BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (1683 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

4IFQ:1:A|pdbid|entity|chain(s)|sequence                              1806   0.0  
5HB4:1:B|pdbid|entity|chain(s)|sequence                               197   2e-49
4KNH:1:A,B|pdbid|entity|chain(s)|sequence                             105   7e-22
5CWV:1:A,B|pdbid|entity|chain(s)|sequence                              53   4e-06
3LDP:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.37 
3LDO:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.37 
3LDN:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.37 
3LDL:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.37 
5F2R:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
5F1X:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
5F0X:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
5EY4:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
5EXW:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
5EX5:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
5EVZ:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.40 
3IUC:1:A,C|pdbid|entity|chain(s)|sequence                              37   0.42 
5E84:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence                      37   0.42 
6EOF:1:A|pdbid|entity|chain(s)|sequence                                36   0.55 
6EOE:1:A|pdbid|entity|chain(s)|sequence                                36   0.55 
6EOC:1:A|pdbid|entity|chain(s)|sequence                                36   0.55 
6EOB:1:A|pdbid|entity|chain(s)|sequence                                36   0.55 
5O4P:1:A,B|pdbid|entity|chain(s)|sequence                              36   0.55 
5IJO:3:D,P|pdbid|entity|chain(s)|sequence                              36   0.58 
5IJN:3:D,J,P,V|pdbid|entity|chain(s)|sequence                          36   0.58 
5IJO:7:J,V|pdbid|entity|chain(s)|sequence                              34   1.9  
4XQB:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
4XQA:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
4K6W:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
4K6V:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
4K6U:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
4K6T:1:A,B,C,E,F,G|pdbid|entity|chain(s)|sequence                      33   3.2  
3QND:1:A,B,C,E,F,G|pdbid|entity|chain(s)|sequence                      33   3.2  
3N0I:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
2WGU:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
2WGT:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
2WBW:1:A|pdbid|entity|chain(s)|sequence                                33   3.2  
2J12:1:A|pdbid|entity|chain(s)|sequence                                33   3.2  
1UXE:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
1UXA:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
1UXB:1:A,B,C|pdbid|entity|chain(s)|sequence                            32   9.2  
>4IFQ:1:A|pdbid|entity|chain(s)|sequence
          Length = 970

 Score = 1806 bits (4677), Expect = 0.0,   Method: Composition-based stats.
 Identities = 932/961 (96%), Positives = 934/961 (97%)

Query: 1   MKWSAIPFQTLYRSIESGEFDFDLFKEVLPXXXXXXXXXXXXXXXASRSQLEKGEIELSD 60
           +KWSAIPFQTLYRSIESGEFDFDLFKEVLP               ASRSQLEKGEIELSD
Sbjct: 3   LKWSAIPFQTLYRSIESGEFDFDLFKEVLPDLQNLNLNTDKLKNNASRSQLEKGEIELSD 62

Query: 61  GSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTANNGKVQYFLRRQYILQIVSFI 120
           GSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTANNGKVQYFLRRQYILQIVSFI
Sbjct: 63  GSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTANNGKVQYFLRRQYILQIVSFI 122

Query: 121 VNCFHEDTELYQELIKNGALVSNILSAFKFIHTQLSEIKQQINKAQILENYNALFQQNIK 180
           VNCFHEDTELYQELIKNGALVSNILSAFKFIHTQLSEIKQQINKAQILENYNALFQQNIK
Sbjct: 123 VNCFHEDTELYQELIKNGALVSNILSAFKFIHTQLSEIKQQINKAQILENYNALFQQNIK 182

Query: 181 FRRDFLLREYDILSQILYGLVDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHL 240
           FRRDFLLREYDILSQILYGLVDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHL
Sbjct: 183 FRRDFLLREYDILSQILYGLVDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHL 242

Query: 241 FASLRVLPDADVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTM 300
           FASLRVLPDADVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTM
Sbjct: 243 FASLRVLPDADVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTM 302

Query: 301 DFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLERHIPRLIPKQL 360
           DFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLERHIPRLIPKQL
Sbjct: 303 DFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLERHIPRLIPKQL 362

