BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (823 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1O6O:2:D,E,F|pdbid|entity|chain(s)|sequence                           119   2e-26
5CWS:3:C,I|pdbid|entity|chain(s)|sequence                              99   3e-20
5OWU:2:B|pdbid|entity|chain(s)|sequence                                83   2e-15
5IJO:6:H,N,T,Z|pdbid|entity|chain(s)|sequence                          78   7e-14
5IJN:6:H,N,T,Z|pdbid|entity|chain(s)|sequence                          78   7e-14
5C3L:3:C|pdbid|entity|chain(s)|sequence                                69   4e-11
5H1X:1:A,B,C|pdbid|entity|chain(s)|sequence                            46   3e-04
3T97:2:A,C|pdbid|entity|chain(s)|sequence                              45   4e-04
>1O6O:2:D,E,F|pdbid|entity|chain(s)|sequence
          Length = 119

 Score =  119 bits (299), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 497 TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKP 556
           TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKP
Sbjct: 5   TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKP 64

Query: 557 TGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 608
           TGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS
Sbjct: 65  TGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 116

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 63/102 (61%), Positives = 80/102 (78%)

Query: 327 KSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAKPD 386
           KSNE K  G++KPAFSFGAKP EK N+E SKPAFSFGAK++EKK+ D SK AFSFG+KP 
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 387 ENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQ 428
             +    +K A SFGAKPEE+K  ++SKPAF+FGA+ + +K+
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKK 107

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 64/114 (56%), Positives = 79/114 (69%)

Query: 289 KSDENKAGATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPA 348
           KS+E K   +SKPAFSFGAKP+EKK+D  SKPAFSFGAK+NE K+   +K AFSFG+KP 
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 349 EKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAKPDENKASATSKPAFSFGA 402
            K   + +K A SFGAK +E+K  D SKPAF+FGA+ D  K +  S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 80/114 (70%)

Query: 365 KSDEKKDGDASKPAFSFGAKPDENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSN 424
           KS+EKKD  +SKPAFSFGAKPDE K    SKPAFSFGAK  EKK+ + SK AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 425 EDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGA 478
             ++   AK A SFGAKP E+ +++TSKPAF+FGA+ D +K  + S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 79/114 (69%)

Query: 308 KPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSD 367
           K  EKKD  SSKPAFSFGAK +E K D  +KPAFSFGAK  EK  ++ SK AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 368 EKKDGDASKPAFSFGAKPDENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGA 421
            K++GD +K A SFGAKP+E K+S TSKPAF+FGA+ + +K    S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 75/114 (65%)

Query: 422 KSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAXXX 481
           KSNE K  G++KPAFSFGAKP EK N+E SKPAFSFGAK++EKK+ D SK AFSFG+   
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 482 XXXXXXXXXPAFSFGTKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGA 535
                     A SFG K  E+K S +SKPAF+FGA+ D +K  E S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 76/114 (66%)

Query: 346 KPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAKPDENKASATSKPAFSFGAKPE 405
           K  EK ++ +SKPAFSFGAK DEKK+ + SKPAFSFGAK +E K S  SK AFSFG+KP 
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 406 EKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGA 459
            K++ + +K A SFGAK  E K   T+KPAF+FGA+   +   E S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 55/111 (49%), Positives = 76/111 (68%)

Query: 441 KPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAXXXXXXXXXXXXPAFSFGTKSN 500
           K  EK ++ +SKPAFSFGAK DEKK+ + SKPAFSFGA             AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 501 EKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFS 551
            K++   +K A SFGAKP+E+K+ + SKPAF+FGA+ + +K+++ES +  S
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 116

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 69/114 (60%)

Query: 403 KPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSD 462
           K  EKKD  SSKPAFSFGAK +E K D  +KPAFSFGAK  EK  ++ SK AFSFG+K  
Sbjct: 6   KSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPT 65

Query: 463 EKKDGDASKPAFSFGAXXXXXXXXXXXXPAFSFGTKSNEKKDSGSSKPAFSFGA 516
            K++GD +K A SFGA            PAF+FG + + +K +  S    S  A
Sbjct: 66  GKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 55/102 (53%), Positives = 69/102 (67%)

Query: 282 PSFSFGAKSDENKAGATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAF 341
           P+FSFGAK DE K    SKPAFSFGAK  EKK+ + SK AFSFG+K    ++   AK A 
Sbjct: 18  PAFSFGAKPDEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPTGKEEGDGAKAAI 77

Query: 342 SFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFSFGA 383
           SFGAKP E+ +++TSKPAF+FGA+ D +K  + S    S  A
Sbjct: 78  SFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKSMQA 119
>5CWS:3:C,I|pdbid|entity|chain(s)|sequence
          Length = 208

 Score = 99.0 bits (245), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 98/174 (56%), Gaps = 4/174 (2%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           +D+++T+W   L +    F++   K+  WD++LV+ GE+I +LY+    AE + N+I++ 
Sbjct: 1   MDEIITRWATDLAKYQKEFKEQAAKVMEWDRLLVENGEKIQKLYTSTYEAERASNEIERQ 60

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAAANNNDQKRQQAYKTAQTLDEXXX 756
           L  +E QQ+EL  +LD +E + + L +  + +++G  A   DQ+R++ YK A+ L +   
Sbjct: 61  LSNVESQQEELTAWLDRYERELDELYAKQMGSAAGEQAAGPDQERERTYKLAEKLTDQLD 120

Query: 757 XXXXXXXXXIVEINNVSNTFNKTTXXXXXXXXXXXQLIKILNSHFDALRSLDDN 810
                    I EIN++SNT +K +           Q++++LN H   L+ +D N
Sbjct: 121 EMGKDLAKMIKEINDMSNTLSKGS----KPDDPLTQIVRVLNGHLAQLQWIDTN 170
>5OWU:2:B|pdbid|entity|chain(s)|sequence
          Length = 1076

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 129/470 (27%), Positives = 183/470 (38%), Gaps = 57/470 (12%)

Query: 171 TANANKPAFSFGATTNDDKKTEPDKPAFSFNSSVGNKTDAQAPTTGFSFGSQLGGNKTVN 230
           TA A   +F+F    N  K  +   P+ +  +  G      + +  F FG     ++   
Sbjct: 376 TAEAPTLSFNFSQKANKTKAVDNTVPSTTLFNFGGKSDTVTSASQPFKFGKTSEKSENHT 435

Query: 231 EAAKPSLXXXXXXXXXXXXXXXQPEPTTNEPAKPALSFGXXXXXXXXXXXXPSFSFGAKS 290
           E+  P                       NEP +                  P F FG   
Sbjct: 436 ESDAPPKSTAPIFSFGKQEENGDEGDDENEPKRK-----RRLPVSEDTNTKPLFDFGKTG 490

Query: 291 D-------ENKAGATSKPAFSFGAKPEEKKDDNSSKPAFSFGAK--------SNEDKQDG 335
           D       E++  A+ KP+F FGA  ++ +      P F+FG K        S+     G
Sbjct: 491 DQKETKKGESEKDASGKPSFVFGASDKQAE----GTPLFTFGKKADVTSNIDSSAQFTFG 546

Query: 336 TAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDAS-KPAFSFGAKPDENKASATS 394
            A  A     KP+E       KP F+FG  + E K  + S KP FSF    +E K+S  S
Sbjct: 547 KAATAKETHTKPSETPATIVKKPTFTFGQSTSENKISEGSAKPTFSFSKSEEERKSSPIS 606

Query: 395 ----KPAFSFGAKP---EEKKDDNSSKPAFSFGAKSNEDKQ--DGTAKPAFSFGAKPAEK 445
               KP+FSF  KP   +   DD + KP FSF   + +D        KP+F+F +    +
Sbjct: 607 NEAAKPSFSFPGKPVDVQAPTDDKTLKPTFSFTEPAQKDSSVVSEPKKPSFTFASSKTSQ 666

