BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (475 letters)

Database: pdb_polypeptide 
           205,028 sequences; 50,760,108 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3W3Y:2:B|pdbid|entity|chain(s)|sequence                                88   4e-17
3P3D:1:A|pdbid|entity|chain(s)|sequence                                87   5e-17
2M4M:1:A|pdbid|entity|chain(s)|sequence                                71   3e-12
4LIR:1:A,B|pdbid|entity|chain(s)|sequence                              38   0.045
1WWH:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          38   0.047
>3W3Y:2:B|pdbid|entity|chain(s)|sequence
          Length = 48

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%)

Query: 401 RNAEFKVSKNSTSFKNPRRLEIKDGRSLFLRNRGKIHSGVLSSIESDL 448
           RNAEFKVSKNSTSFKNPRRLEIKDGRSLFLRNRGKIHSGVLSSIESDL
Sbjct: 1   RNAEFKVSKNSTSFKNPRRLEIKDGRSLFLRNRGKIHSGVLSSIESDL 48
>3P3D:1:A|pdbid|entity|chain(s)|sequence
          Length = 132

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 10/114 (8%)

Query: 252 AIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQKY-PIYTG 310
           AI++FGYPET+AN +I +F  FG ILEDF V++       K  + +  L  +++ PI++G
Sbjct: 9   AILVFGYPETMANQVIAYFQEFGTILEDFEVLR-------KPQAMTVGLQDRQFVPIFSG 61

Query: 311 DGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAALKQLA--SLKKSEEI 362
           + W K+TY +  S   AL ENG + NG L+G + Y+  A+++L    L  SE+I
Sbjct: 62  NSWTKITYDNPASAVDALLENGAVFNGVLLGVIPYTKDAVERLQKRKLTSSEDI 115
>2M4M:1:A|pdbid|entity|chain(s)|sequence
          Length = 124

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 11/110 (10%)

Query: 251 HAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQKYPIYT- 309
           +A+++FGY E I   I+ +FA FGEILED        +L      ++P    Q+ P    
Sbjct: 11  NAVVVFGYREAITKQILAYFAQFGEILEDLE-----SELGDTETMRTPGYFFQQAPNRRR 65

Query: 310 -----GDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAALKQLA 354
                G  W KLTY +  S  RAL+E+G I  G  IGCV Y    + +L+
Sbjct: 66  ISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISELS 115
>4LIR:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 117

 Score = 37.7 bits (86), Expect = 0.045,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 26/92 (28%)

Query: 249 DDHAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQKYPIY 308
           DD  + +FG+P+  A+ I+L FA +G IL                          K+ + 
Sbjct: 23  DDSWVTVFGFPQASASYILLQFAQYGNIL--------------------------KHVMS 56

Query: 309 TGDGWVKLTYKSELSKSRALQENGIIMNGTLI 340
               W+ + Y+S+L   +AL ++G I   +++
Sbjct: 57  NTGNWMHIRYQSKLQARKALSKDGRIFGESIM 88
>1WWH:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 119

 Score = 37.7 bits (86), Expect = 0.047,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 26/92 (28%)

Query: 249 DDHAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQKYPIY 308
           DD  + +FG+P+  A+ I+L FA +G IL                          K+ + 
Sbjct: 23  DDTWVTVFGFPQASASYILLQFAQYGNIL--------------------------KHVMS 56

Query: 309 TGDGWVKLTYKSELSKSRALQENGIIMNGTLI 340
               W+ + Y+S+L   +AL ++G I   +++
Sbjct: 57  NTGNWMHIRYQSKLQARKALSKDGRIFGESIM 88
  Database: pdb_polypeptide
    Posted date:  Nov 18, 2017  2:38 AM
  Number of letters in database: 50,760,108
  Number of sequences in database:  205,028
  
Lambda     K      H
   0.312    0.130    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 205028
Number of Hits to DB: 40,969,962
Number of extensions: 1504911
Number of successful extensions: 2177
Number of sequences better than 10.0: 5
Number of HSP's gapped: 2260
Number of HSP's successfully gapped: 5
Length of query: 475
Length of database: 50,760,108
Length adjustment: 111
Effective length of query: 364
Effective length of database: 28,002,000
Effective search space: 10192728000
Effective search space used: 10192728000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)