Query: 361 LDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMSTTGTARLNSMPNNVNEYSYTT 420
           LDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMSTTGTARLNSMPNNVNEYSYTT
Sbjct: 363 LDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMSTTGTARLNSMPNNVNEYSYTT 422

Query: 421 IVLSDQTQEFFLSSFDDVLQTIITDCAFLLTKIKDAEEDSLLSGEDLTLDDISLKADLER 480
           IVLSDQTQEFFLSSFDDVLQTIITDCAFLLTKIKDAEEDSLLSGEDLTLDDISLKADLER
Sbjct: 423 IVLSDQTQEFFLSSFDDVLQTIITDCAFLLTKIKDAEEDSLLSGEDLTLDDISLKADLER 482

Query: 481 FFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENA 540
           FFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENA
Sbjct: 483 FFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENA 542

Query: 541 LNVYHYFGENSSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEG 600
           LNVYHYFGENSSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEG
Sbjct: 543 LNVYHYFGENSSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEG 602

Query: 601 LNEEAVIFXXXXXXXXXXXXYQVDEDVKSSLSKVFSDVLFEFTKINTPLVGAAFKVISNL 660
           LNEEAVIF            YQVDEDVKSSLSKVFSDVLFEFTKINTPLVGAAFKVISNL
Sbjct: 603 LNEEAVIFLSSLLTLVGSVTYQVDEDVKSSLSKVFSDVLFEFTKINTPLVGAAFKVISNL 662

Query: 661 VPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIH 720
           VPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIH
Sbjct: 663 VPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIH 722

Query: 721 SRENNSEYMVFGKLAFPTRLGQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPI 780
           SRENNSEYMVFGKLAFPTRLGQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPI
Sbjct: 723 SRENNSEYMVFGKLAFPTRLGQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPI 782

Query: 781 LKIIYTGLCSFDYSVILNSIPAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSI 840
           LKIIYTGLCSFDYSVILNSIPAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSI
Sbjct: 783 LKIIYTGLCSFDYSVILNSIPAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSI 842

Query: 841 FNVVDVGVDQLSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFL 900
           FNVVDVGVDQLSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFL
Sbjct: 843 FNVVDVGVDQLSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFL 902

Query: 901 PKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSERSNGSVASLS 960
           PKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSERSNGSVASLS
Sbjct: 903 PKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSERSNGSVASLS 962

Query: 961 K 961
           +
Sbjct: 963 E 963
>5HB4:1:B|pdbid|entity|chain(s)|sequence
          Length = 1596

 Score =  197 bits (500), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 280/1278 (21%), Positives = 519/1278 (40%), Gaps = 171/1278 (13%)

Query: 477  DLERFFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFG 536
            DLERF + I + Y  RP+ + +FW D +SN  GF++W SR     + S F  M+  L+  
Sbjct: 303  DLERFLIIISYAYEGRPDAAMSFWEDPDSNLAGFLQWASRRASTPLVSAFCEMLRCLADN 362

Query: 537  PENALNVYHYF-----------GENSSISWKNIAQCLSDYTKKISNF-----NSSLHKRQ 580
             E A   +++              + S++W  I + L  +T K+ +       +S+H+  
Sbjct: 363  EECATAAHNFLLDEGHQASGKMKRSQSLTWSQIFKELEYFTTKVCSERPNPPQASMHRPG 422

Query: 581  QFSESTHNDIDSTAVALEEGLNEEAVIFXXXXXXXXXXXXYQVDEDVKSSLSKVFSDVLF 640
            +           +A+ LE  L    +I               +DED          D + 
Sbjct: 423  RPGADPAEIEPESALMLECYLR---LIAKLATESEIARKRLIMDEDFN------LVDTIL 473

Query: 641  EFTKINTP--LVGAAFKVISNL-VPKLESSRTKFWSFLDSLIFKD-SSLNYSS------- 689
            + +    P  L    F V+  L + K        W ++++ +    SSL  S        
Sbjct: 474  KLSVGVIPHRLRACIFYVLKALMIRKTHEELDAMWRWVEAWMTNPFSSLPGSQGAPQRIS 533

