BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (541 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

5CWS:5:E,K|pdbid|entity|chain(s)|sequence                             116   1e-25
5C3L:1:A|pdbid|entity|chain(s)|sequence                                47   9e-05
5IJO:4:F,L,R,X|pdbid|entity|chain(s)|sequence                          45   3e-04
5IJN:4:F,L,R,X|pdbid|entity|chain(s)|sequence                          45   3e-04
3PR7:1:A,B,C|pdbid|entity|chain(s)|sequence                            30   9.0  
>5CWS:5:E,K|pdbid|entity|chain(s)|sequence
          Length = 247

 Score =  116 bits (290), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 122/247 (49%), Gaps = 10/247 (4%)

Query: 284 YPQQIQEQVLKCKESWDPNTTKTKLRAFVYNKVNETEAILYTKPGHVLQEEWDQAMEKKP 343
           Y + I EQ+    + W+PN      + ++YNKV+E    LY    +   +EW++A+++KP
Sbjct: 2   YQKPIPEQIKLIVDKWNPNHPNCAFKTYLYNKVDEHTVPLYGPGPNEDPKEWEEALQRKP 61

Query: 344 SPQTIPIQIYGFEGLNQRNQVQTENVAQARIILNHILEKSTQLQQKHELDTASRILKAQS 403
           +P  IP+   GF  +  R  +Q   + +    L+ I      +  +H+LD   R   A+ 
Sbjct: 62  APNFIPVLCSGFPSIVARLMLQRRVITEFNNKLHQINASLDAILSRHDLDHTVRAFNARR 121

Query: 404 RNVEIEKRILKLGTQLATLKNRGLPLGIAEEKMWSQFQTLLQRSEDPAGLGKTNELWARL 463
           R+ E+ +R L L  ++  L+NRG  L   E+++  + Q + +   DPA   +  ELW+RL
Sbjct: 122 RHAELSRRCLHLAARVQVLRNRGYALSGDEDELKQKLQQIDKTLNDPAQGSRLEELWSRL 181

Query: 464 AILKERAKNISSQLDSKLMVFNDDTKNQDSMSKGTGEESNDRINKIVEILTNQQRGITYL 523
            +L+  A+++  Q++   +  +D          G GEE   +  KI+E    Q + +   
Sbjct: 182 IVLRGYAEDLKDQINQAGITESD----------GLGEEIEAKAKKILEDYDKQLQHLKKQ 231

Query: 524 NEVLEKD 530
            E  +KD
Sbjct: 232 VEEAKKD 238
>5C3L:1:A|pdbid|entity|chain(s)|sequence
          Length = 333

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 68/131 (51%), Gaps = 3/131 (2%)

Query: 335 WDQAMEKKPSPQT-IPIQIYGFEGLNQRNQVQTENVAQARIILNHILEKSTQLQQKHELD 393
           W+QA    P P+  IP+ + GF+ L +R +VQ +   Q +  L+ I E   +L QK++  
Sbjct: 197 WEQAKVDNPDPERLIPVPMIGFKELLRRLEVQDQMTKQHQSRLDIISEDIGEL-QKNQTT 255

Query: 394 TASRILKAQSRNVEIEKRILKLGTQLATLKNRGLPLGIAEEKMWSQFQTLLQRSEDPAGL 453
           T ++I + + + +E+  R+L++  +    +  G  +   EE++  Q  T+      P   
Sbjct: 256 TMAKIGQYKRKLMELSHRVLQVLIKQEIQRKSGFAIQAEEEQLRVQLDTIQSELNAPTQF 315

Query: 454 -GKTNELWARL 463
            G+ NEL +++
Sbjct: 316 KGRLNELMSQI 326
>5IJO:4:F,L,R,X|pdbid|entity|chain(s)|sequence
          Length = 507

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 101/220 (45%), Gaps = 24/220 (10%)