Query: 446 NNNETSKPAFSFGAKSDEKKDGDASKPAFSFGAXXXXXXXXXXXXPAFSFGTKSNEKKDS 505
                 KP FSFG KSD  K+   S  +FSF              P+F+FG  +     +
Sbjct: 667 -----PKPLFSFG-KSDAAKEPPGSNTSFSFTKPPANETDKRPTPPSFTFGGSTTNNTTT 720

Query: 506 GSSKPAFSFGAKPDEKK-------NDEVSKPAFSFGAKANEKKESDESKSAFSFGSKPTG 558
            S+KP+FSFGA    K        N E     FSF    + K++S+   S F        
Sbjct: 721 TSTKPSFSFGAPESMKSTASTAAANTEKLSNGFSFTKFNHNKEKSNSPTSFF-------- 772

Query: 559 KEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDNEKKTEESSTGKS 608
             +G  +   I    KP +   + TSK AF+FG    N      +ST  S
Sbjct: 773 --DGSASSTPIPVLGKPTDATGNTTSKSAFSFGTANTNGTNASANSTSFS 820

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 101/336 (30%), Positives = 149/336 (44%), Gaps = 47/336 (13%)

Query: 255 EPTTNEPAKPALSFGXXXXXXXXXXXXPSFSFGAKSDENKAGATSKPAFSFG-------- 306
           E   +   KP+  FG            P F+FG K+D   +   S   F+FG        
Sbjct: 499 ESEKDASGKPSFVFGASDKQAEGT---PLFTFGKKADVT-SNIDSSAQFTFGKAATAKET 554

Query: 307 -AKPEEKKDDNSSKPAFSFGAKSNEDK-QDGTAKPAFSFGAKPAEKNN----NETSKPAF 360
             KP E       KP F+FG  ++E+K  +G+AKP FSF     E+ +    NE +KP+F
Sbjct: 555 HTKPSETPATIVKKPTFTFGQSTSENKISEGSAKPTFSFSKSEEERKSSPISNEAAKPSF 614

Query: 361 SFGAKSDEKK---DGDASKPAFSFG--AKPDENKASATSKPAFSFGAKPEEKKDDNSSKP 415
           SF  K  + +   D    KP FSF   A+ D +  S   KP+F+F +    +      KP
Sbjct: 615 SFPGKPVDVQAPTDDKTLKPTFSFTEPAQKDSSVVSEPKKPSFTFASSKTSQ-----PKP 669

Query: 416 AFSFGAKSNEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPAFS 475
            FSFG KS+  K+   +  +FSF   PA + +   + P+F+FG  +       ++KP+FS
Sbjct: 670 LFSFG-KSDAAKEPPGSNTSFSFTKPPANETDKRPTPPSFTFGGSTTNNTTTTSTKPSFS 728

Query: 476 FGAXXXXXXXXXXXXP-------AFSFGTKSNEKKDSGSSKPAFSFGA----------KP 518
           FGA                     FSF TK N  K+  +S  +F  G+          KP
Sbjct: 729 FGAPESMKSTASTAAANTEKLSNGFSF-TKFNHNKEKSNSPTSFFDGSASSTPIPVLGKP 787

Query: 519 DEKKNDEVSKPAFSFGAKANEKKESDESKSAFSFGS 554
            +   +  SK AFSFG        +  + ++FSF +
Sbjct: 788 TDATGNTTSKSAFSFGTANTNGTNASANSTSFSFNA 823

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 110/412 (26%), Positives = 161/412 (39%), Gaps = 63/412 (15%)

Query: 213 PTTGFSFGSQLGGNKTVNEAAKPSLXXXXXXXXXXXXXXXQPEPTTNEPAKPALSFGXXX 272
           PT GF F   +  N+T ++   P                 + + +T     P LSF    
Sbjct: 332 PTVGFDF---IKDNETPSKKTSPKATSSAGAVFKSSVEMGKTDKSTKTAEAPTLSFNFSQ 388

