVK+W    D  T  L + L+GH+++V  V  SP     S  AS  +D    +
Sbjct: 170 VSGGWDNLVKVW----DLATGRLVTDLKGHTNYVTSVTVSPD---GSLCASSDKDGVARL 222

Query: 234 W 234
           W
Sbjct: 223 W 223

 Score = 32.0 bits (71), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV 216
           + ++R+ V+GG DN +++W    +    +       H+DWV  V +SP++
Sbjct: 118 SPDNRQIVSGGRDNALRVWNVKGECMHTLSRG---AHTDWVSCVRFSPSL 164

 Score = 29.3 bits (64), Expect = 9.7,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 15/122 (12%)

Query: 172 KFVTGGADNLVKIWKYNSDAQT----YVL-ESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           K V+   D  +  W  N D  +    Y L +  LEGHS +V DVA S      ++  S S
Sbjct: 30  KVVSTSRDKTLLSWGPNPDRHSSECSYGLPDRRLEGHSAFVSDVALSNN---GNFAVSAS 86

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLE 286
            D +  +W   N Q  +K   L   K  DVL   ++S     +   G DN + +W  N++
Sbjct: 87  WDHSLRLWNLQNGQCQYK--FLGHTK--DVL-SVAFSPDNRQIVSGGRDNALRVW--NVK 139

Query: 287 GK 288
           G+
Sbjct: 140 GE 141
>3JB9:11:K|pdbid|entity|chain(s)|sequence
          Length = 473

 Score = 35.4 bits (80), Expect = 0.13,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 173 FVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCI 232
           F TG  D  +KIW    D  + VL+ TL GH   VR +A SP      YL S  +D+   
Sbjct: 178 FCTGAGDRTIKIW----DLASGVLKLTLTGHIATVRGLAVSPR---HPYLFSCGEDKMVK 230

Query: 233 IW 234
            W
Sbjct: 231 CW 232
>4OZU:1:A|pdbid|entity|chain(s)|sequence
          Length = 394

 Score = 35.4 bits (80), Expect = 0.14,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 7   AHNELIHDAVLD-YYGKRLATCSSDKTIKIF----EVEGETH--KLIDTLTGHEGPVWRV 59
            H   I D     +Y   LAT   D  ++I+    EV G T   + I TLTG    V   
Sbjct: 77  GHTASIQDTNFSPFYRDILATACEDTIVRIWQLPEEVTGTTELKEPIATLTGALKKVLSA 136

Query: 60  DWAHPKFGTILASCSYDGKVLIWKEE 85
           +W +P    ILAS  +DG V  W  E
Sbjct: 137 EW-NPAVSGILASGCFDGTVAFWNVE 161
>5M2N:1:A|pdbid|entity|chain(s)|sequence
          Length = 788

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 221 YLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWS--LSGNVLALSGGDNKV 278
           +L SV +DR   +W ++ E   ++     E+    ++W A W+    GNV   +  D  V
Sbjct: 620 FLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASRDKTV 679

Query: 279 TLWKENLE 286
            +W+   E
Sbjct: 680 KVWRHQKE 687

 Score = 34.3 bits (77), Expect = 0.24,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 99/246 (40%), Gaps = 27/246 (10%)

Query: 22  KRLATCSSDKTIKIFE-VEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           K++    + KTI +++ +E     +  TL GHE  V  V +        + S S D  V 
Sbjct: 27  KKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDS--DFMVSASEDHHVK 84

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPII 140
           IWK  +    Q                A      L+ V  +DG +S+  +++N       
Sbjct: 85  IWKFTDYSHLQCIQTIQHYSKTIV---ALSALPSLISVGCADGTISI--WRQNIQNDEFG 139

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFV--TGGADNLVKIWKY---NSDAQTYV 195
           + AH   +    + P  +          E +K++   GG +  V I  +   +S  +   
Sbjct: 140 L-AHEFTIKKGFFYPLCLSLS-----KVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCR 193

Query: 196 LESTLEGHSDWVRDVAWSPTVLLRSY-LASVSQDRTCIIW-------TQDNEQGPWKKTL 247
           + + LEGH DWV+ +A+        Y L S SQDR   +W         D+E+   K TL
Sbjct: 194 VVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLTL 253

