BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (823 letters)

Database: pdb_polypeptide 
           202,155 sequences; 49,994,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1O6O:2:D,E,F|pdbid|entity|chain(s)|sequence                           119   2e-26
5CWS:3:C,I|pdbid|entity|chain(s)|sequence                              99   3e-20
5IJO:6:H,N,T,Z|pdbid|entity|chain(s)|sequence                          78   7e-14
5IJN:6:H,N,T,Z|pdbid|entity|chain(s)|sequence                          78   7e-14
5C3L:3:C|pdbid|entity|chain(s)|sequence                                69   4e-11
3T97:2:A,C|pdbid|entity|chain(s)|sequence                              45   4e-04
>1O6O:2:D,E,F|pdbid|entity|chain(s)|sequence
          Length = 119

 Score =  119 bits (299), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 497 TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKP 556
           TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKP
Sbjct: 5   TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKP 64

Query: 557 TGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 608
           TGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS
Sbjct: 65  TGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 116

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 63/102 (61%), Positives = 80/102 (78%)

Query: 327 KSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAKPD 386
           KSNE K  G++KPAFSFGAKP EK N+E SKPAFSFGAK++EKK+ D SK AFSFG+KP 
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 387 ENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQ 428
             +    +K A SFGAKPEE+K  ++SKPAF+FGA+ + +K+
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKK 107

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 64/114 (56%), Positives = 79/114 (69%)

Query: 289 KSDENKAGATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPA 348
           KS+E K   +SKPAFSFGAKP+EKK+D  SKPAFSFGAK+NE K+   +K AFSFG+KP 
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 349 EKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAKPDENKASATSKPAFSFGA 402
            K   + +K A SFGAK +E+K  D SKPAF+FGA+ D  K +  S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 80/114 (70%)

Query: 365 KSDEKKDGDASKPAFSFGAKPDENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSN 424
           KS+EKKD  +SKPAFSFGAKPDE K    SKPAFSFGAK  EKK+ + SK AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 425 EDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGA 478
             ++   AK A SFGAKP E+ +++TSKPAF+FGA+ D +K  + S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 79/114 (69%)

Query: 308 KPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSD 367
           K  EKKD  SSKPAFSFGAK +E K D  +KPAFSFGAK  EK  ++ SK AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 368 EKKDGDASKPAFSFGAKPDENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGA 421
            K++GD +K A SFGAKP+E K+S TSKPAF+FGA+ + +K    S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 75/114 (65%)

Query: 422 KSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAXXX 481
           KSNE K  G++KPAFSFGAKP EK N+E SKPAFSFGAK++EKK+ D SK AFSFG+   
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 482 XXXXXXXXXPAFSFGTKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGA 535
                     A SFG K  E+K S +SKPAF+FGA+ D +K  E S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 76/114 (66%)

Query: 346 KPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAKPDENKASATSKPAFSFGAKPE 405
           K  EK ++ +SKPAFSFGAK DEKK+ + SKPAFSFGAK +E K S  SK AFSFG+KP 
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 406 EKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGA 459
            K++ + +K A SFGAK  E K   T+KPAF+FGA+   +   E S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 55/111 (49%), Positives = 76/111 (68%)

Query: 441 KPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAXXXXXXXXXXXXPAFSFGTKSN 500
           K  EK ++ +SKPAFSFGAK DEKK+ + SKPAFSFGA             AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 501 EKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFS 551
            K++   +K A SFGAKP+E+K+ + SKPAF+FGA+ + +K+++ES +  S
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 116

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 69/114 (60%)

Query: 403 KPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSD 462
           K  EKKD  SSKPAFSFGAK +E K D  +KPAFSFGAK  EK  ++ SK AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 463 EKKDGDASKPAFSFGAXXXXXXXXXXXXPAFSFGTKSNEKKDSGSSKPAFSFGA 516
            K++GD +K A SFGA            PAF+FG + + +K +  S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 55/102 (53%), Positives = 69/102 (67%)

Query: 282 PSFSFGAKSDENKAGATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAF 341
           P+FSFGAK DE K    SKPAFSFGAK  EKK+ + SK AFSFG+K    ++   AK A 
Sbjct: 18  PAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPTGKEEGDGAKAAI 77

Query: 342 SFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGA 383
           SFGAKP E+ +++TSKPAF+FGA+ D +K  + S    S  A
Sbjct: 78  SFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119
>5CWS:3:C,I|pdbid|entity|chain(s)|sequence
          Length = 208