Query: 690  ---------ESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEYMVFGKLAFPTRL 740
                     E     F    T +     F+QL   L+      N+    +   + FP  L
Sbjct: 534  FLGQTPGPQECMEMMFREFGTGFEQSNAFIQLLTTLLVPPEGLNS----LNDSVPFPEWL 589

Query: 741  GQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPILKIIYTGLCSFDYSVILNSI 800
            G   R +GI PY D++F+        I D    R ++L  L  +   L +F+  +I+   
Sbjct: 590  GSSIRTLGIEPYVDFVFDVFANRTKDISDPSQLRILRLSCLDFVMVCLVTFNEDLIVLGH 649

Query: 801  PAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSIFNVVDVGVDQLSIELEGGKN 860
             +  ++D  +   N   YV+  P   +  ++F EK+  S+ N     + Q  I L     
Sbjct: 650  ESNISIDDAMAATNLATYVRLHPFSRVMEWLFNEKVITSLINT----IHQDPISLGSASP 705

Query: 861  QAEL---LQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFLPKNYSLHGLRSFYDAIF 917
             + L   +  A++++ K L+ QETY+  + P V ++        K  +     +F D I 
Sbjct: 706  DSPLVVSILRAIQVMIKALELQETYLHLVRPEVLRYQGEAGVRRKPVANAAYSAFEDGIL 765

Query: 918  FNIPLVAHLGLYVGVDDQILATNSLRILAKLSERS------NGSVASLSKRNKLLTIFDS 971
             ++ LV  LG Y  +    L    L++L K+S  S      +     L  RNK +   + 
Sbjct: 766  SHLSLVVDLGKYCNLGHAELTLACLKLLEKISTSSRILSAWSPDSGRLGHRNKAIVQLER 825

Query: 972  VDE----SARIKDAFITQLESSITDAGV-LALKLELLDFLTSNLSNYSRTMTISHLLLGF 1026
              E    SA +  + +  L+ ++  +G    +KL +LDFL + L       TI+H LLGF
Sbjct: 826  NGEGETISASLSASIMATLDPALAASGENYRVKLAILDFLYACLRATPDQPTIAHQLLGF 885

Query: 1027 QVSNVISLGPNLATFISSGTSLLDSLISVLEASLNSITKDNIDYAPMRLATAALEIILKL 1086
                +  LG           SL  SL++VL     S  +  +    + L    L I+  L
Sbjct: 886  HCE-LSKLGIEPKGPFDMQKSLFHSLLNVLITLTVSEEEQGMRGYLVTLKYRVLRILQLL 944

Query: 1087 CRNPLTSGLLYSYLIKENFFERIMILDPQVTRFTTWNGSPFDNSTEEKCKNFIESESVGA 1146
             ++PL++ L+   L   NF   +++ + Q+     W+G          C+ F+ S++  A
Sbjct: 945  WKSPLSASLVMDELRATNFLFHMLLREVQIQPQLPWDGQLVTG-----CE-FLLSDASLA 998

Query: 1147 FLSFLAYRNYWTQYLGLFIHKIS---FSGTKSEVLTYVNYLI----SNTMYSVRLFSFLD 1199
            ++ +LA R    +Y+G  +  +S       K ++   +N  I       +    +F F D
Sbjct: 999  YIDYLASRAAIFEYIGKELCSVSQNRIPSIKRQIFDALNGQIFVDEEAPLTIPSIFDFFD 1058

Query: 1200 PLNYGNICEPKETLSIFTNVPLNLEQVTLNKYCSGNIYDFHKMENLMRLIKRVRAESLHS 1259
             +N     E   +        L+L    L    +G  YD  K + ++ L    R E  HS
Sbjct: 1059 FINTDYKWEEIPSPHFTYLKDLDLGPCILEHKYAGVHYDIRKAQEILAL---KRKEYEHS 1115

Query: 1260 NSFSLTVSKEQFLKDADVECIKAKSHFTNIISRNKA---LELNLSVLHSWVQLVQIIVTD 1316
                  ++  +FL+  ++E    K     +  RN+A   L   L++L +W  L+ +++  
Sbjct: 1116 Q-----LATPEFLETVELE---EKVLIEWLTVRNRANLLLTARLNLLQAWANLLLVMIES 1167

