BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (1391 letters)

Database: pdb_polypeptide 
           202,155 sequences; 49,994,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

4MHC:1:A|pdbid|entity|chain(s)|sequence                              1630   0.0  
3I5P:1:A|pdbid|entity|chain(s)|sequence                               387   e-107
5HB1:1:A|pdbid|entity|chain(s)|sequence                               231   6e-60
5HAY:1:A,B|pdbid|entity|chain(s)|sequence                             189   3e-47
5HAX:1:A|pdbid|entity|chain(s)|sequence                               177   8e-44
3I5Q:1:A,B|pdbid|entity|chain(s)|sequence                             173   2e-42
5HAZ:1:A|pdbid|entity|chain(s)|sequence                               171   7e-42
5HB0:1:A,B,C,D|pdbid|entity|chain(s)|sequence                         169   3e-41
5IJO:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence                     110   2e-23
5IJN:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence                     110   2e-23
5A9Q:10:A,B|pdbid|entity|chain(s)|sequence                            110   2e-23
4P1N:1:A,B|pdbid|entity|chain(s)|sequence                              34   1.5  
3J6B:18:R|pdbid|entity|chain(s)|sequence                               33   3.1  
3BJD:1:A,B,C|pdbid|entity|chain(s)|sequence                            33   3.2  
5MRF:18:R|pdbid|entity|chain(s)|sequence                               33   3.3  
5MRE:18:R|pdbid|entity|chain(s)|sequence                               33   3.3  
5MRC:18:R|pdbid|entity|chain(s)|sequence                               33   3.3  
>4MHC:1:A|pdbid|entity|chain(s)|sequence
          Length = 826

 Score = 1630 bits (4220), Expect = 0.0,   Method: Composition-based stats.
 Identities = 824/826 (99%), Positives = 826/826 (100%)

Query: 68  TIESELRDVTTHVKISGLTSSEPLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSD 127
           ++ESELRDVTTHVKISGLTSSEPLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSD
Sbjct: 1   SMESELRDVTTHVKISGLTSSEPLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSD 60

Query: 128 EVGGLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINN 187
           EVGGLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINN
Sbjct: 61  EVGGLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINN 120

Query: 188 SSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIF 247
           SSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIF
Sbjct: 121 SSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIF 180

Query: 248 NTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKS 307
           NTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKS
Sbjct: 181 NTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKS 240

Query: 308 NLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYL 367
           NLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYL
Sbjct: 241 NLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYL 300

Query: 368 ITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDLFLAVITT 427
           ITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDLFLAVITT
Sbjct: 301 ITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDLFLAVITT 360

Query: 428 TGVRLYFKGSISRRSIGSLKLDSVKFPPTSISSSLEQNKSFIIGHHPLNTHDTGPLSTQK 487
           TGVRLYFKGSISRRSIGSLKLDSVKFPPTSISSSLEQNKSFIIGHHPLNTHDTGPLSTQK
Sbjct: 361 TGVRLYFKGSISRRSIGSLKLDSVKFPPTSISSSLEQNKSFIIGHHPLNTHDTGPLSTQK 420

Query: 488 ASSTYINTTCASTIISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYVSAPDYGI 547
           ASSTYINTTCASTIISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYVSAPDYGI
Sbjct: 421 ASSTYINTTCASTIISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYVSAPDYGI 480

Query: 548 LKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLKVAVLTSN 607
           LKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLKVAVLTSN
Sbjct: 481 LKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLKVAVLTSN 540

Query: 608 ALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKSSALAFFSA 667
           ALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKSSALAFFSA
Sbjct: 541 ALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKSSALAFFSA 600

Query: 668 GIPGVVEIKPKSSRESGSVPPISQNLFDKSGECDGIVLSPRFYGSALLITRLFSQIWEER 727
           GIPGVVEIKPKSSRESGSVPPISQNLFDKSGECDGIVLSPRFYGSALLITRLFSQIWEER
Sbjct: 601 GIPGVVEIKPKSSRESGSVPPISQNLFDKSGECDGIVLSPRFYGSALLITRLFSQIWEER 660

Query: 728 VFVFKRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNIHRPSFVSFVPPKGSNAITA 787
           VFVFKRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNIHRPSFVSFVPPKGSNAITA
Sbjct: 661 VFVFKRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNIHRPSFVSFVPPKGSNAITA 720