Query: 273 XXXXXXXXXPS------FSFGAKSDENKAGATSKPAFSFGAKPEEKKDDN-------SSK 319
                     +      F+FG KSD      ++   F FG   E+ ++         S+ 
Sbjct: 389 KANKTKAVDNTVPSTTLFNFGGKSD---TVTSASQPFKFGKTSEKSENHTESDAPPKSTA 445

Query: 320 PAFSFGAKS-NEDKQDGTAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPA 378
           P FSFG +  N D+ D   +P        +E  N   +KP F FG   D+K+        
Sbjct: 446 PIFSFGKQEENGDEGDDENEPKRKRRLPVSEDTN---TKPLFDFGKTGDQKE-------- 494

Query: 379 FSFGAKPDENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGAK--------SNEDKQDG 430
                K  E++  A+ KP+F FGA  ++ +      P F+FG K        S+     G
Sbjct: 495 ----TKKGESEKDASGKPSFVFGASDKQAE----GTPLFTFGKKADVTSNIDSSAQFTFG 546

Query: 431 TAKPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDAS-KPAFSFGAXXXXXXXX--- 486
            A  A     KP+E       KP F+FG  + E K  + S KP FSF             
Sbjct: 547 KAATAKETHTKPSETPATIVKKPTFTFGQSTSENKISEGSAKPTFSFSKSEEERKSSPIS 606

Query: 487 -XXXXPAFSFGTKSNEKK---DSGSSKPAFSFG--AKPDEKKNDEVSKPAFSFGAKANEK 540
                P+FSF  K  + +   D  + KP FSF   A+ D     E  KP+F+F +     
Sbjct: 607 NEAAKPSFSFPGKPVDVQAPTDDKTLKPTFSFTEPAQKDSSVVSEPKKPSFTFASS---- 662

Query: 541 KESDESKSAFSFGSKPTGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGA 592
            ++ + K  FSFG     KE   G+  + SF   P  +     + P+FTFG 
Sbjct: 663 -KTSQPKPLFSFGKSDAAKEP-PGSNTSFSFTKPPANETDKRPTPPSFTFGG 712

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 72/265 (27%), Positives = 108/265 (40%), Gaps = 24/265 (9%)

Query: 176 KPAFSFGATTNDDKKTEPD-KPAFSFNSSVGNKTDAQAPTTGFSFGSQLGGNKTVNEAAK 234
           KP F+FG +T+++K +E   KP FSF+ S   +  +              G     +   
Sbjct: 568 KPTFTFGQSTSENKISEGSAKPTFSFSKSEEERKSSPISNEAAKPSFSFPGKPV--DVQA 625

Query: 235 PSLXXXXXXXXXXXXXXXQPEPTTNEPAKPALSFGXXXXXXXXXXXXPSFSFGAKSDENK 294
           P+                +     +EP KP+ +F             P FSFG KSD  K
Sbjct: 626 PTDDKTLKPTFSFTEPAQKDSSVVSEPKKPSFTFASSKTSQPK----PLFSFG-KSDAAK 680

Query: 295 AGATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQDGTAKPAFSFGAKPAEKN--- 351
               S  +FSF   P  + D   + P+F+FG  +  +    + KP+FSFGA  + K+   
Sbjct: 681 EPPGSNTSFSFTKPPANETDKRPTPPSFTFGGSTTNNTTTTSTKPSFSFGAPESMKSTAS 740

Query: 352 ----NNETSKPAFSFGAKSDEKK---------DGDASKPAFSFGAKPDENKASATSKPAF 398
               N E     FSF   +  K+         DG AS        KP +   + TSK AF
Sbjct: 741 TAAANTEKLSNGFSFTKFNHNKEKSNSPTSFFDGSASSTPIPVLGKPTDATGNTTSKSAF 800

Query: 399 SFGAKPEEKKDDNSSKPAFSFGAKS 423
           SFG       + +++  +FSF A +
Sbjct: 801 SFGTANTNGTNASANSTSFSFNAPA 825

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 96/322 (29%), Positives = 141/322 (43%), Gaps = 48/322 (14%)