 Score = 99.0 bits (245), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 98/174 (56%), Gaps = 4/174 (2%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           +D+++T+W   L +    F++   K+  WD++LV+ GE+I +LY+    AE + N+I++ 
Sbjct: 1   MDEIITRWATDLAKYQKEFKEQAAKVMEWDRLLVENGEKIQKLYTSTYEAERASNEIERQ 60

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAAANNNDQKRQQAYKTAQTLDEXXX 756
           L  +E QQ+EL  +LD +E + + L +  + +++G  A   DQ+R++ YK A+ L +   
Sbjct: 61  LSNVESQQEELTAWLDRYERELDELYAKQMGSAAGEQAAGPDQERERTYKLAEKLTDQLD 120

Query: 757 XXXXXXXXXIVEINNVSNTFNKTTXXXXXXXXXXXQLIKILNSHFDALRSLDDN 810
                    I EIN++SNT +K +           Q++++LN H   L+ +D N
Sbjct: 121 EMGKDLAKMIKEINDMSNTLSKGS----KPDDPLTQIVRVLNGHLAQLQWIDTN 170
>5IJO:6:H,N,T,Z|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 17/188 (9%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           L+ L+ KW+ +L +   HF Q   ++N+WD+ L++ GE+I+ L+ +    +  Q ++DQ 
Sbjct: 333 LESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQE 392

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAA-ANNNDQKRQQAYKTAQTLDEXX 755
           L +I  QQ ELE+ L   E        ++V   SG     + D++R++ YK A+ +D   
Sbjct: 393 LDFILSQQKELEDLLSPLE--------ELVKEQSGTIYLQHADEEREKTYKLAENIDAQL 444

Query: 756 XXXXXXXXXXIVEINNVSNTFNKTTXXXXXXXXXXXQLIKILNSHFDALRSLDDNSTSLE 815
                     I  +N        T+           Q+ KILN+H D+L+ +D NS  L+
Sbjct: 445 KRMAQDLKDIIEHLN--------TSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQ 496

Query: 816 KQINSIKK 823
           +++  + K
Sbjct: 497 RKVEEVTK 504
>5IJN:6:H,N,T,Z|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 17/188 (9%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           L+ L+ KW+ +L +   HF Q   ++N+WD+ L++ GE+I+ L+ +    +  Q ++DQ 
Sbjct: 333 LESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQE 392

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAA-ANNNDQKRQQAYKTAQTLDEXX 755
           L +I  QQ ELE+ L   E        ++V   SG     + D++R++ YK A+ +D   
Sbjct: 393 LDFILSQQKELEDLLSPLE--------ELVKEQSGTIYLQHADEEREKTYKLAENIDAQL 444

Query: 756 XXXXXXXXXXIVEINNVSNTFNKTTXXXXXXXXXXXQLIKILNSHFDALRSLDDNSTSLE 815
                     I  +N        T+           Q+ KILN+H D+L+ +D NS  L+
Sbjct: 445 KRMAQDLKDIIEHLN--------TSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQ 496

Query: 816 KQINSIKK 823
           +++  + K
Sbjct: 497 RKVEEVTK 504
>5C3L:3:C|pdbid|entity|chain(s)|sequence
          Length = 150

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 64/116 (55%), Gaps = 7/116 (6%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           L++L+ KW+ +L +   HF Q   ++N+WD+ L++ GE+I+ L+ +    +  Q ++DQ 
Sbjct: 20  LENLINKWSLELEDQEKHFLQQATQVNAWDRTLMQNGERITTLHREMEKVKLDQKRLDQE 79

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAAANNNDQKRQQAYKTAQTLD 752
           L +I  QQ ELE+ L   E         V   S      + D++R++ YK A+ +D
Sbjct: 80  LDFILSQQKELEDLLTPLE-------ESVKEQSGTIYLQHADEEREKTYKLAENID 128
>3T97:2:A,C|pdbid|entity|chain(s)|sequence
          Length = 64

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 663 NSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQSLQYIERQQDELENFLDNFE 715
           N+WD+ L++ GE+I+ L+ +    +  Q ++DQ L +I  QQ ELE+ L   E
Sbjct: 1   NAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLE 53
  Database: pdb_polypeptide
    Posted date:  Sep 15, 2017  6:19 PM
  Number of letters in database: 49,994,932
  Number of sequences in database:  202,155
  
Lambda     K      H
   0.303    0.121    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 202155
Number of Hits to DB: 67,163,136
Number of extensions: 2526479
Number of successful extensions: 3384
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3499
Number of HSP's successfully gapped: 52
Length of query: 823
Length of database: 49,994,932
Length adjustment: 115
Effective length of query: 708
Effective length of database: 26,747,107
Effective search space: 18936951756
Effective search space used: 18936951756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 69 (31.2 bits)