Query: 788 SDAESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDL 847
           SDAESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDL
Sbjct: 721 SDAESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDL 780

Query: 848 KFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFG 893
           KFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFG
Sbjct: 781 KFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFG 826
>3I5P:1:A|pdbid|entity|chain(s)|sequence
          Length = 525

 Score =  387 bits (995), Expect = e-107,   Method: Composition-based stats.
 Identities = 207/518 (39%), Positives = 318/518 (61%), Gaps = 5/518 (0%)

Query: 878  GTSADYIVNVLKERFGSFCHSADILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYER 937
            G S +Y    L+ER GSFC ++DIL +RA EHL  A++  + +      HL  A  L E+
Sbjct: 1    GPSIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQ 60

Query: 938  CAENIELCELRRVVDIMVKLNYQPKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKVF 997
              +++ + +L+  V +M+ +NY PK++ FLL  A+ +DKG  A +YV+ G    D RK +
Sbjct: 61   IVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQY 120

Query: 998  YDKRINVYTLIFEIVKSVDDYTSIEQSPSIAN-ISIFSPAS-SLKKRVYSVIMNSNNRFF 1055
            YDKRI VY L+F+ +  VD+    +QS    N ISI +     L+++ Y   +  N+R F
Sbjct: 121  YDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLF 180

Query: 1056 HYCFYDWLVANKRQDYLLRLDSQFVLPYLKERAEKSLEISNLLWFYLFKEEHFLEAADVL 1115
            HY  YDWLV+  R++ LL +++ F+LPYL E+A  SL+ISN+LW Y  +   F E+A++L
Sbjct: 181  HYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEIL 240

Query: 1116 YALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLN 1175
            Y LA+S+FD+ L ERIE L+RANG C+S +   QK  +VQL+  I +  ++A IQ D+L+
Sbjct: 241  YRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILS 300

Query: 1176 LVRNETRIDEDYRKQLTLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQ 1235
            LV  + RID   + +L   L+G++L  S+LFND A PL Y+EI L IFK++ F+D +VI 
Sbjct: 301  LVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIM 360

Query: 1236 GEWNRLLDSMKNAPSPDVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVHFLMNKILES 1295
             +W+ L  S++   +         +F++ +SN LI+IGK  +D++ +FP+  L   +   
Sbjct: 361  AKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNF 420

Query: 1296 FID---KSSAADGSVCSMFLLAGVSHLKLYYILSRIIENSEGNVELAKKEMVWLIKDWYQ 1352
            F +   K     GS+ S+F+ AGVS  K+YYIL  +IE S+ +  +  KEM WLI +WY+
Sbjct: 421  FYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYK 480

Query: 1353 SDSDLRGSIAPEQIKKLEKYDPNTDPVQDYVKDRHHGL 1390
            SD   R  I+   I  L++Y  + DP++ YVK+  + L
Sbjct: 481  SDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNL 518
>5HB1:1:A|pdbid|entity|chain(s)|sequence
          Length = 830

 Score =  231 bits (590), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 192/767 (25%), Positives = 349/767 (45%), Gaps = 72/767 (9%)

Query: 613  CYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKSSALAFFSAGIPGV 672
            C    D+  E  +     FI+ YG  E  + AL +AC   +   +++        G+   
Sbjct: 13   CVSASDDALEREVRK---FINQYGRVETIAAALAVAC--GQGSDLRTGT----GRGMDRN 63

Query: 673  VEIKPKSSR-ESGSVPPISQNLFDKSGECDGIVLSPRFYGSALLITRLFSQIWEERVFVF 731
             E   +++  E G  P ++++   K    + + LS R    AL +TRL   +W+ +V   
Sbjct: 64   TENLARAAFIEYGGQPRLAES-DGKQSVSESVRLSSRHDALALYLTRLVRTLWKAKVVQV 122

Query: 732  KRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNIHRPSFVSFVPPK----GSNAITA 787
               S          +I   ++     ++  L +F   ++ +     PP     G     A
Sbjct: 123  GSGSDISS------TIPTSKLVTIQENVERLRNFLEANKSTIQGLAPPSERLFGRQEDIA 176

Query: 788  SDAESIAMNALILLINSIKDALSLINVFYED--IDAFKSLLNTLMGAGGVYDSKTREYFF 845
            +  E  A++AL  L+ SI + +S + + +++   D +  L           D+ +++   
Sbjct: 177  NQKEHQALHALQKLMESISEGISFVLMLFDERVSDIYARL-----------DAVSQQQLK 225

