BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (1157 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3KFO:1:A|pdbid|entity|chain(s)|sequence                               520   e-147
4Q9T:1:A,B|pdbid|entity|chain(s)|sequence                             316   1e-85
5A9Q:4:3,C,L,U|pdbid|entity|chain(s)|sequence                          33   3.8  
3I4R:2:B|pdbid|entity|chain(s)|sequence                                32   6.6  
>3KFO:1:A|pdbid|entity|chain(s)|sequence
          Length = 288

 Score =  520 bits (1339), Expect = e-147,   Method: Composition-based stats.
 Identities = 277/277 (100%), Positives = 277/277 (100%)

Query: 881  KYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLD 940
            KYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLD
Sbjct: 4    KYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLD 63

Query: 941  INTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLS 1000
            INTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLS
Sbjct: 64   INTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLS 123

Query: 1001 DLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQH 1060
            DLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQH
Sbjct: 124  DLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQH 183

Query: 1061 IVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQV 1120
            IVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQV
Sbjct: 184  IVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQV 243

Query: 1121 ETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEY 1157
            ETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEY
Sbjct: 244  ETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEY 280
>4Q9T:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 459

 Score =  316 bits (810), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 193/454 (42%), Positives = 280/454 (61%), Gaps = 28/454 (6%)

Query: 49  LRLHSHFDNSKVFTENNRYIVKTLQTDYS-----SGFSND---DELNGYIDMQIGYGLVN 100
           L  ++ + N+K+ TE  +Y V  L TD S     +G +N        G +D  +   LVN
Sbjct: 3   LTSNNKYGNTKILTETEKYSVTKLSTDLSFLPGSNGNNNTIDTHHFEGLVDTALQKALVN 62

Query: 101 DHKKVYIWNIHSTQKDTPYITVPFRSDDNDEIAVAPRCILTFPATMDESPLAL------- 153
           D   +YIWN +S QKDTP   +    DD   ++  P C+ T   +   +  A        
Sbjct: 63  DLDHIYIWNYNSIQKDTPICKISLH-DDYSVLSSPPICLFTSSISSTNNDTANYNNNASG 121

Query: 154 NPNDQDETGGLIII--KGSKAIYYEDINSINNLNFKLSEKFSHELELPINSSGGEKCDLM 211
           N N      G+ II  K S+ +Y+EDI++INNL  KLS+  +H L+L +  +  E     
Sbjct: 122 NINSGKFNNGICIINKKNSQFLYFEDISTINNLYTKLSKSKAHVLDLKLKDN--ENITST 179

Query: 212 LNCEPAGIVLSTNMGRIFFITIRNSMGKPQLKLGKLLNKPFKLGIWSKIFNTNSSVVSLR 271
           +NCEP+GI+++T++GR+ FITI++S GKP+L+L + L KP +   + +  +++  ++SL+
Sbjct: 180 INCEPSGIIIATSLGRVLFITIKDSTGKPKLELKQQLIKP-QNSFFFRNLDSSKEIISLK 238

Query: 272 NGPILGKGTRLVYITTNKGIFQTWQLSATNSHPTKLIDVNIYEAILESLQDLYPFAHGTL 331
            GPI+GKG RL+YITT  G  Q WQLS  NS   K +++NIYE +L+SLQDLYPFAHGTL
Sbjct: 239 KGPIVGKGERLLYITTRGGSLQIWQLS-INSKSFKRLEINIYEHVLDSLQDLYPFAHGTL 297

Query: 332 KIWDSHPLQDESSQLFLSSIYDSSCNETYYILSTIIFDSSSNSFTIFSTYRLNT-FMESI 390
              DSHP+  ++S   L+    S+ NE YY++ T+I D  +NSF IFS Y+LNT F +S 
Sbjct: 298 AFLDSHPIYSDTSSAHLTLASISNGNEIYYLMITVILDEKTNSFQIFSIYKLNTYFTKST 357

Query: 391 TDTKFKPKIFIPQMENANDT--NEVTSILVMFPNAVVITQVNSKLDSSYSMRRKWEDIVS 448
            D   KP++FIP   NA D+  +   S+ V+F NAVV+TQ++SKLDSS+ +RRKWEDI+ 
Sbjct: 358 VDLNHKPQLFIP---NALDSIVSPTLSVYVLFNNAVVMTQISSKLDSSFPLRRKWEDIIR 414

Query: 449 LRNDIDIIGSGYDSKSLYVLTKQMGVLQFFVKEN 482
              D++IIGSGY + S+YV+ K MGVL+     N
Sbjct: 415 FNKDVEIIGSGYSTDSIYVICKDMGVLKIASHSN 448
>5A9Q:4:3,C,L,U|pdbid|entity|chain(s)|sequence
          Length = 1156

 Score = 32.7 bits (73), Expect = 3.8,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 804 IAEFYKDLSGLVQTLQTLDQNDSTTVSLYETFFNEFPKEFSFTLFEYLIKHKKLNDLIFR 863
           +AE Y D   LVQ  +  D  + + +  Y T F +  + FS  LF + ++  K   L+ +
Sbjct: 862 LAEKYCDFDILVQMCEQTD--NQSRLQRYMTQFAD--QNFSDFLFRWYLEKGKRGKLLSQ 917

Query: 864 FPQQHDVLIQFFQESAPKYGHVAWIQQILDGSYADAMNTL 903
              QH  L  F Q     + H++W+ +I       A  TL
Sbjct: 918 PISQHGQLANFLQ----AHEHLSWLHEINSQELEKAHATL 953
>3I4R:2:B|pdbid|entity|chain(s)|sequence
          Length = 644

 Score = 32.0 bits (71), Expect = 6.6,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 804 IAEFYKDLSGLVQTLQTLDQNDSTTVSLYETFFNEFPKEFSFTLFEYLIKHKKLNDLIFR 863
           +AE Y D   LVQ  +  D  + + +  Y T F +  + FS  LF + ++  K   L+ +
Sbjct: 350 LAEKYCDFDILVQMCEQTD--NQSRLQRYMTQFAD--QNFSDFLFRWYLEKGKRGKLLSQ 405

Query: 864 FPQQHDVLIQFFQESAPKYGHVAWIQQILDGSYADAMNTL 903
              QH  L  F Q     + H++W+ +I       A  TL
Sbjct: 406 PISQHGQLANFLQ----AHEHLSWLHEINSQELEKAHATL 441
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.318    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 112,792,404
Number of extensions: 4846460
Number of successful extensions: 12370
Number of sequences better than 10.0: 11
Number of HSP's gapped: 12731
Number of HSP's successfully gapped: 11
Length of query: 1157
Length of database: 50,680,114
Length adjustment: 118
Effective length of query: 1039
Effective length of database: 26,529,526
Effective search space: 27564177514
Effective search space used: 27564177514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)