BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (726 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3IKO:3:C,F,I|pdbid|entity|chain(s)|sequence                           894   0.0  
4XMN:3:F|pdbid|entity|chain(s)|sequence                               879   0.0  
4XMM:6:F|pdbid|entity|chain(s)|sequence                               879   0.0  
3JRO:2:C|pdbid|entity|chain(s)|sequence                               824   0.0  
5A9Q:5:4,D,M,V|pdbid|entity|chain(s)|sequence                          71   6e-12
4GKQ:1:A,B|pdbid|entity|chain(s)|sequence                              32   5.6  
4GKP:1:A,B|pdbid|entity|chain(s)|sequence                              32   6.0  
2WAM:1:A,B,C|pdbid|entity|chain(s)|sequence                            31   9.0  
>3IKO:3:C,F,I|pdbid|entity|chain(s)|sequence
          Length = 460

 Score =  894 bits (2309), Expect = 0.0,   Method: Composition-based stats.
 Identities = 460/460 (100%), Positives = 460/460 (100%)

Query: 1   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 60
           MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
Sbjct: 1   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 60

Query: 61  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 120
           NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
Sbjct: 61  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 120

Query: 121 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 180
           IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
Sbjct: 121 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 180

Query: 181 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 240
           FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
Sbjct: 181 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 240

Query: 241 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 300
           SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
Sbjct: 241 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 300

Query: 301 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 360
           YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
Sbjct: 301 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 360

Query: 361 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 420
           SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
Sbjct: 361 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 420

Query: 421 KLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKK 460
           KLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKK
Sbjct: 421 KLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKK 460
>4XMN:3:F|pdbid|entity|chain(s)|sequence
          Length = 454

 Score =  879 bits (2271), Expect = 0.0,   Method: Composition-based stats.
 Identities = 451/451 (100%), Positives = 451/451 (100%)

Query: 1   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 60
           MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
Sbjct: 4   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 63

Query: 61  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 120
           NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
Sbjct: 64  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 123

Query: 121 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 180
           IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
Sbjct: 124 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 183

Query: 181 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 240
           FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
Sbjct: 184 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 243

Query: 241 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 300
           SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
Sbjct: 244 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 303

Query: 301 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 360
           YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
Sbjct: 304 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 363

Query: 361 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 420
           SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
Sbjct: 364 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 423

Query: 421 KLQGLYENIPIYATFLNESDCLEACSFILSS 451
           KLQGLYENIPIYATFLNESDCLEACSFILSS
Sbjct: 424 KLQGLYENIPIYATFLNESDCLEACSFILSS 454
>4XMM:6:F|pdbid|entity|chain(s)|sequence
          Length = 454

 Score =  879 bits (2271), Expect = 0.0,   Method: Composition-based stats.
 Identities = 451/451 (100%), Positives = 451/451 (100%)

Query: 1   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 60
           MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
Sbjct: 4   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 63

Query: 61  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 120
           NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
Sbjct: 64  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 123

Query: 121 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 180
           IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
Sbjct: 124 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 183

Query: 181 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 240
           FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
Sbjct: 184 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 243

Query: 241 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 300
           SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
Sbjct: 244 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 303

Query: 301 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 360
           YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
Sbjct: 304 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 363

Query: 361 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 420
           SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
Sbjct: 364 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 423

Query: 421 KLQGLYENIPIYATFLNESDCLEACSFILSS 451
           KLQGLYENIPIYATFLNESDCLEACSFILSS
Sbjct: 424 KLQGLYENIPIYATFLNESDCLEACSFILSS 454
>3JRO:2:C|pdbid|entity|chain(s)|sequence
          Length = 426

 Score =  824 bits (2128), Expect = 0.0,   Method: Composition-based stats.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 60
           MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
Sbjct: 3   MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES 62

Query: 61  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 120
           NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
Sbjct: 63  NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW 122

Query: 121 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 180
           IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
Sbjct: 123 IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF 182

Query: 181 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 240
           FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
Sbjct: 183 FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH 242

Query: 241 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 300
           SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
Sbjct: 243 SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN 302

Query: 301 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 360
           YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
Sbjct: 303 YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH 362

Query: 361 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 420
           SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
Sbjct: 363 SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL 422

Query: 421 KLQG 424
           KLQG
Sbjct: 423 KLQG 426
>5A9Q:5:4,D,M,V|pdbid|entity|chain(s)|sequence
          Length = 925

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 125/605 (20%), Positives = 246/605 (40%), Gaps = 73/605 (12%)

Query: 157 DLDFPLRENTNVLDVKDKEEDHIFFKYIYELILAGAIDEALEEAKLSDNISICMILCGIQ 216
           D D P+R+    LD  D+E++    KY++ LI AG  +EA    K          L G +
Sbjct: 324 DPDAPIRQKMP-LDDLDREDEVRLLKYLFTLIRAGMTEEAQRLCKRCGQAWRAATLEGWK 382

Query: 217 EYLNPVIDTQIANEFNTQQGIKKHSLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEV 276
            Y +P ++     E    +G     +W+ + + +++    + YERAIY+ LSG +  +++
Sbjct: 383 LYHDPNVNG--GTELEPVEGNPYRRIWKISCWRMAEDELFNRYERAIYAALSGNL--KQL 438