Query: 846  DLKFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFGSFCHSADILCYR 905
            DL +  LF+     K+L K ++  +VN NIASG + + + + L+ R GSFC   D++ ++
Sbjct: 226  DLTYEQLFS-QTPGKELAKVLVKAIVNRNIASGANVETVADALRRRCGSFCSPDDVVTFK 284

Query: 906  AGEHLEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNYQPKTVG 965
            A E L+ A + +  +S + R  L  ++ L+E+ A ++    L   V+  + L Y    + 
Sbjct: 285  AQEQLQRASE-QAHNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISLKYYAGAIQ 343

Query: 966  FLLRFADKIDKGNQAQEYVSRGCNTADPRKVFYDKRINVYTLIFEIVKSVD-DYTS---- 1020
              L  A + D+GN A  +V+ G    D RK  +D+R   Y LI +++  ++ D+      
Sbjct: 344  LCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLESDFAGEPEL 403

Query: 1021 IEQSPSIANISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLRLDSQFV 1080
            ++  P++A        ++ +   Y+V+ +S++  FH+  Y+W +     D +L +DS  V
Sbjct: 404  VDGRPTLA--------ATKRMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRILSIDSPHV 455

Query: 1081 LPYLKERAEKSLEISNLLWFYLFKEEHFLEAADVLYALASSDFDLKLSERIECLARANGL 1140
            + YL+  AE     + LL  +      F EAA V   LA SD ++ L +RI  L+RA G 
Sbjct: 456  ITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRIILLSRAKGN 515

Query: 1141 CDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLTLKLNGRVL 1200
               +T    +    QL+    EL +IA IQDDLL  +  + RI E+ + ++   L+G + 
Sbjct: 516  ASVNTIGISRQQQQQLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIEEFLDGPIR 575

Query: 1201 PLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMK-------------- 1246
             L+DLFND AD  +YY++ L IF  + F + + I   WN L++                 
Sbjct: 576  TLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFEAEQRREYWEIVQ 635

Query: 1247 ---NAPSPDVGSVGQESF-LSSISNTLIRIGKTTRDTDVVFPVHFLMNKILESFI----D 1298
               + P+  +  + +       +S  +  I   T    ++FPV+ L+  +    I    D
Sbjct: 636  AGGDLPAGVIAPIAEPPLPYVYVSQQIQLIAHRTSLDSLIFPVNSLLPVVCAYAINNGQD 695

Query: 1299 KSSAADGS-VCSMFLLAGVSHLKLYYILSRIIENSEGNVELAKKEMV 1344
             S  AD      +FL  GV H  +  +L  +++  E      ++++V
Sbjct: 696  ASIGADPCWPIQLFLNLGVPHALVVQVLENVLDTQEAPFTGRRRKLV 742
>5HAY:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 586

 Score =  189 bits (480), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 132/494 (26%), Positives = 236/494 (47%), Gaps = 37/494 (7%)

Query: 879  TSADYIVNVLKERFGSFCHSADILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYERC 938
            ++ + + + L+ R GSFC   D++ ++A E L+ A + +  +S + R  L  ++ L+E+ 
Sbjct: 1    SNVETVADALRRRCGSFCSPDDVVTFKAQEQLQRASE-QAHNSPVLRALLAESLRLFEQV 59

Query: 939  AENIELCELRRVVDIMVKLNYQPKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKVFY 998
            A ++    L   V+ M+ L Y    +   L  A + D+GN A  +V+ G    D RK  +
Sbjct: 60   AGSLTPANLTTAVEQMISLKYYAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAF 119

Query: 999  DKRINVYTLIFEIVKSVD-DYTS----IEQSPSIANISIFSPASSLKKRVYSVIMNSNNR 1053
            D+R   Y LI +++  ++ D+      ++  P++A        ++ +   Y+V+ +S++ 
Sbjct: 120  DERKICYNLIHQVLDKLESDFAGEPELVDGRPTLA--------ATKRMEAYNVVNDSSDE 171

Query: 1054 FFHYCFYDWLVANKRQDYLLRLDSQFVLPYLKERAEKSLEISNLLWFYLFKEEHFLEAAD 1113
             FH+  Y+W +     D +L +DS  V+ YL+  AE     + LL  +      F EAA 
Sbjct: 172  VFHFDMYEWYIEKGWTDRILSIDSPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQ 231

