BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (839 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2QX5:1:A,B|pdbid|entity|chain(s)|sequence                            1196   0.0  
2RFO:1:A,B|pdbid|entity|chain(s)|sequence                            1187   0.0  
5HB3:1:A,C|pdbid|entity|chain(s)|sequence                             329   1e-89
5HB2:1:C|pdbid|entity|chain(s)|sequence                               329   1e-89
5IJO:2:C,I,O,U|pdbid|entity|chain(s)|sequence                         180   7e-45
5IJN:2:C,I,O,U|pdbid|entity|chain(s)|sequence                         180   7e-45
5CWS:6:F,L|pdbid|entity|chain(s)|sequence                              36   0.33 
1VHN:1:A|pdbid|entity|chain(s)|sequence                                33   1.9  
4C82:1:A|pdbid|entity|chain(s)|sequence                                32   7.0  
4C81:1:A|pdbid|entity|chain(s)|sequence                                32   7.0  
>2QX5:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 661

 Score = 1196 bits (3094), Expect = 0.0,   Method: Composition-based stats.
 Identities = 627/654 (95%), Positives = 627/654 (95%)

Query: 186 GNKGNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSA 245
           GNKGNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSA
Sbjct: 8   GNKGNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSA 67

Query: 246 NGTRNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLATNVNKI 305
           NGTRNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLATNVNKI
Sbjct: 68  NGTRNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLATNVNKI 127

Query: 306 KSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVEQ 365
           KSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVEQ
Sbjct: 128 KSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVEQ 187

Query: 366 SFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKNI 425
           SFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKNI
Sbjct: 188 SFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKNI 247

Query: 426 PAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSNXXXXXXXXX 485
           PAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSN         
Sbjct: 248 PAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSNYYLQTLLLS 307

Query: 486 XXXXXAIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSF 545
                AIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSF
Sbjct: 308 GLYGLAIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSF 367

Query: 546 RYSDPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARIPGVIE 605
           RYSDPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARIPGVIE
Sbjct: 368 RYSDPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARIPGVIE 427

Query: 606 ERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNXXXXXXX 665
           ERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVN       
Sbjct: 428 ERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNSLLSDTL 487

Query: 666 XXXXXXQPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNISSIRE 725
                 QPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNISSIRE
Sbjct: 488 SASDLDQPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNISSIRE 547

Query: 726 LYFNKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNM 785
           LYFNKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNM
Sbjct: 548 LYFNKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNM 607

Query: 786 IHILNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL 839
           IHILNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL
Sbjct: 608 IHILNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL 661
>2RFO:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 651

 Score = 1187 bits (3072), Expect = 0.0,   Method: Composition-based stats.
 Identities = 624/651 (95%), Positives = 624/651 (95%)

Query: 189 GNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGT 248
           GNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGT
Sbjct: 1   GNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGT 60

Query: 249 RNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLATNVNKIKSF 308
           RNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLATNVNKIKSF
Sbjct: 61  RNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLATNVNKIKSF 120

Query: 309 IDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVEQSFL 368
           IDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVEQSFL
Sbjct: 121 IDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVEQSFL 180

Query: 369 TYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKNIPAV 428
           TYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKNIPAV
Sbjct: 181 TYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKNIPAV 240

Query: 429 TLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSNXXXXXXXXXXXX 488
           TLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSN            
Sbjct: 241 TLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSNYYLQTLLLSGLY 300

Query: 489 XXAIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSFRYS 548
             AIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSFRYS
Sbjct: 301 GLAIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSFRYS 360

Query: 549 DPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARIPGVIEERQ 608
           DPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARIPGVIEERQ
Sbjct: 361 DPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARIPGVIEERQ 420

Query: 609 PLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNXXXXXXXXXX 668
           PLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVN          
Sbjct: 421 PLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNSLLSDTLSAS 480

Query: 669 XXXQPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNISSIRELYF 728
              QPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNISSIRELYF
Sbjct: 481 DLDQPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNISSIRELYF 540

Query: 729 NKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNMIHI 788
           NKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNMIHI
Sbjct: 541 NKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNMIHI 600

Query: 789 LNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL 839
           LNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL
Sbjct: 601 LNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL 651
>5HB3:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 723

 Score =  329 bits (843), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 227/719 (31%), Positives = 354/719 (49%), Gaps = 91/719 (12%)

