BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (605 letters)

Database: pdb_polypeptide 
           202,155 sequences; 49,994,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3KES:1:A,B|pdbid|entity|chain(s)|sequence                             308   1e-83
3KEP:1:A,B|pdbid|entity|chain(s)|sequence                             308   1e-83
5HB6:1:A,B|pdbid|entity|chain(s)|sequence                              84   1e-15
5HB5:1:A,B|pdbid|entity|chain(s)|sequence                              84   1e-15
5CWW:1:A|pdbid|entity|chain(s)|sequence                                84   1e-15
2Q5X:1:A|pdbid|entity|chain(s)|sequence                                76   1e-13
2Q5Y:1:A,C|pdbid|entity|chain(s)|sequence                              76   2e-13
3TKN:3:C,F,I|pdbid|entity|chain(s)|sequence                            76   2e-13
1KO6:1:A,C|pdbid|entity|chain(s)|sequence                              75   5e-13
5E0Q:2:B|pdbid|entity|chain(s)|sequence                                74   6e-13
3PBP:2:B,E,H,K|pdbid|entity|chain(s)|sequence                          63   1e-09
2AIV:1:A|pdbid|entity|chain(s)|sequence                                63   2e-09
3NF5:1:A,B|pdbid|entity|chain(s)|sequence                              62   3e-09
5UI8:5:M|pdbid|entity|chain(s)|sequence                                31   5.8  
5NSS:7:M|pdbid|entity|chain(s)|sequence                                31   5.8  
5NSR:5:M|pdbid|entity|chain(s)|sequence                                31   5.8  
5BYH:5:M|pdbid|entity|chain(s)|sequence                                31   5.8  
>3KES:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 174

 Score =  308 bits (790), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 151/165 (91%), Positives = 152/165 (92%)

Query: 441 NLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV 500
           +LNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV
Sbjct: 2   SLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV 61

Query: 501 DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXX 560
           DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPV    
Sbjct: 62  DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVDKKT 121

Query: 561 XXXXXXXXXFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHF 605
                    FAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHF
Sbjct: 122 KKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHF 166
>3KEP:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 174

 Score =  308 bits (790), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 151/165 (91%), Positives = 152/165 (92%)

Query: 441 NLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV 500
           +LNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV
Sbjct: 2   SLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV 61

Query: 501 DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXX 560
           DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPV    
Sbjct: 62  DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVDKKT 121

Query: 561 XXXXXXXXXFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHF 605
                    FAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHF
Sbjct: 122 KKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHF 166
>5HB6:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 144

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 11/148 (7%)

Query: 458 SFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKI 517
           S  YW SP+ + +  ++  Q   V  F +GR   G + F+  VDL+       ++LFG I
Sbjct: 1   SGAYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNIN---LDDLFGTI 57

Query: 518 VIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFD 577
           VI    ++  VYP+ A KP +G GLNVPA+I+LE+ +P                  +   
Sbjct: 58  VILEP-RSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGR-------RLERHI 109

Query: 578 RKLRSMREMNYISYNPFGGTWTFKVNHF 605
            +L+S+ +  + SY+P  G W F V HF
Sbjct: 110 ERLKSIPDTTFESYDPETGVWAFSVEHF 137
>5HB5:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 140

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 48/146 (32%), Positives = 74/146 (50%), Gaps = 11/146 (7%)

Query: 460 GYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVI 519
            YW SP+ + +  ++  Q   V  F +GR   G + F+  VDL+       ++LFG IVI
Sbjct: 6   AYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNIN---LDDLFGTIVI 62

Query: 520 FRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFDRK 579
               ++  VYP+ A KP +G GLNVPA+I+LE+ +P                  +    +
Sbjct: 63  LEP-RSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGR-------RLERHIER 114

Query: 580 LRSMREMNYISYNPFGGTWTFKVNHF 605
           L+S+ +  + SY+P  G W F V HF
Sbjct: 115 LKSIPDTTFESYDPETGVWAFSVEHF 140
>5CWW:1:A|pdbid|entity|chain(s)|sequence
          Length = 140

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 48/146 (32%), Positives = 74/146 (50%), Gaps = 11/146 (7%)

Query: 460 GYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVI 519
            YW SP+ + +  ++  Q   V  F +GR   G + F+  VDL+       ++LFG IVI
Sbjct: 6   AYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNIN---LDDLFGTIVI 62

Query: 520 FRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFDRK 579
               ++  VYP+ A KP +G GLNVPA+I+LE+ +P                  +    +
Sbjct: 63  LEP-RSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGR-------RLERHIER 114

Query: 580 LRSMREMNYISYNPFGGTWTFKVNHF 605
           L+S+ +  + SY+P  G W F V HF
Sbjct: 115 LKSIPDTTFESYDPETGVWAFSVEHF 140
>2Q5X:1:A|pdbid|entity|chain(s)|sequence
          Length = 155

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 51/153 (33%), Positives = 75/153 (49%), Gaps = 13/153 (8%)