Query: 1114 VLYALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDL 1173
            V   LA SD ++ L +RI  L+RA G    +T    +    QL+    EL +IA IQDDL
Sbjct: 232  VQTNLAKSDLNISLKDRIILLSRAKGNASVNTIGISRQQQQQLNHEASELLEIAHIQDDL 291

Query: 1174 LNLVRNETRIDEDYRKQLTLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKV 1233
            L  +  + RI E+ + ++   L+G +  L+DLFND AD  +YY++ L IF  + F + + 
Sbjct: 292  LERLVADPRIPEERKAEIEEFLDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRT 351

Query: 1234 IQGEWNRLLDSMK-----------------NAPSPDVGSVGQESF-LSSISNTLIRIGKT 1275
            I   WN L++                    + P+  +  + +       +S  +  I   
Sbjct: 352  IMDTWNNLINQSHFEAEQRREYWEIVQAGGDLPAGVIAPIAEPPLPYVYVSQQIQLIAHR 411

Query: 1276 TRDTDVVFPVHFLMNKILESFI----DKSSAADGS-VCSMFLLAGVSHLKLYYILSRIIE 1330
            T    ++FPV+ L+  +    I    D S  AD      +FL  GV H  +  +L  +++
Sbjct: 412  TSLDSLIFPVNSLLPVVCAYAINNGQDASIGADPCWPIQLFLNLGVPHALMVQVLENVLD 471

Query: 1331 NSEGNVELAKKEMV 1344
              E      ++++V
Sbjct: 472  TQEAPFTGRRRKLV 485
>5HAX:1:A|pdbid|entity|chain(s)|sequence
          Length = 742

 Score =  177 bits (450), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 204/833 (24%), Positives = 349/833 (41%), Gaps = 142/833 (17%)

Query: 90  PLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSDEVGGLGAFTPFQRQQVTNIPDE 149
           P+  A++ V      D + P LD+  Y   G   ++  +     ++ PF   +  NIPD+
Sbjct: 5   PVAKAAQVVNQTLQLDDSYPDLDS--YCRPGASSDYEMQSSD-SSWAPFHVVRHHNIPDK 61

Query: 150 VLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINN-SSEYHCIDEIEHTILKVKLVK 208
           V   ++  E+ + +G+F E+ Y W + D+ L LW+  + + E    +E  HTI  V LV 
Sbjct: 62  VFEHLNAGEVFTKLGLFAEIGYAWASIDSSLFLWDYTHPNPELIGYEEATHTITAVALVP 121

Query: 209 PSPNTFVSSVENLLIVATLFDIYILTISFN---DRTHELNIFNTGLKVNVTGFNVSNIIS 265
           P P  FV ++ ++L+VAT  +I +L +S       +  L +++T + V+  G +VS I+ 
Sbjct: 122 PKPGVFVKTITHVLVVATTSEIILLGVSATPTPSGSKSLTLYSTRMSVHRGGSDVSFIVG 181

Query: 266 YERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKSNLANLLPTKLIPSIPGGK 325
             + G+IF  G +D  ++ E+ Y   E  F+S+  KI                 S P G 
Sbjct: 182 -TKDGRIFLGGESD-TDIHEIFYQQEERWFSSRCGKIN---------------HSHPFGS 224

Query: 326 LIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYLITSNGLVGPV-------- 377
             Q+ L G           L VD +R +L++LS +S +R+Y +     +  V        
Sbjct: 225 RQQEWLRG-----------LYVDDTRNLLYSLSNRSTIRTYHMEGPEKLTKVIEKDKTSC 273

Query: 378 LIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDLFLAVITTTGVRL----- 432
           L D AH+          +SPL +++   I  +  I   E + L L  +T TG RL     
Sbjct: 274 LRDFAHM--------ADSSPLFTDKT-NIVALSPIPATEASKLHLMALTDTGCRLFLSAT 324

Query: 433 ----YFKGSISRRSIGSLKLDSVKFPPTSISSSLEQNKSFIIGHHPLNTHDTGPLSTQKA 488
               Y  G  +  +  S++L  VKFPP    + +      II             S    
Sbjct: 325 SSASYTMGGATSLAPQSMQLQFVKFPPRESPTRIRTLNGQIID------------SQLDK 372