Query: 248 LKEEKF 253
           L  +++
Sbjct: 254 LSNKQY 259

 Score = 33.5 bits (75), Expect = 0.42,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 183 KIWKYNSDAQTYV---LESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNE 239
           K +K+  D +  V    E+ + GH DW+  + W  +   R  L + + D + ++W  D  
Sbjct: 257 KQYKFQIDDELRVGINFEALIMGHDDWISSLQWHES---RLQLLAATADTSLMVWEPDET 313

Query: 240 QGPW 243
            G W
Sbjct: 314 SGIW 317

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 21  GKRLATCSSDKTIKIFE--VEGETHKL-IDTLTGHEGPVWRVDWAHPKFGTILASCSYDG 77
           GK L +   D+   ++E  +E  T +L       H   +W  DWA  +FG +  + S D 
Sbjct: 618 GKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASRDK 677

Query: 78  KVLIWKEE 85
            V +W+ +
Sbjct: 678 TVKVWRHQ 685
>4XFV:1:A|pdbid|entity|chain(s)|sequence
          Length = 792

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 221 YLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWS--LSGNVLALSGGDNKV 278
           +L SV +DR   +W ++ E   ++     E+    ++W A W+    GNV   +  D  V
Sbjct: 624 FLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASRDKTV 683

Query: 279 TLWKENLE 286
            +W+   E
Sbjct: 684 KVWRHQKE 691

 Score = 34.3 bits (77), Expect = 0.24,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 99/246 (40%), Gaps = 27/246 (10%)

Query: 22  KRLATCSSDKTIKIFE-VEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           K++    + KTI +++ +E     +  TL GHE  V  V +        + S S D  V 
Sbjct: 31  KKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDS--DFMVSASEDHHVK 88

Query: 81  IWKEENGRWSQIXXXXXXXXXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPII 140
           IWK  +    Q                A      L+ V  +DG +S+  +++N       
Sbjct: 89  IWKFTDYSHLQCIQTIQHYSKTIV---ALSALPSLISVGCADGTISI--WRQNIQNDEFG 143

Query: 141 IDAHAIGVNSASWAPATIEEDGEHNGTKESRKFV--TGGADNLVKIWKY---NSDAQTYV 195
           + AH   +    + P  +          E +K++   GG +  V I  +   +S  +   
Sbjct: 144 L-AHEFTIKKGFFYPLCLSLS-----KVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCR 197

Query: 196 LESTLEGHSDWVRDVAWSPTVLLRSY-LASVSQDRTCIIW-------TQDNEQGPWKKTL 247
           + + LEGH DWV+ +A+        Y L S SQDR   +W         D+E+   K TL
Sbjct: 198 VVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLTL 257

Query: 248 LKEEKF 253
           L  +++
Sbjct: 258 LSNKQY 263

 Score = 33.5 bits (75), Expect = 0.42,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 183 KIWKYNSDAQTYV---LESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNE 239
           K +K+  D +  V    E+ + GH DW+  + W  +   R  L + + D + ++W  D  
Sbjct: 261 KQYKFQIDDELRVGINFEALIMGHDDWISSLQWHES---RLQLLAATADTSLMVWEPDET 317

Query: 240 QGPW 243
            G W
Sbjct: 318 SGIW 321

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 21  GKRLATCSSDKTIKIFE--VEGETHKL-IDTLTGHEGPVWRVDWAHPKFGTILASCSYDG 77
           GK L +   D+   ++E  +E  T +L       H   +W  DWA  +FG +  + S D 
Sbjct: 622 GKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASRDK 681

Query: 78  KVLIWKEE 85
            V +W+ +
Sbjct: 682 TVKVWRHQ 689
>4AOW:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 340

 Score = 35.0 bits (79), Expect = 0.16,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 26  EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 84

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 85  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 136

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 137 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 185

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 186 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 238

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 239 AMLWDLN-EGK 248
>4D6V:1:A|pdbid|entity|chain(s)|sequence
          Length = 314

 Score = 34.7 bits (78), Expect = 0.20,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 167 TKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVS 226
           + ++R+ V+   D  +K+W    + +  ++E   +GH++WV  V +SP   L   + S  
Sbjct: 114 SADNRQIVSASRDRSIKLWNTLGECKFDIVE---DGHTEWVSCVRFSPNPAL-PVIISAG 169