Query: 203 NENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGTRNAQLLESWKILES 262
           +++  LREK    A  + +FN++RQ    F I  +   + S +       ++E+++ +  
Sbjct: 1   SDDRFLREKQAKLAEKIREFNDARQRGTPFYICRDLADLESKSGDRHGPHIVEAYRAVME 60

Query: 263 M-----------------------KSKDINIVEVGKQ-------YLEQQFLQYTDNL--- 289
           M                        ++  N + + KQ       +LE+QF    ++L   
Sbjct: 61  MVGEHPDAGEAPRERQFAKMYLDPNTQSANALAMRKQILKGATTFLEKQFWNEVNSLIAK 120

Query: 290 YKKNMN-EGLATNVNKIKSFIDTKLKKADKSWKISN--LTVINGVPIWALIFYLLRAGLI 346
           Y ++ N  GL   V+KIK++I  +L+ A K+    N  L  ING  +WA++FYLLRAG +
Sbjct: 121 YPQDANLGGLPDVVSKIKAYI--RLRIARKTLVPDNVELQQINGEYVWAIVFYLLRAGFV 178

Query: 347 KEALQVLVENKANIKKVEQSFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDG-- 404
            EA Q +  N+A+ + ++++F  Y  +YASS++  L  +   +  +EYNQ I+++ +G  
Sbjct: 179 TEAAQYVNSNQAHFRAIDRTFSGYINSYASSEERRLKRQMQDRCMSEYNQRIRNAPEGSI 238

Query: 405 DPYRLAVYKLIGRCDLSRKNIPAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQN 464
           DP+R+A YK+IGRCDLS +++  +   + DW+W+   L +E D   +   E Y L + Q 
Sbjct: 239 DPFRMACYKIIGRCDLSNRSLDGLQTDVNDWIWLQFNLARETDRSLELAGESYGLAELQA 298

Query: 465 IIISYGPSRFSNXXXXXXX-----------XXXXXXXAIDYTYTFSEMDAVHLAIGLASL 513
            I   G   F                           AI Y Y FS +DAVH AI L   
Sbjct: 299 SIREIGLKHFPKTAAEDTNGSFGMFFYLQILAGMFEQAIAYLYPFSYVDAVHFAIALTYY 358

Query: 514 KLFK-IDSST---RLTKKPKRD---IRFANILANYTKSFRYSDPRVAVEYLVLITLNEGP 566
            L + +D+++    L     R    I F  +L  YT+ FR ++P  AV+YLVLI LN   
Sbjct: 359 GLLRPVDAASAGNELLSHNTRSMPQINFGRMLGYYTRDFRAANPAAAVDYLVLICLNADE 418

Query: 567 TDVE------LCHEALRELVLETKEFTVLLGKIGRDGARIPGVIEERQPLLHVRDEKEFL 620
                     LCHEALRELVLE++EF+ L+G I  DG RI GVIEER PL+ +  E +F+
Sbjct: 419 AAGGQQAQAALCHEALRELVLESREFSRLIGDIRPDGRRIRGVIEERGPLIALGQEDDFI 478

Query: 621 HTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNXXXXXXXXXXXXXQPL----VG 676
            TIT QAA  AD++GR  D++LLY LAE+YD V+++V+              P+    V 
Sbjct: 479 RTITLQAASFADDNGRTTDAVLLYHLAEDYDTVVSIVSRALSEAISLEIGEDPMRLIPVK 538

Query: 677 PD-DNSE-----------------TNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLL 718
           P   N+E                  +PV LA+ M  +Y  +    ++I   N+  C +LL
Sbjct: 539 PRVTNAEGQVEEAAPGSSLSLAAIDDPVELAKAMMGMYERDHMFWQKIREPNRVACSVLL 598

Query: 719 NISSIRELYFNKQWQETLSQMELLDLLPFS---DELSARKKAQDFSNLDDNIVKNIPNLL 775
            ++ I+ L    +W E L ++  LD+LP +   D  + R  A  F +L   +  N+PNLL
Sbjct: 599 QMADIKSLVEQGRWAECLDKIRALDILPLTARGDPGTIRSYAARFPSLAQPVAINVPNLL 658