Query: 1317 GKLEPSTRSNFILEVFGTIIPKISDYIEFNITFSEELVSLA-VFLFDI-------YNRDR 1368
               + + +  F+L+    I+P +  +       + EL  +A V L+ +          DR
Sbjct: 1168 NDFKSTPKMAFLLQALQAILPTLEAFSSLKSDEAFELARVAKVLLWKLDFSQDSDAGLDR 1227

Query: 1369 KLITDKGTVDGRLYQLFKTCIQGINSPLSSVALRSDFYILANHYLSRVL----------- 1417
            +  T    +  +L+QLF+ C+  I+    +  LRS +Y +   YL+ V+           
Sbjct: 1228 EQFTVGNLIGDKLFQLFQLCLSAISQCSGTPELRSLYYSICYRYLTAVVDNDATVAATPA 1287

Query: 1418 SDQVG--------SEKVLQDLRLGSKKLVEIIWNDVVYGEGTSRVTGILLLDSLIQLANR 1469
            S  +G          + L+ + L   +L+ +I +D    + T +   ++LL++L+  +  
Sbjct: 1288 SSTIGPTRSVTNARARTLKAITLYGDRLLNVICDDAYGSDTTCQTAAMILLNALVHTSRA 1347

Query: 1470 SK---------ENFILDSLMKTTRLLLIIRSLKNTDALLNSTTEHINIDDLLYELTA--- 1517
            S          +  I+D+L +   + +++ SLK    +LN      +  D      A   
Sbjct: 1348 SSAAGVSPADVDCPIIDALNRLNFIGVLVDSLKE---ILNEWLAPSSTFDPSLSTNASPS 1404

Query: 1518 -----------FKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVDPDLGLDLMFD 1566
                         A +  L+++ +TR GA  +++ NLFR + +      DP+L       
Sbjct: 1405 LPIPASPSQQYTSAKLALLLQLCQTRQGAKYVLQANLFRALEQSGVFAADPEL------- 1457

Query: 1567 EVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLVSMGSSNKAVVQTV 1626
                     ++V+     P +V  + +    + L+V + +++ A + + G+ N  +VQ  
Sbjct: 1458 ---------VEVDSESGVPRVVALERH----YALLVALARVVGAAVTARGAHN--IVQGR 1502

Query: 1627 KGLLNTYKRLVIGIFKRD 1644
            K  L  ++ LV+ + K++
Sbjct: 1503 K-FLTQHRGLVVHVLKKN 1519
>4KNH:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 961

 Score =  105 bits (262), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 117/512 (22%), Positives = 203/512 (39%), Gaps = 56/512 (10%)

Query: 477 DLERFFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFG 536
           DLERF + I + Y  RP+ + +FW D +SN  GF++W SR     + S F  M+  L+  
Sbjct: 466 DLERFLIIISYAYEGRPDAAMSFWEDPDSNLAGFLQWASRRASTPLVSAFCEMLRCLADN 525

Query: 537 PENALNVYHYF-----------GENSSISWKNIAQCLSDYTKKISNF-----NSSLHKRQ 580
            E A   +++              + S++W  I + L  +T K+ +       +S+H+  
Sbjct: 526 EECATAAHNFLLDEGHQASGKMKRSQSLTWSQIFKELEYFTTKVCSERPNPPQASMHRPG 585

Query: 581 QFSESTHNDIDSTAVALEEGLNEEAVIFXXXXXXXXXXXXYQVDEDVKSSLSKVFSDVLF 640
           +           +A+ LE  L    +I               +DED          D + 
Sbjct: 586 RPGADPAEIEPESALMLECYLR---LIAKLATESEIARKRLIMDEDFN------LVDTIL 636

Query: 641 EFTKINTP--LVGAAFKVISNL-VPKLESSRTKFWSFLDSLIFKD-SSLNYSS------- 689
           + +    P  L    F V+  L + K        W ++++ +    SSL  S        
Sbjct: 637 KLSVGVIPHRLRACIFYVLKALMIRKTHEELDAMWRWVEAWMTNPFSSLPGSQGAPQRIS 696