Query: 338 KPAFSFGAKPAEKNNNETSKPAFSFGAKSDEKKDGDASKPA---FSFGAKPDENKASATS 394
           K +   G         E    +F+F  K+++ K  D + P+   F+FG K D    ++ S
Sbjct: 362 KSSVEMGKTDKSTKTAEAPTLSFNFSQKANKTKAVDNTVPSTTLFNFGGKSD--TVTSAS 419

Query: 395 KPAFSFGAKPEEKKDDN-------SSKPAFSFGAK-SNEDKQDGTAKPAFSFGAKPAEKN 446
           +P F FG   E+ ++         S+ P FSFG +  N D+ D   +P        +E  
Sbjct: 420 QP-FKFGKTSEKSENHTESDAPPKSTAPIFSFGKQEENGDEGDDENEPKRKRRLPVSEDT 478

Query: 447 NNETSKPAFSFGAKSDEKK------DGDAS-KPAFSFGAXXXXXXXXXXXXPAFSFGTKS 499
           N   +KP F FG   D+K+      + DAS KP+F FGA            P F+FG K+
Sbjct: 479 N---TKPLFDFGKTGDQKETKKGESEKDASGKPSFVFGA----SDKQAEGTPLFTFGKKA 531

Query: 500 NEKKDSGSSKPAFSFG---------AKPDEKKNDEVSKPAFSFGAKANEKKESDES-KSA 549
           +   +  SS   F+FG          KP E     V KP F+FG   +E K S+ S K  
Sbjct: 532 DVTSNIDSSA-QFTFGKAATAKETHTKPSETPATIVKKPTFTFGQSTSENKISEGSAKPT 590

Query: 550 FSFGSKPTGKEEG----DGAKAAISFGAKPEEQKS---SDTSKPAFTFG--AQKDNEKKT 600
           FSF      ++      + AK + SF  KP + ++     T KP F+F   AQKD+   +
Sbjct: 591 FSFSKSEEERKSSPISNEAAKPSFSFPGKPVDVQAPTDDKTLKPTFSFTEPAQKDSSVVS 650

Query: 601 EESSTGKSTADVKSSDSLKLNS 622
           E      + A  K+S    L S
Sbjct: 651 EPKKPSFTFASSKTSQPKPLFS 672

 Score = 42.0 bits (97), Expect = 0.004,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 102/263 (38%), Gaps = 34/263 (12%)

Query: 372 GDASKPAFSFGAKPDENKASATSKPAFSFGAKPEEKKDDNSSKPAFSFGAKSNEDKQDGT 431
           G   K +   G      K +     +F+F  K  + K  +++ P+ +      +     +
Sbjct: 358 GAVFKSSVEMGKTDKSTKTAEAPTLSFNFSQKANKTKAVDNTVPSTTLFNFGGKSDTVTS 417

Query: 432 AKPAFSFGAKPAEKNNNET--------SKPAFSFGAKSDEKKDGDASKPAFSFGAXXXXX 483
           A   F FG K +EK+ N T        + P FSFG + +   +GD               
Sbjct: 418 ASQPFKFG-KTSEKSENHTESDAPPKSTAPIFSFGKQEENGDEGDDENEPKR--KRRLPV 474

Query: 484 XXXXXXXPAFSFG-------TKSNEKKDSGSSKPAFSFGAKPDEKKNDEVSKPAFSFGAK 536
                  P F FG       TK  E +   S KP+F FGA   + +      P F+FG K
Sbjct: 475 SEDTNTKPLFDFGKTGDQKETKKGESEKDASGKPSFVFGASDKQAE----GTPLFTFGKK 530

Query: 537 ANEKKESDESKSAFSFGSKPTGKEEGDGAKAAISFGAKPEEQKSSDTSKPAFTFGAQKDN 596
           A+     D S + F+FG   T KE             KP E  ++   KP FTFG Q  +
Sbjct: 531 ADVTSNIDSS-AQFTFGKAATAKET----------HTKPSETPATIVKKPTFTFG-QSTS 578