Query: 776 IITLSCISNMIHILNESKY--QSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTL 832
           + T+ C       L   ++    ST    +D LK +    M Y   ++YR+P   +  L
Sbjct: 659 MWTVLCCMRQRERLAGGQFAGNESTARLMMDELKQMTVDLMAYTSQLRYRLPPHLHEAL 717
>5HB2:1:C|pdbid|entity|chain(s)|sequence
          Length = 723

 Score =  329 bits (843), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 227/719 (31%), Positives = 354/719 (49%), Gaps = 91/719 (12%)

Query: 203 NENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGTRNAQLLESWKILES 262
           +++  LREK    A  + +FN++RQ    F I  +   + S +       ++E+++ +  
Sbjct: 1   SDDRFLREKQAKLAEKIREFNDARQRGTPFYICRDLADLESKSGDRHGPHIVEAYRAVME 60

Query: 263 M-----------------------KSKDINIVEVGKQ-------YLEQQFLQYTDNL--- 289
           M                        ++  N + + KQ       +LE+QF    ++L   
Sbjct: 61  MVGEHPDAGEAPRERQFAKMYLDPNTQSANALAMRKQILKGATTFLEKQFWNEVNSLIAK 120

Query: 290 YKKNMN-EGLATNVNKIKSFIDTKLKKADKSWKISN--LTVINGVPIWALIFYLLRAGLI 346
           Y ++ N  GL   V+KIK++I  +L+ A K+    N  L  ING  +WA++FYLLRAG +
Sbjct: 121 YPQDANLGGLPDVVSKIKAYI--RLRIARKTLVPDNVELQQINGEYVWAIVFYLLRAGFV 178

Query: 347 KEALQVLVENKANIKKVEQSFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDG-- 404
            EA Q +  N+A+ + ++++F  Y  +YASS++  L  +   +  +EYNQ I+++ +G  
Sbjct: 179 TEAAQYVNSNQAHFRAIDRTFSGYINSYASSEERRLKRQMQDRCMSEYNQRIRNAPEGSI 238

Query: 405 DPYRLAVYKLIGRCDLSRKNIPAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQN 464
           DP+R+A YK+IGRCDLS +++  +   + DW+W+   L +E D   +   E Y L + Q 
Sbjct: 239 DPFRMACYKIIGRCDLSNRSLDGLQTDVNDWIWLQFNLARETDRSLELAGESYGLAELQA 298

Query: 465 IIISYGPSRFSNXXXXXXX-----------XXXXXXXAIDYTYTFSEMDAVHLAIGLASL 513
            I   G   F                           AI Y Y FS +DAVH AI L   
Sbjct: 299 SIREIGLKHFPKTAAEDTNGSFGMFFYLQILAGMFEQAIAYLYPFSYVDAVHFAIALTYY 358

Query: 514 KLFK-IDSST---RLTKKPKRD---IRFANILANYTKSFRYSDPRVAVEYLVLITLNEGP 566
            L + +D+++    L     R    I F  +L  YT+ FR ++P  AV+YLVLI LN   
Sbjct: 359 GLLRPVDAASAGNELLSHNTRSMPQINFGRMLGYYTRDFRAANPAAAVDYLVLICLNADE 418

Query: 567 TDVE------LCHEALRELVLETKEFTVLLGKIGRDGARIPGVIEERQPLLHVRDEKEFL 620
                     LCHEALRELVLE++EF+ L+G I  DG RI GVIEER PL+ +  E +F+
Sbjct: 419 AAGGQQAQAALCHEALRELVLESREFSRLIGDIRPDGRRIRGVIEERGPLIALGQEDDFI 478

Query: 621 HTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNXXXXXXXXXXXXXQPL----VG 676
            TIT QAA  AD++GR  D++LLY LAE+YD V+++V+              P+    V 
Sbjct: 479 RTITLQAASFADDNGRTTDAVLLYHLAEDYDTVVSIVSRALSEAISLEIGEDPMRLIPVK 538

Query: 677 PD-DNSE-----------------TNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLL 718
           P   N+E                  +PV LA+ M  +Y  +    ++I   N+  C +LL
Sbjct: 539 PRVTNAEGQVEEAAPGSSLSLAAIDDPVELAKAMMGMYERDHMFWQKIREPNRVACSVLL 598