Query: 690 ---------ESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEYMVFGKLAFPTRL 740
                    E     F    T +     F+QL   L+      N+    +   + FP  L
Sbjct: 697 FLGQTPGPQECMEMMFREFGTGFEQSNAFIQLLTTLLVPPEGLNS----LNDSVPFPEWL 752

Query: 741 GQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPILKIIYTGLCSFDYSVILNSI 800
           G   R +GI PY D++F+        I D    R ++L  L  +   L +F+  +I+   
Sbjct: 753 GSSIRTLGIEPYVDFVFDVFANRTKDISDPSQLRILRLSCLDFVMVCLVTFNEDLIVLGH 812

Query: 801 PAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSIFNVVDVGVDQLSIELEGGKN 860
            +  ++D  +   N   YV+  P   +  ++F EK+  S+ N     + Q  I L     
Sbjct: 813 ESNISIDDAMAATNLATYVRLHPFSRVMEWLFNEKVITSLINT----IHQDPISLGSASP 868

Query: 861 QAEL---LQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFLPKNYSLHGLRSFYDAIF 917
            + L   +  A++++ K L+ QETY+  + P V ++        K  +     +F D I 
Sbjct: 869 DSPLVVSILRAIQVMIKALELQETYLHLVRPEVLRYQGEAGVRRKPVANAAYSAFEDGIL 928

Query: 918 FNIPLVAHLGLYVGVDDQILATNSLRILAKLS 949
            ++ LV  LG Y  +    L    L++L K+S
Sbjct: 929 SHLSLVVDLGKYCNLGHAELTLACLKLLEKIS 960
>5CWV:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 364

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 63/307 (20%), Positives = 132/307 (42%), Gaps = 68/307 (22%)

Query: 1380 RLYQLFKTCIQGINSPLSSVALRSDFYILANHYLSRVL-----------SDQVGSEKVLQ 1428
            +L+QLF+ C+  I+    +  LRS +Y +   YL+ V+           S  +G  + + 
Sbjct: 7    KLFQLFQLCLSAISQCSGTPELRSLYYSICYRYLTAVVDNDATVAATPASSTIGPTRSVT 66

Query: 1429 DLR--------LGSKKLVEIIWNDVVYGEGTSRVTGILLLDSLIQLANRSK--------- 1471
            + R        L   +L+ +I +D    + T +   ++LL++L+  +  S          
Sbjct: 67   NARARTLKAITLYGDRLLNVICDDAYGSDTTCQTAAMILLNALVHTSRASSAAGVSPADV 126

Query: 1472 ENFILDSLMKTTRLLLIIRSLKNTDALLNSTTEHINIDDLLYELTA-------------- 1517
            +  I+D+L +   + +++ SLK    +LN      +  D      A              
Sbjct: 127  DCPIIDALNRLNFIGVLVDSLKE---ILNEWLAPSSTFDPSLSTNASPSLPIPASPSQQY 183

Query: 1518 FKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVDPDLGLDLMFDEVYVQNSKFLK 1577
              A +  L+++ +TR GA  +++ NLFR + +      DP+L                ++
Sbjct: 184  TSAKLALLLQLCQTRQGAKYVLQANLFRALEQSGVFAADPEL----------------VE 227

Query: 1578 VNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLVSMGSSNKAVVQTVKGLLNTYKRLV 1637
            V+     P +V  + +    + L+V + +++ A + + G+ N  +VQ  K  L  ++ LV
Sbjct: 228  VDSESGVPRVVALERH----YALLVALARVVGAAVTARGAHN--IVQGRK-FLTQHRGLV 280

Query: 1638 IGIFKRD 1644
            + + K++
Sbjct: 281  VHVLKKN 287
>3LDP:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 384

 Score = 36.6 bits (83), Expect = 0.37,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 227  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 286

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 287  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 346

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 347  KIQQLVK 353
>3LDO:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 384

 Score = 36.6 bits (83), Expect = 0.37,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 227  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 286