Query: 457 SSFGYWCSPSPEQLERLS-LKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFG 515
           +  GY+  PS + L +++  K    VS+F IGR+GYG I F+ DV+LT            
Sbjct: 5   TKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLN-------LD 57

Query: 516 KIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQV 575
            IV  R  K V VY D+  KP +G GLN  A +TL+ V+P               A+   
Sbjct: 58  DIVHIR-RKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADIN- 115

Query: 576 FDRKLRSMRE---MNYISYNPFGGTWTFKVNHF 605
           ++ +L ++       +  Y P  G+W FKV+HF
Sbjct: 116 YEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF 148
>2Q5Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 152

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 51/153 (33%), Positives = 75/153 (49%), Gaps = 13/153 (8%)

Query: 457 SSFGYWCSPSPEQLERLS-LKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFG 515
           +  GY+  PS + L +++  K    VS+F IGR+GYG I F+ DV+LT            
Sbjct: 9   TKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLN-------LD 61

Query: 516 KIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQV 575
            IV  R  K V VY D+  KP +G GLN  A +TL+ V+P               A+   
Sbjct: 62  DIVHIR-RKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADIN- 119

Query: 576 FDRKLRSMRE---MNYISYNPFGGTWTFKVNHF 605
           ++ +L ++       +  Y P  G+W FKV+HF
Sbjct: 120 YEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF 152
>3TKN:3:C,F,I|pdbid|entity|chain(s)|sequence
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 51/153 (33%), Positives = 75/153 (49%), Gaps = 13/153 (8%)

Query: 457 SSFGYWCSPSPEQLERLS-LKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFG 515
           +  GY+  PS + L +++  K    VS+F IGR+GYG I F+ DV+LT            
Sbjct: 9   TKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLN-------LD 61

Query: 516 KIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQV 575
            IV  R  K V VY D+  KP +G GLN  A +TL+ V+P               A+   
Sbjct: 62  DIVHIR-RKEVIVYVDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADIN- 119

Query: 576 FDRKLRSMRE---MNYISYNPFGGTWTFKVNHF 605
           ++ +L ++       +  Y P  G+W FKV+HF
Sbjct: 120 YEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF 152
>1KO6:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 187

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 52/152 (34%), Positives = 72/152 (47%), Gaps = 11/152 (7%)

Query: 457 SSFGYWCSPSPEQLERLS-LKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFG 515
           +  GY+  PS + L +++  K    VS+F IGR+GYG I F+ DV+LT            
Sbjct: 44  TKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLN-------LD 96

Query: 516 KIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQV 575
            IV  R  K V VY D+  KP +G GLN  A +TL+ V+P               A+   
Sbjct: 97  DIVHIR-RKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINY 155

Query: 576 FDRKLRSMREM--NYISYNPFGGTWTFKVNHF 605
             R     R+    +  Y P  G+W FKV+HF
Sbjct: 156 EGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF 187
>5E0Q:2:B|pdbid|entity|chain(s)|sequence
          Length = 153

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 50/148 (33%), Positives = 70/148 (47%), Gaps = 11/148 (7%)

Query: 461 YWCSPSPEQLER-LSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVI 519
           Y+  PS E+L R +       V+ F IGR G+G I F+  V+LT             IV 
Sbjct: 14  YYTIPSMEELARSVDENGECIVNGFTIGREGFGSIYFEGIVNLTNLD-------LDSIVH 66

Query: 520 FRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFDRK 579
            R  K V VY D+  KP +G GLN PA +TL+ V+P+              +E     + 
Sbjct: 67  IRR-KEVIVYVDDQNKPPLGEGLNRPAQVTLDEVWPIDKTSRSMITSPERLSEMNYKSKL 125

Query: 580 LRSMREM--NYISYNPFGGTWTFKVNHF 605
             + R+    ++ Y P  G+W FKVNHF
Sbjct: 126 ENASRKQGAQFVDYRPESGSWVFKVNHF 153
>3PBP:2:B,E,H,K|pdbid|entity|chain(s)|sequence
          Length = 148

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 46/147 (31%), Positives = 66/147 (44%), Gaps = 11/147 (7%)

Query: 461 YWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIF 520
           Y+ SPS + L   SL QL  V + V+G + YG I F   VDL     +      G ++I 
Sbjct: 5   YYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTS----LGGVIIT 60

Query: 521 RSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFDRKL 580
              KT  +Y +   +P  G G+NV A IT  N YPV                 Q+  R +
Sbjct: 61  FEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKD----PNHQLVKRHI 116

Query: 581 RSMRE---MNYISYNPFGGTWTFKVNH 604
             +++     + SY+   GT+ F VNH
Sbjct: 117 ERLKKNPNSKFESYDADSGTYVFIVNH 143
>2AIV:1:A|pdbid|entity|chain(s)|sequence
          Length = 149

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 46/147 (31%), Positives = 66/147 (44%), Gaps = 11/147 (7%)