Query: 719 NISSIRELYFNKQWQETLSQMELLDLLPFS---DELSARKKAQDFSNLDDNIVKNIPNLL 775
            ++ I+ L    +W E L ++  LD+LP +   D  + R  A  F +L   +  N+PNLL
Sbjct: 599 QMADIKSLVEQGRWAECLDKIRALDILPLTARGDPGTIRSYAARFPSLAQPVAINVPNLL 658

Query: 776 IITLSCISNMIHILNESKY--QSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTL 832
           + T+ C       L   ++    ST    +D LK +    M Y   ++YR+P   +  L
Sbjct: 659 MWTVLCCMRQRERLAGGQFAGNESTARLMMDELKQMTVDLMAYTSQLRYRLPPHLHEAL 717
>5IJO:2:C,I,O,U|pdbid|entity|chain(s)|sequence
          Length = 819

 Score =  180 bits (457), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 210/856 (24%), Positives = 370/856 (43%), Gaps = 105/856 (12%)

Query: 27  ESSDNLPSASSELGSIQVSINELRRRVFQLRSKNKASKDYTKAHYLLANSGLSFEDVDAF 86
           E    LP     L  IQ +   LR R     S+  A     KA  LL + GL    +   
Sbjct: 21  EGISELPHVERNLQEIQQAGERLRSRTLTRTSQETAD---VKASVLLGSRGLDISHISQR 77

Query: 87  IKDLQTNQFLEPNPPKIIESEELEFYIRTKKEENILMSIEQLLNGATKDFDNFINHNLNL 146
           ++ L      EP  P  ++  +++ +++ +K+  +L +IE+         + +   ++ +
Sbjct: 78  LESLSAATTFEPLEP--VKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLV 135

Query: 147 DWAQHKNEVMKNFGILIQDKKTVDHKKSISSLDPKLPSWGNKGNNILNSNESRLNVNENN 206
           +W Q K  ++    +L   +  +D  +   S    +   G  G + L++ E         
Sbjct: 136 EWEQVKQRILHT--LLASGEDALDFTQE--SEPSYISDVGPPGRSSLDNIEMA------- 184

Query: 207 ILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGTRNAQLLESWKILESMKS- 265
                   YAR ++ +N  +  NG+  +    + + +S     +  + + W +++ M   
Sbjct: 185 --------YARQIYIYN-EKIVNGH--LQPNLVDLCASVAELDDKSISDMWTMVKQMTDV 233

Query: 266 ---------KDINIVEVGKQ-------YLEQQFLQYT-----DNLYKKNMNEGLATNVNK 304
                    K+ + VEV  +       YLEQ +  YT      NL++  +  G+      
Sbjct: 234 LLTPATDALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLG-GVPGTYQL 292

Query: 305 IKSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVE 364
           ++SF++ KL       +      + G P+WALI+Y +R G +  A QV+  N+A  +  E
Sbjct: 293 VRSFLNIKLPAPLPGLQDGE---VEGHPVWALIYYCMRCGDLLAASQVV--NRAQHQLGE 347

Query: 365 QSFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKN 424
             F T+F+ Y +SKD  L      KL   Y + +++  + DPY+ AVY +IGRCD++  N
Sbjct: 348 --FKTWFQEYMNSKDRRLSPATENKLRLHYRRALRN--NTDPYKRAVYCIIGRCDVT-DN 402

Query: 425 IPAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIIS-YGPSRFSNXXX---- 479
              V    ED+LW+ L  +   D       +R +L  FQ  ++  YG S F+        
Sbjct: 403 QSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLY 462

Query: 480 -XXXXXXXXXXXAIDYTYTFSEM--DAVHLAIGLASLKLFKIDSSTR---LTKKPK---- 529
                       A+ + +    +   AVH+A+ L  LKL    S      L+ +P     
Sbjct: 463 FQVLFLTAQFEAAVAFLFRMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPC 522

Query: 530 -RDIRFANILANYTKSFRYSDPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTV 588
            R + F  +L  YT+ F  +DPR A++Y   +   +      +    + ELV+E++EF +
Sbjct: 523 LRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDM 582

Query: 589 LLGKIGRDGARIPGVIEERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAE 648
           +LGK+  DG+R PGVI++        D K     I  + A  A+  G   ++  LY LA+
Sbjct: 583 ILGKLENDGSRKPGVIDK-----FTSDTK----PIINKVASVAENKGLFEEAAKLYDLAK 633