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 287  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 346

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 347  KIQQLVK 353
>3LDN:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 384

 Score = 36.6 bits (83), Expect = 0.37,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 227  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 286

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 287  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 346

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 347  KIQQLVK 353
>3LDL:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 384

 Score = 36.6 bits (83), Expect = 0.37,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 227  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 286

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 287  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 346

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 347  KIQQLVK 353
>5F2R:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>5F1X:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>5F0X:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>5EY4:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>5EXW:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>5EX5:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>5EVZ:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 400

 Score = 36.6 bits (83), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 243  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 302

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 303  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 362

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 363  KIQQLVK 369
>3IUC:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 408

 Score = 36.6 bits (83), Expect = 0.42,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 248  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 307

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 308  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 367

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 368  KIQQLVK 374
>5E84:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence
          Length = 606

 Score = 36.6 bits (83), Expect = 0.42,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 227  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 286

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 287  ESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 346

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 347  KIQQLVK 353
>6EOF:1:A|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 36.2 bits (82), Expect = 0.55,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 223  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 282

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 283  ESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 342

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 343  KIQQLVK 349
>6EOE:1:A|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 36.2 bits (82), Expect = 0.55,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 223  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 282

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 283  ESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 342

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 343  KIQQLVK 349
>6EOC:1:A|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 36.2 bits (82), Expect = 0.55,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 223  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 282

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 283  ESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 342

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 343  KIQQLVK 349
>6EOB:1:A|pdbid|entity|chain(s)|sequence
          Length = 522

 Score = 36.2 bits (82), Expect = 0.55,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 223  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 282

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 283  ESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 342

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 343  KIQQLVK 349
>5O4P:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 523

 Score = 36.2 bits (82), Expect = 0.55,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 1229 NKYCSGNIYDFHKMENLMRLIKR-----VRAESLHSNSFSLTVSK------EQFLKDADV 1277
            + +  G  +D   ME+ ++L K+     VR ++         V K       Q     ++
Sbjct: 224  DTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEI 283

Query: 1278 ECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIP 1337
            E       F+  ++R K  ELN+ +  S ++ VQ ++ D  L+ S     +L    T IP
Sbjct: 284  ESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP 343

Query: 1338 KISDYIE 1344
            KI   ++
Sbjct: 344  KIQQLVK 350
>5IJO:3:D,P|pdbid|entity|chain(s)|sequence
          Length = 2012

 Score = 36.2 bits (82), Expect = 0.58,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 82/196 (41%), Gaps = 22/196 (11%)

Query: 1437 LVEIIWNDVVYGEGTSRVTGILLLDSLIQLANRSKENFILDSLMKTTRLLLIIRSLKNTD 1496
            L+E++  D   G    R+  + LLD ++ +    K+   L  L  +  L +++ SL   D
Sbjct: 1477 LMEVVCRDACDGHEIGRMLALALLDRIVSV---DKQQQWLLYLSNSGYLKVLVDSLVEDD 1533

Query: 1497 ALLNSTTEHINIDDLLYELTAFKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVD 1556
              L S         LL  L  +++ + FL RVA+ + GA  L+ + +   +A+     + 
Sbjct: 1534 RTLQSLL--TPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMR 1591

Query: 1557 PDLGLDLMFDEVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLV-SM 1615
            P+     MF                 D P+ +    +     ++++P  QL   +L  SM
Sbjct: 1592 PETDPQSMFG--------------MRDPPMFIPTPVDRYR--QILLPALQLCQVILTSSM 1635

Query: 1616 GSSNKAVVQTVKGLLN 1631
                +A  Q ++ L++
Sbjct: 1636 AQHLQAAGQVLQFLIS 1651
>5IJN:3:D,J,P,V|pdbid|entity|chain(s)|sequence
          Length = 2012

 Score = 36.2 bits (82), Expect = 0.58,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 82/196 (41%), Gaps = 22/196 (11%)