Query: 227 QDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLE 286
            D+T  +W   N +   K T      + + L   + S  G++ A  G D    LW  N E
Sbjct: 170 WDKTVKVWELSNCK--LKTTHHGHTGYLNTL---AVSPDGSLAASGGKDGITMLWDLN-E 223

Query: 287 GK 288
           GK
Sbjct: 224 GK 225
>3ODT:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 313

 Score = 34.7 bits (78), Expect = 0.21,   Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 8/86 (9%)

Query: 8   HNELI-HDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKF 66
           HN+++ H AV+D       +CS+D  IK+  V+  T  ++ T  GHE  V+ +    P  
Sbjct: 183 HNDVVRHLAVVD--DGHFISCSNDGLIKL--VDMHTGDVLRTYEGHESFVYCIKLL-PN- 236

Query: 67  GTILASCSYDGKVLIWKEENGRWSQI 92
           G I+ SC  D  V IW +ENG   Q+
Sbjct: 237 GDIV-SCGEDRTVRIWSKENGSLKQV 261
>5OA3:37:g|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 34.7 bits (78), Expect = 0.21,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5A2Q:35:g|pdbid|entity|chain(s)|sequence
          Length = 315

 Score = 34.7 bits (78), Expect = 0.21,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5GVA:1:A|pdbid|entity|chain(s)|sequence
          Length = 344

 Score = 34.7 bits (78), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 21  GKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL 80
           G ++A  SSD  +KI +V   + +   T  GH+ PV  + +  PK    LAS S DG V 
Sbjct: 120 GTKIAAGSSDFLVKIVDVMDSSQQ--KTFRGHDAPVLSLSF-DPK-DIFLASASCDGSVR 175

Query: 81  IWK 83
           +W+
Sbjct: 176 VWQ 178
>5VYC:9:g1,g2,g3,g4,g5,g6|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5T2C:78:AI|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZZ:84:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZY:82:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZX:84:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZW:84:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZV:84:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZU:83:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZT:84:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LZS:83:gg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5LKS:68:Sg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5FLX:34:g|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>5AJ0:82:Bg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4V6X:2:Ag|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4V5Z:9:Aa|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4UJE:37:Bg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4UJD:83:Cg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4UJC:83:Cg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4UG0:70:Sg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4KZZ:33:g|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4KZY:33:g|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4KZX:33:g|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4D61:34:g|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>4D5L:34:g|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>3J7R:83:Sg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
>3J7P:82:Sg|pdbid|entity|chain(s)|sequence
          Length = 317

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 31/251 (12%)

Query: 41  ETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQ-IXXXXXXX 99
           E   L  TL GH G V ++    P+F  ++ S S D  +++WK      +  I       
Sbjct: 3   EQMTLRGTLKGHNGWVTQIA-TTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRG 61

Query: 100 XXXXXXQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIE 159
                        G   L  S DG + + +     TT   +   H   V S ++      
Sbjct: 62  HSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV--GHTKDVLSVAF------ 113

Query: 160 EDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLR 219
                  + ++R+ V+G  D  +K+W      +  V +   E HS+WV  V +SP     
Sbjct: 114 -------SSDNRQIVSGSRDKTIKLWNTLGVCKYTVQD---ESHSEWVSCVRFSPNS-SN 162

Query: 220 SYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLS--GNVLALSGGDNK 277
             + S   D+   +W   N +       LK        +  + ++S  G++ A  G D +
Sbjct: 163 PIIVSCGWDKLVKVWNLANCK-------LKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

Query: 278 VTLWKENLEGK 288
             LW  N EGK
Sbjct: 216 AMLWDLN-EGK 225
  Database: pdb_polypeptide
    Posted date:  Sep 15, 2017  6:19 PM
  Number of letters in database: 49,994,932
  Number of sequences in database:  202,155
  
Lambda     K      H
   0.314    0.132    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 202155
Number of Hits to DB: 33,784,908
Number of extensions: 1439181
Number of successful extensions: 4934
Number of sequences better than 10.0: 476
Number of HSP's gapped: 4300
Number of HSP's successfully gapped: 1220
Length of query: 297
Length of database: 49,994,932
Length adjustment: 106
Effective length of query: 191
Effective length of database: 28,566,502
Effective search space: 5456201882
Effective search space used: 5456201882
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)