Query: 649 EYDIVITLVNXXXXXXXXXXXXXQPLVGPDDNSETNPVLLARRMASI--YFDNAGISRQI 706
             D V+ L+N              P+V      ++N   L     SI   +   GIS   
Sbjct: 634 NADKVLELMN----------KLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANK 683

Query: 707 HVKNKEICMLLLNISSIRELYFNKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDN 766
            V +     LLL++ +  + Y +         +E L L+P + E S  ++   F N  D 
Sbjct: 684 FVDST--FYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQE-SVEERVAAFRNFSDE 740

Query: 767 IVKNIPNLLIITLSCISNMIHILNESKYQSSTKGQQI-----DSLKNVARQCMIYAGMIQ 821
           I  N+  +L+ T++ +      L  +   SS++ Q++       L++ AR  + +AGMI 
Sbjct: 741 IRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIP 800

Query: 822 YRMPRETYSTLINIDV 837
           YR   +T + L+ ++V
Sbjct: 801 YRTSGDTNARLVQMEV 816
>5IJN:2:C,I,O,U|pdbid|entity|chain(s)|sequence
          Length = 819

 Score =  180 bits (457), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 210/856 (24%), Positives = 370/856 (43%), Gaps = 105/856 (12%)

Query: 27  ESSDNLPSASSELGSIQVSINELRRRVFQLRSKNKASKDYTKAHYLLANSGLSFEDVDAF 86
           E    LP     L  IQ +   LR R     S+  A     KA  LL + GL    +   
Sbjct: 21  EGISELPHVERNLQEIQQAGERLRSRTLTRTSQETAD---VKASVLLGSRGLDISHISQR 77

Query: 87  IKDLQTNQFLEPNPPKIIESEELEFYIRTKKEENILMSIEQLLNGATKDFDNFINHNLNL 146
           ++ L      EP  P  ++  +++ +++ +K+  +L +IE+         + +   ++ +
Sbjct: 78  LESLSAATTFEPLEP--VKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLV 135

Query: 147 DWAQHKNEVMKNFGILIQDKKTVDHKKSISSLDPKLPSWGNKGNNILNSNESRLNVNENN 206
           +W Q K  ++    +L   +  +D  +   S    +   G  G + L++ E         
Sbjct: 136 EWEQVKQRILHT--LLASGEDALDFTQE--SEPSYISDVGPPGRSSLDNIEMA------- 184

Query: 207 ILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGTRNAQLLESWKILESMKS- 265
                   YAR ++ +N  +  NG+  +    + + +S     +  + + W +++ M   
Sbjct: 185 --------YARQIYIYN-EKIVNGH--LQPNLVDLCASVAELDDKSISDMWTMVKQMTDV 233

Query: 266 ---------KDINIVEVGKQ-------YLEQQFLQYT-----DNLYKKNMNEGLATNVNK 304
                    K+ + VEV  +       YLEQ +  YT      NL++  +  G+      
Sbjct: 234 LLTPATDALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLG-GVPGTYQL 292

Query: 305 IKSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANIKKVE 364
           ++SF++ KL       +      + G P+WALI+Y +R G +  A QV+  N+A  +  E
Sbjct: 293 VRSFLNIKLPAPLPGLQDGE---VEGHPVWALIYYCMRCGDLLAASQVV--NRAQHQLGE 347

Query: 365 QSFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDLSRKN 424
             F T+F+ Y +SKD  L      KL   Y + +++  + DPY+ AVY +IGRCD++  N
Sbjct: 348 --FKTWFQEYMNSKDRRLSPATENKLRLHYRRALRN--NTDPYKRAVYCIIGRCDVT-DN 402

Query: 425 IPAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIIS-YGPSRFSNXXX---- 479
              V    ED+LW+ L  +   D       +R +L  FQ  ++  YG S F+        
Sbjct: 403 QSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLY 462

Query: 480 -XXXXXXXXXXXAIDYTYTFSEM--DAVHLAIGLASLKLFKIDSSTR---LTKKPK---- 529
                       A+ + +    +   AVH+A+ L  LKL    S      L+ +P     
Sbjct: 463 FQVLFLTAQFEAAVAFLFRMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPC 522

