BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (1655 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

4KF7:1:A|pdbid|entity|chain(s)|sequence                                43   0.006
5IJO:7:J,V|pdbid|entity|chain(s)|sequence                              38   0.14 
4BBM:1:A,B|pdbid|entity|chain(s)|sequence                              34   2.3  
4AAA:1:A|pdbid|entity|chain(s)|sequence                                34   2.3  
>4KF7:1:A|pdbid|entity|chain(s)|sequence
          Length = 1160

 Score = 42.7 bits (99), Expect = 0.006,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 890  LPSYVH-FKVQIIELLSYLVEAPWND--DYPFLLSFLGEAKSMAFLKEVLSDLSSPVQDW 946
            LP+  H F++  I LLS LVE+      + P LL +LG   S +F+ ++ + L  P    
Sbjct: 1064 LPAIRHSFRIPAISLLSALVESAGKSSGEPPSLLGYLGPQVSRSFI-QIAAQLDKPFDRV 1122

Query: 947  NLLRSLYIFFTTLLESKQDGLSILFLTGQ 975
              + S + FF+T+L ++Q  ++   LTG+
Sbjct: 1123 AEVASTWRFFSTILRNRQQWMANCLLTGK 1151
>5IJO:7:J,V|pdbid|entity|chain(s)|sequence
          Length = 1749

 Score = 38.1 bits (87), Expect = 0.14,   Method: Composition-based stats.
 Identities = 104/494 (21%), Positives = 203/494 (41%), Gaps = 84/494 (17%)

Query: 552  LIIFLYKFNGWSLVGRILQNLLHSYMEKGTQLDDLQH-ELMISIIKLVTNVVDPKTSIEK 610
            L+ + Y ++ W+L    ++ LLH      +  D +QH + +  II LV  V+    SI  
Sbjct: 529  LVRWEYSYSSWTLFTCEIEMLLHVV----STADVIQHCQRVKPIIDLVHKVISTDLSIAD 584

Query: 611  S------------SEILSYLSNSLDTSASTINGASIIQVIFEIFEISLQRKDYTSIVQCC 658
                           + + +S  +D  AS +N  +++             K +T +    
Sbjct: 585  CLLPITSRIYMLLQRLTTVISPPVDVIASCVNCLTVLAA-------RNPAKVWTDLRH-- 635

Query: 659  EFMTMLTPNYLHLVSSYLNKSDLLDKYGKTGLSNMILGSVELSTGDYTFTIQLLKLTKVF 718
               T   P   H VSS L++    +     G  N+++ S E   G+Y  TI  L+L    
Sbjct: 636  ---TGFLPFVAHPVSS-LSQMISAEGMNAGGYGNLLMNS-EQPQGEYGVTIAFLRLITTL 690

Query: 719  IRESLSLKNIHISKRSKIDIINKLILHAIHIFESYYNWKYNNFLQKFEIAFHLTLIFYDV 778
            ++  L       S +S+  ++  ++     +  SY+ W+YN+   + +I      +  ++
Sbjct: 691  VKGQLG------STQSQ-GLVPCVMFVLKEMLPSYHKWRYNSHGVREQIG----CLILEL 739

Query: 779  LHDVFTINPHQKDQLIISSSANKLLQLFLTPMDSIDLAPNTLTNILISPLNTTTKILGDK 838
            +H +  +  H+ D   + SS    LQ       +   A  T+ NI+   ++T   ++  +
Sbjct: 740  IHAILNLC-HETD---LHSSHTPSLQFLCICSLAYTEAGQTVINIMGIGVDTIDMVMAAQ 795

Query: 839  I---------LGNLYSKVMNNSFKLCTLLIAIRGSNRDLKPSNLEKLLF---INSSKLVD 886
                       G L  K +  +F +   +I ++  +  + P  LE+ L     + + L+ 
Sbjct: 796  PRSDGAEGQGQGQLLIKTVKLAFSVTNNVIRLKPPSNVVSP--LEQALSQHGAHGNNLIA 853

Query: 887  VYTLPSYVHFK---------VQIIELLSYLVEAPWNDDYPFLLSFLGEAKSMAFLKEVLS 937
            V  L  Y++ K         +Q+++ L+ +  AP +     + + LG   + A     L+
Sbjct: 854  V--LAKYIYHKHDPALPRLAIQLLKRLATV--APMS-----VYACLGN-DAAAIRDAFLT 903

Query: 938  DLSSPVQDWNLLRSLYIFFTTLLESKQDGLSILFLTGQFASNKKINDESSIDKKSSILTV 997
             L S ++D  +   +  F T  +E+ Q GL  LFL  +       + E S+   S +  V
Sbjct: 904  RLQSKIEDMRIKVMILEFLTVAVET-QPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAV 962

Query: 998  LQKNSLLLDSTPEE 1011
            L+    L+DS  ++
Sbjct: 963  LE----LIDSQQQD 972
>4BBM:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 331

 Score = 33.9 bits (76), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%)

Query: 1107 ELVHH-FFQIDGFNKTFHDELNLKFKE 1132
            EL+HH FFQ+DGF + F  EL LK ++
Sbjct: 303  ELLHHDFFQMDGFAERFSQELQLKVQK 329
>4AAA:1:A|pdbid|entity|chain(s)|sequence
          Length = 331

 Score = 33.9 bits (76), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%)

Query: 1107 ELVHH-FFQIDGFNKTFHDELNLKFKE 1132
            EL+HH FFQ+DGF + F  EL LK ++
Sbjct: 303  ELLHHDFFQMDGFAERFSQELQLKVQK 329
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 135,657,921
Number of extensions: 5117904
Number of successful extensions: 11426
Number of sequences better than 10.0: 13
Number of HSP's gapped: 11704
Number of HSP's successfully gapped: 13
Length of query: 1655
Length of database: 50,680,114
Length adjustment: 120
Effective length of query: 1535
Effective length of database: 26,120,194
Effective search space: 40094497790
Effective search space used: 40094497790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)