Query: 277 LQYSD-WESDLHIHLNQILQTEIENYLLENNQVGTDELILPLPSHALTVQEVLNRV---- 331
           L   D WE  +  +   ++ + +E  +     V T +    LP   L     L +V    
Sbjct: 439 LPVCDTWEDTVWAYFRVMVDSLVEQEI--QTSVATLDETEELPREYLGANWTLEKVFEEL 496

Query: 332 ----ASRHPSESEHPIRVLMASVILDSLPSVIHSSVEMLLDVVKGTEASNDIIDKPYLLR 387
                 R   E++    ++   +IL  +  ++    + L      +++ N++    +LLR
Sbjct: 497 QATDKKRVLEENQEHYHIVQKFLILGDIDGLMDEFSKWL------SKSRNNL--PGHLLR 548

Query: 388 IVTHLAICLDIINPGSVEEVDKSKLITTYISLLKLQGLYENIPIYATFLNESDCLEACSF 447
            +THL +    +   + EEV   +++ TYI LL  +     I  Y   L +   +   + 
Sbjct: 549 FMTHLILFFRTLGLQTKEEV-SIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYAL 607

Query: 448 ILSSLEDPQVRKKQIETINFLRLPASNILRRTTQRVFDETEQEYSPSNEISISFDVNNI- 506
            L S+ + + R   +E      L  + I +   + +  +   E+S  ++++ + D     
Sbjct: 608 FLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFS-HHDLAPALDTGTTE 666

Query: 507 -DMHLIYGVEWLI-EGKLYVDAVHSIIALSRRFLLNGRVKALEQF---MERNNIGEICKN 561
            D   I  ++WL+ +     +A+    A+ R+FL + + +A ++    + +++I EI   
Sbjct: 667 EDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSIAEIYNQ 726

Query: 562 YELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEWQKSVSLLSSESNI---PTLIE 618
            E + +   +  +  +D  + E       ++    + EW K ++ +  +  +   PT  E
Sbjct: 727 CEEQGMESPLPAE--DDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTE 784

Query: 619 K--------------------LQGFSKDTFELIKTFL--------VDLTSSNFADSADYE 650
           K                    L   + D  E +   L        VD+      D     
Sbjct: 785 KVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTH 844

Query: 651 ILYEIRALYTPFLLMELHKKLVEAAKLLKIPKFISEALAFTSLVANENDKIYLLFQSSGK 710
            +  +R L  P L   LH  L    +         E L    +V++E  K+YL+F S  +
Sbjct: 845 QMVLLRKLCLPMLCFLLHTILHSTGQY-------QECLQLADMVSSERHKLYLVF-SKEE 896

Query: 711 LKEYL 715
           L++ L
Sbjct: 897 LRKLL 901
>4GKQ:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 286

 Score = 31.6 bits (70), Expect = 5.6,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 10/94 (10%)

Query: 560 KNYELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEWQKSVSLLS-SESNIPTLIE 618
           K Y+  K+  N S  +N+D F E++  Y       RE      + +L S   SNIP   E
Sbjct: 57  KTYKFTKLIQNFSH-QNKDLFKEDLHVYIDFCLKRRE------NFNLFSVGSSNIPNTFE 109

Query: 619 KLQGFSKDTFELIKTFLVDLTSSNFADSADYEIL 652
           KL  F K+ +     F++ L     +D+AD + L
Sbjct: 110 KLLAFFKNNY--FDKFVITLQYVMLSDNADSQDL 141
>4GKP:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 275

 Score = 31.6 bits (70), Expect = 6.0,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 10/94 (10%)

Query: 560 KNYELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEWQKSVSLLS-SESNIPTLIE 618
           K Y+  K+  N S  +N+D F E++  Y       RE      + +L S   SNIP   E
Sbjct: 46  KTYKFTKLIQNFSH-QNKDLFKEDLHVYIDFCLKRRE------NFNLFSVGSSNIPNTFE 98

Query: 619 KLQGFSKDTFELIKTFLVDLTSSNFADSADYEIL 652
           KL  F K+ +     F++ L     +D+AD + L
Sbjct: 99  KLLAFFKNNY--FDKFVITLQYVMLSDNADSQDL 130
>2WAM:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 351

 Score = 30.8 bits (68), Expect = 9.0,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 34/129 (26%)

Query: 568 ADNISKDENEDQFLEEITQYEHLIKGIREYEEWQKSVSLLSSESNIPTLIEKLQGFS--- 624
           ++N+      DQ  +E  +YE    G+ E E     +S  SS+   P L+  L+GFS   
Sbjct: 22  SENLYFQGARDQGADEAREYEPGQPGMYELEFPAPQLS--SSDGRGPVLVHALEGFSDAG 79

Query: 625 -------------KDTFELIKTFLVD-------------LTSSNFADSADYEI-LYEIR- 656
                         DT EL+ +F +D               + +F  S D E+ LY +R 
Sbjct: 80  HAIRLAAAHLKAALDT-ELVASFAIDELLDYRSRRPLMTFKTDHFTHSDDPELSLYALRD 138

Query: 657 ALYTPFLLM 665
           ++ TPFLL+
Sbjct: 139 SIGTPFLLL 147
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.317    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 70,312,578
Number of extensions: 2935173
Number of successful extensions: 7264
Number of sequences better than 10.0: 9
Number of HSP's gapped: 7470
Number of HSP's successfully gapped: 9
Length of query: 726
Length of database: 50,680,114
Length adjustment: 114
Effective length of query: 612
Effective length of database: 27,348,190
Effective search space: 16737092280
Effective search space used: 16737092280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)