Query: 530 -RDIRFANILANYTKSFRYSDPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTV 588
            R + F  +L  YT+ F  +DPR A++Y   +   +      +    + ELV+E++EF +
Sbjct: 523 LRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDM 582

Query: 589 LLGKIGRDGARIPGVIEERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAE 648
           +LGK+  DG+R PGVI++        D K     I  + A  A+  G   ++  LY LA+
Sbjct: 583 ILGKLENDGSRKPGVIDK-----FTSDTK----PIINKVASVAENKGLFEEAAKLYDLAK 633

Query: 649 EYDIVITLVNXXXXXXXXXXXXXQPLVGPDDNSETNPVLLARRMASI--YFDNAGISRQI 706
             D V+ L+N              P+V      ++N   L     SI   +   GIS   
Sbjct: 634 NADKVLELMN----------KLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANK 683

Query: 707 HVKNKEICMLLLNISSIRELYFNKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDN 766
            V +     LLL++ +  + Y +         +E L L+P + E S  ++   F N  D 
Sbjct: 684 FVDST--FYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQE-SVEERVAAFRNFSDE 740

Query: 767 IVKNIPNLLIITLSCISNMIHILNESKYQSSTKGQQI-----DSLKNVARQCMIYAGMIQ 821
           I  N+  +L+ T++ +      L  +   SS++ Q++       L++ AR  + +AGMI 
Sbjct: 741 IRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIP 800

Query: 822 YRMPRETYSTLINIDV 837
           YR   +T + L+ ++V
Sbjct: 801 YRTSGDTNARLVQMEV 816
>5CWS:6:F,L|pdbid|entity|chain(s)|sequence
          Length = 74

 Score = 35.8 bits (81), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 34 SASSELGSIQVSINELRRRVFQLRSKNKASKDYTKAHYLLANSGLSFEDVDAFIKDL 90
          +A  EL S+Q+ + +LR+R+ +L   +    +  KAHY LA SG+   D  A ++DL
Sbjct: 19 TALGELPSLQLGLADLRQRLRKLGPSSDRPIEPGKAHYFLAASGV---DPGAAVRDL 72
>1VHN:1:A|pdbid|entity|chain(s)|sequence
          Length = 318

 Score = 33.1 bits (74), Expect = 1.9,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 87  IKD-LQTNQFLEPNPPKIIESEE--LEFYIRTKKEENILMSIEQLLNGATKDFDN---FI 140
           IKD L++ ++ EP+  +I+ + E  LE  I+TK E   ++ + + L G TKD      F 
Sbjct: 226 IKDFLRSGKYSEPSREEILRTFERHLELLIKTKGERKAVVEMRKFLAGYTKDLKGARRFR 285

Query: 141 NHNLNLDWAQHKNEVMKNF 159
              + ++  Q   E+  NF
Sbjct: 286 EKVMKIEEVQILKEMFYNF 304
>4C82:1:A|pdbid|entity|chain(s)|sequence
          Length = 184

 Score = 31.6 bits (70), Expect = 7.0,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 755 KKAQDFSNLDDNIVKNIPNLLIITLSCISNMIHILNESKYQSSTKGQQIDSL 806
           KK  D  N+D N++  +P +  I  + I N+  +LN  + Q S KG+  + L
Sbjct: 111 KKNYDIGNVDINVIAQVPKISNIRKNIIKNISTVLNIDESQISVKGKTHEKL 162
>4C81:1:A|pdbid|entity|chain(s)|sequence
          Length = 184

 Score = 31.6 bits (70), Expect = 7.0,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 755 KKAQDFSNLDDNIVKNIPNLLIITLSCISNMIHILNESKYQSSTKGQQIDSL 806
           KK  D  N+D N++  +P +  I  + I N+  +LN  + Q S KG+  + L
Sbjct: 111 KKNYDIGNVDINVIAQVPKISNIRKNIIKNISTVLNIDESQISVKGKTHEKL 162
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.317    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 77,908,431
Number of extensions: 3129894
Number of successful extensions: 8174
Number of sequences better than 10.0: 41
Number of HSP's gapped: 8360
Number of HSP's successfully gapped: 43
Length of query: 839
Length of database: 50,680,114
Length adjustment: 115
Effective length of query: 724
Effective length of database: 27,143,524
Effective search space: 19651911376
Effective search space used: 19651911376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)