Query: 318 ETEAILYTKPGHVLQEEWDQAMEKKP-SPQTIPIQIYGFEGLNQRNQVQTENVAQARIIL 376
           + + +L   P  V    W+QA    P S + IP+ + GF+ L +R +VQ +   Q +  L
Sbjct: 292 QIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRL 351

Query: 377 NHILEKSTQLQQKHELDTASRILKAQSRNVEIEKRILKLGTQLATLKNRGLPLGIAEEKM 436
           + I E  ++L QK++  + ++I + + + +++  R L++  +    +  G  +   EE++
Sbjct: 352 DIISEDISEL-QKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQL 410

Query: 437 WSQFQTLLQRSEDPAGL-GKTNELWARLAILKERAKNISSQLDSKLMVFNDDTKNQDSMS 495
             Q  T+      P    G+ NEL +++     R +N    + S+   + D         
Sbjct: 411 RVQLDTIQGELNAPTQFKGRLNELMSQI-----RMQNHFGAVRSEERYYID--------- 456

Query: 496 KGTGEESNDRINKIVEILTNQQRGITYLNEVLEKDAAIVK 535
                   D + +I + L  QQ G+++L  +++ D   +K
Sbjct: 457 -------ADLLREIKQHLKQQQEGLSHLISIIKDDLEDIK 489
>5IJN:4:F,L,R,X|pdbid|entity|chain(s)|sequence
          Length = 507

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 101/220 (45%), Gaps = 24/220 (10%)

Query: 318 ETEAILYTKPGHVLQEEWDQAMEKKP-SPQTIPIQIYGFEGLNQRNQVQTENVAQARIIL 376
           + + +L   P  V    W+QA    P S + IP+ + GF+ L +R +VQ +   Q +  L
Sbjct: 292 QIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRL 351

Query: 377 NHILEKSTQLQQKHELDTASRILKAQSRNVEIEKRILKLGTQLATLKNRGLPLGIAEEKM 436
           + I E  ++L QK++  + ++I + + + +++  R L++  +    +  G  +   EE++
Sbjct: 352 DIISEDISEL-QKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQL 410

Query: 437 WSQFQTLLQRSEDPAGL-GKTNELWARLAILKERAKNISSQLDSKLMVFNDDTKNQDSMS 495
             Q  T+      P    G+ NEL +++     R +N    + S+   + D         
Sbjct: 411 RVQLDTIQGELNAPTQFKGRLNELMSQI-----RMQNHFGAVRSEERYYID--------- 456

Query: 496 KGTGEESNDRINKIVEILTNQQRGITYLNEVLEKDAAIVK 535
                   D + +I + L  QQ G+++L  +++ D   +K
Sbjct: 457 -------ADLLREIKQHLKQQQEGLSHLISIIKDDLEDIK 489
>3PR7:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 311

 Score = 30.4 bits (67), Expect = 9.0,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 6/96 (6%)

Query: 115 STIGGGLFG---NKPTTTTGGLFGNSAQNNSTTSGGLFGNKVGSTGSLMGGNSTQ---NT 168
           STIGGGLF    N+ +T   G +  +    ST  GG +        ++ GG++       
Sbjct: 45  STIGGGLFNEATNEYSTIGSGGYNKAKGRYSTIGGGGYNEATNQYSTIGGGDNNTAKGRY 104

Query: 169 SNMNAGGLFGAKPQNTTATTGGLFGSKPQGSTTNGG 204
           S +  GG   A  +N+T   GG   +K + ST  GG
Sbjct: 105 STIGGGGYNEATIENSTVGGGGYNQAKGRNSTVAGG 140
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.308    0.126    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 47,931,290
Number of extensions: 1859131
Number of successful extensions: 3926
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3942
Number of HSP's successfully gapped: 58
Length of query: 541
Length of database: 50,680,114
Length adjustment: 112
Effective length of query: 429
Effective length of database: 27,757,522
Effective search space: 11907976938
Effective search space used: 11907976938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 67 (30.4 bits)