Query: 461 YWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIF 520
           Y+ SPS + L   SL QL  V + V+G + YG I F   VDL     +      G ++I 
Sbjct: 6   YYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTS----LGGVIIT 61

Query: 521 RSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFDRKL 580
              KT  +Y +   +P  G G+NV A IT  N YPV                 Q+  R +
Sbjct: 62  FEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKD----PNHQLVKRHI 117

Query: 581 RSMRE---MNYISYNPFGGTWTFKVNH 604
             +++     + SY+   GT+ F VNH
Sbjct: 118 ERLKKNPNSKFESYDADSGTYVFIVNH 144
>3NF5:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 164

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 43/144 (29%), Positives = 68/144 (47%), Gaps = 5/144 (3%)

Query: 461 YWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIF 520
           Y+ SPS + L  LS  ++  V N V+G + YG I F   VDL+         +   +V+F
Sbjct: 16  YYISPSLDTLATLSKYEIQKVENLVVGNKQYGKIEFLDPVDLSDIPLG---SICDDLVVF 72

Query: 521 RSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVXXXXXXXXXXXXXFAEFQVFDRKL 580
           +   +V +Y +    P  G GLNV A I+  N YP+                 + +  KL
Sbjct: 73  Q-PMSVLLYNNSTNVPEKGKGLNVRARISCYNCYPLDKSTRKPIKDPNHRI-MERYSEKL 130

Query: 581 RSMREMNYISYNPFGGTWTFKVNH 604
           + +   ++ SY+P  GT+ F V+H
Sbjct: 131 KKIPHTHFESYDPASGTYCFTVDH 154
>5UI8:5:M|pdbid|entity|chain(s)|sequence
          Length = 477

 Score = 31.2 bits (69), Expect = 5.8,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 352 QNGFNFLSSQRADLT-----ELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSEN 406
           + G     SQ+  +T      +R L++ +     +  + L   P + +  + DE ++ E 
Sbjct: 2   KQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEVEAKEV 61

Query: 407 EPIANADSVTNIDRKENRDN-----NLDNTYLNGKEQSNNLNKQDGE 448
           E   + D+V  +++KE  D      + D  Y  G    N ++ QD E
Sbjct: 62  EDRESLDTVDALEQKEMPDELPLDASWDEIYTAGTPSGNGVDYQDDE 108
>5NSS:7:M|pdbid|entity|chain(s)|sequence
          Length = 581

 Score = 31.2 bits (69), Expect = 5.8,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 352 QNGFNFLSSQRADLT-----ELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSEN 406
           + G     SQ+  +T      +R L++ +     +  + L   P + +  + DE ++ E 
Sbjct: 2   KQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEVEAKEV 61

Query: 407 EPIANADSVTNIDRKENRDN-----NLDNTYLNGKEQSNNLNKQDGE 448
           E   + D+V  +++KE  D      + D  Y  G    N ++ QD E
Sbjct: 62  EDRESLDTVDALEQKEMPDELPLDASWDEIYTAGTPSGNGVDYQDDE 108
>5NSR:5:M|pdbid|entity|chain(s)|sequence
          Length = 573

 Score = 31.2 bits (69), Expect = 5.8,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 352 QNGFNFLSSQRADLT-----ELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSEN 406
           + G     SQ+  +T      +R L++ +     +  + L   P + +  + DE ++ E 
Sbjct: 2   KQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEVEAKEV 61

Query: 407 EPIANADSVTNIDRKENRDN-----NLDNTYLNGKEQSNNLNKQDGE 448
           E   + D+V  +++KE  D      + D  Y  G    N ++ QD E
Sbjct: 62  EDRESLDTVDALEQKEMPDELPLDASWDEIYTAGTPSGNGVDYQDDE 108
>5BYH:5:M|pdbid|entity|chain(s)|sequence
          Length = 477

 Score = 31.2 bits (69), Expect = 5.8,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 352 QNGFNFLSSQRADLT-----ELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSEN 406
           + G     SQ+  +T      +R L++ +     +  + L   P + +  + DE ++ E 
Sbjct: 2   KQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEVEAKEV 61

Query: 407 EPIANADSVTNIDRKENRDN-----NLDNTYLNGKEQSNNLNKQDGE 448
           E   + D+V  +++KE  D      + D  Y  G    N ++ QD E
Sbjct: 62  EDRESLDTVDALEQKEMPDELPLDASWDEIYTAGTPSGNGVDYQDDE 108
  Database: pdb_polypeptide
    Posted date:  Sep 15, 2017  6:19 PM
  Number of letters in database: 49,994,932
  Number of sequences in database:  202,155
  
Lambda     K      H
   0.312    0.128    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 202155
Number of Hits to DB: 47,914,930
Number of extensions: 1749244
Number of successful extensions: 2860
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2882
Number of HSP's successfully gapped: 25
Length of query: 605
Length of database: 49,994,932
Length adjustment: 113
Effective length of query: 492
Effective length of database: 27,151,417
Effective search space: 13358497164
Effective search space used: 13358497164
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)