Query: 1437 LVEIIWNDVVYGEGTSRVTGILLLDSLIQLANRSKENFILDSLMKTTRLLLIIRSLKNTD 1496
            L+E++  D   G    R+  + LLD ++ +    K+   L  L  +  L +++ SL   D
Sbjct: 1477 LMEVVCRDACDGHEIGRMLALALLDRIVSV---DKQQQWLLYLSNSGYLKVLVDSLVEDD 1533

Query: 1497 ALLNSTTEHINIDDLLYELTAFKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVD 1556
              L S         LL  L  +++ + FL RVA+ + GA  L+ + +   +A+     + 
Sbjct: 1534 RTLQSLL--TPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMR 1591

Query: 1557 PDLGLDLMFDEVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLV-SM 1615
            P+     MF                 D P+ +    +     ++++P  QL   +L  SM
Sbjct: 1592 PETDPQSMFG--------------MRDPPMFIPTPVDRYR--QILLPALQLCQVILTSSM 1635

Query: 1616 GSSNKAVVQTVKGLLN 1631
                +A  Q ++ L++
Sbjct: 1636 AQHLQAAGQVLQFLIS 1651
>5IJO:7:J,V|pdbid|entity|chain(s)|sequence
          Length = 1749

 Score = 34.3 bits (77), Expect = 1.9,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 51/185 (27%)

Query: 838  KSIFNVVDVGVDQLSIELEG--------GKNQAELL----QLAVKIINKVLDYQ--ETYV 883
            +++ N++ +GVD + + +          G+ Q +LL    +LA  + N V+  +     V
Sbjct: 775  QTVINIMGIGVDTIDMVMAAQPRSDGAEGQGQGQLLIKTVKLAFSVTNNVIRLKPPSNVV 834

Query: 884  EELFPIVKKHGKTDYFLPKNYSLHGLRSFYDAIFFNIPLVAHLGLYV-GVDDQILATNSL 942
              L   + +HG            HG             L+A L  Y+    D  L   ++
Sbjct: 835  SPLEQALSQHGA-----------HGNN-----------LIAVLAKYIYHKHDPALPRLAI 872

Query: 943  RILAKLSERSNGSVASLSKRNKLLTIFDSVDESARIKDAFITQLESSITDAGVLALKLEL 1002
            ++L +L+     +VA +S    L       +++A I+DAF+T+L+S I D   + +K+ +
Sbjct: 873  QLLKRLA-----TVAPMSVYACL------GNDAAAIRDAFLTRLQSKIED---MRIKVMI 918

Query: 1003 LDFLT 1007
            L+FLT
Sbjct: 919  LEFLT 923
>4XQB:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>4XQA:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>4K6W:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>4K6V:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>4K6U:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>4K6T:1:A,B,C,E,F,G|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>3QND:1:A,B,C,E,F,G|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>3N0I:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>2WGU:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>2WGT:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>2WBW:1:A|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>2J12:1:A|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>1UXE:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>1UXA:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 33.5 bits (75), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   PK++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
>1UXB:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 194

 Score = 32.0 bits (71), Expect = 9.2,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 624 DEDVKSSL--SKVFSDVLFEFTKINTPLVGAAFKVISNLV-PKLESSRTKFWSFLDSLIF 680
           D+D K +L  +K  S +L   + I   +V   + +I+N   P+++S   K     + ++ 
Sbjct: 30  DKDSKLTLVLTKCGSQILANVSLI---VVAGKYHIINNKTNPEIKSFTIKLLFNKNGVLL 86

Query: 681 KDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEY---MVFGKL 734
            +S+L  +  ++R+  +NV T Y   +GF+    NL++     N+ +Y   +V+G +
Sbjct: 87  DNSNLGKAYWNFRSGNSNVSTAYEKAIGFMP---NLVAYPKPSNSKKYARDIVYGTI 140
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.321    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 152,159,807
Number of extensions: 6193701
Number of successful extensions: 14451
Number of sequences better than 10.0: 41
Number of HSP's gapped: 14703
Number of HSP's successfully gapped: 45
Length of query: 1683
Length of database: 50,680,114
Length adjustment: 121
Effective length of query: 1562
Effective length of database: 25,915,528
Effective search space: 40480054736
Effective search space used: 40480054736
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)