Query: 597 EKKTEESSTGKSTADVKSSDSLK 619
           E K  E S   + +  KS +  K
Sbjct: 579 ENKISEGSAKPTFSFSKSEEERK 601
>5IJO:6:H,N,T,Z|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 17/188 (9%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           L+ L+ KW+ +L +   HF Q   ++N+WD+ L++ GE+I+ L+ +    +  Q ++DQ 
Sbjct: 333 LESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQE 392

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAA-ANNNDQKRQQAYKTAQTLDEXX 755
           L +I  QQ ELE+ L   E        ++V   SG     + D++R++ YK A+ +D   
Sbjct: 393 LDFILSQQKELEDLLSPLE--------ELVKEQSGTIYLQHADEEREKTYKLAENIDAQL 444

Query: 756 XXXXXXXXXXIVEINNVSNTFNKTTXXXXXXXXXXXQLIKILNSHFDALRSLDDNSTSLE 815
                     I  +N        T+           Q+ KILN+H D+L+ +D NS  L+
Sbjct: 445 KRMAQDLKDIIEHLN--------TSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQ 496

Query: 816 KQINSIKK 823
           +++  + K
Sbjct: 497 RKVEEVTK 504
>5IJN:6:H,N,T,Z|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 17/188 (9%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           L+ L+ KW+ +L +   HF Q   ++N+WD+ L++ GE+I+ L+ +    +  Q ++DQ 
Sbjct: 333 LESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQE 392

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAA-ANNNDQKRQQAYKTAQTLDEXX 755
           L +I  QQ ELE+ L   E        ++V   SG     + D++R++ YK A+ +D   
Sbjct: 393 LDFILSQQKELEDLLSPLE--------ELVKEQSGTIYLQHADEEREKTYKLAENIDAQL 444

Query: 756 XXXXXXXXXXIVEINNVSNTFNKTTXXXXXXXXXXXQLIKILNSHFDALRSLDDNSTSLE 815
                     I  +N        T+           Q+ KILN+H D+L+ +D NS  L+
Sbjct: 445 KRMAQDLKDIIEHLN--------TSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQ 496

Query: 816 KQINSIKK 823
           +++  + K
Sbjct: 497 RKVEEVTK 504
>5C3L:3:C|pdbid|entity|chain(s)|sequence
          Length = 150

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 64/116 (55%), Gaps = 7/116 (6%)

Query: 637 LDDLVTKWTNQLTESASHFEQYTKKINSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQS 696
           L++L+ KW+ +L +   HF Q   ++N+WD+ L++ GE+I+ L+ +    +  Q ++DQ 
Sbjct: 20  LENLINKWSLELEDQEKHFLQQATQVNAWDRTLMQNGERITTLHREMEKVKLDQKRLDQE 79

Query: 697 LQYIERQQDELENFLDNFETKTEALLSDVVSTSSGAAANNNDQKRQQAYKTAQTLD 752
           L +I  QQ ELE+ L   E         V   S      + D++R++ YK A+ +D
Sbjct: 80  LDFILSQQKELEDLLTPLE-------ESVKEQSGTIYLQHADEEREKTYKLAENID 128
>5H1X:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 52

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 33/50 (66%)

Query: 662 INSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQSLQYIERQQDELENFL 711
           +N+WD+ L++ GE+I+ L+ +    +  Q ++DQ L +I  QQ ELE+ L
Sbjct: 1   MNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLL 50
>3T97:2:A,C|pdbid|entity|chain(s)|sequence
          Length = 64

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 663 NSWDQVLVKGGEQISQLYSDAVMAEHSQNKIDQSLQYIERQQDELENFLDNFE 715
           N+WD+ L++ GE+I+ L+ +    +  Q ++DQ L +I  QQ ELE+ L   E
Sbjct: 1   NAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLE 53
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.303    0.121    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 68,094,351
Number of extensions: 2563183
Number of successful extensions: 3548
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3576
Number of HSP's successfully gapped: 62
Length of query: 823
Length of database: 50,680,114
Length adjustment: 115
Effective length of query: 708
Effective length of database: 27,143,524
Effective search space: 19217614992
Effective search space used: 19217614992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 69 (31.2 bits)