Query: 489 SSTYINTTCASTIISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYVSAPDYGIL 548
           +S  ++ +      SPG +F  VRK  N                  +  L+VSAPD G +
Sbjct: 373 TSRALDPSALGFRFSPGYFFDVVRKHPN------------------QDMLFVSAPDTGRI 414

Query: 549 K-----NYGKYVENTAL--LDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLKV 601
           K     +  KY E      L+  +   EI   T  F     P G+ N  A Q+   P + 
Sbjct: 415 KVTQPASALKYFEQGTWIELENGNRTIEIGLTTAPFAAAKQPLGFGNELAVQFDQVPGEF 474

Query: 602 AVLTSNALEIYCYRTPDEVFESLIENPLP------------FIHSYGLSEACSTALYLAC 649
           AVLT+  + I   R   ++F   + N +             FI+ YG  E  + AL +AC
Sbjct: 475 AVLTNTGVHIVRRRRLVDIFAKALGNCVSASDDALEREVRKFINQYGRVETIAAALAVAC 534

Query: 650 KFNKSEHIKSSALAFFSAGIPGVVEIKPKSSR-ESGSVPPISQNLFDKSGECDGIVLSPR 708
              +   +++        G+    E   +++  E G  P ++++   K    + + LS R
Sbjct: 535 --GQGSDLRTGT----GRGMDRNTENLARAAFIEYGGQPRLAES-DGKQSVSESVRLSSR 587

Query: 709 FYGSALLITRLFSQIWEERVFVFKRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNI 768
               AL +TRL   +W+ +V      S          +I   ++     ++  L +F   
Sbjct: 588 HDALALYLTRLVRTLWKAKVVQVGSGSDISS------TIPTSKLVTIQENVERLRNFLEA 641

Query: 769 HRPSFVSFVPPK----GSNAITASDAESIAMNALILLINSIKDALSLINVFYED--IDAF 822
           ++ +     PP     G     A+  E  A++AL  L+ SI + +S + + +++   D +
Sbjct: 642 NKSTIQGLAPPSERLFGRQEDIANQKEHQALHALQKLMESISEGISFVLMLFDERVSDIY 701

Query: 823 KSLLNTLMGAGGVYDSKTREYFFDLKFHDLFTPNAKTKQLIKEILIEVVNANI 875
             L           D+ +++   DL +  LF+     K+L K ++  +VN NI
Sbjct: 702 ARL-----------DAVSQQQLKDLTYEQLFS-QTPGKELAKVLVKAIVNRNI 742
>3I5Q:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 252

 Score =  173 bits (439), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/241 (37%), Positives = 145/241 (60%), Gaps = 3/241 (1%)

Query: 1153 LVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLTLKLNGRVLPLSDLFNDCADP 1212
            +VQL+  I +  ++A IQ D+L+LV  + RID   + +L   L+G++L  S+LFND A P
Sbjct: 5    IVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVP 64

Query: 1213 LDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMKNAPSPDVGSVGQESFLSSISNTLIRI 1272
            L Y+EI L IFK++ F+D +VI  +W+ L  S++   +         +F++ +SN LI+I
Sbjct: 65   LSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKI 124

Query: 1273 GKTTRDTDVVFPVHFLMNKILESFID---KSSAADGSVCSMFLLAGVSHLKLYYILSRII 1329
            GK  +D++ +FP+  L   +   F +   K     GS+ S+F+ AGVS  K+YYIL  +I
Sbjct: 125  GKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELI 184

Query: 1330 ENSEGNVELAKKEMVWLIKDWYQSDSDLRGSIAPEQIKKLEKYDPNTDPVQDYVKDRHHG 1389
            E S+ +  +  KEM WLI +WY+SD   R  I+   I  L++Y  + DP++ YVK+  + 
Sbjct: 185  ETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNN 244

Query: 1390 L 1390
            L
Sbjct: 245  L 245
>5HAZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 567

 Score =  171 bits (434), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 126/475 (26%), Positives = 224/475 (47%), Gaps = 37/475 (7%)

Query: 898  SADILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKL 957
            S D++ ++A E L+ A + +  +S + R  L  ++ L+E+ A ++    L   V+  + L
Sbjct: 1    SDDVVTFKAQEQLQRASE-QAHNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISL 59

Query: 958  NYQPKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKVFYDKRINVYTLIFEIVKSVD- 1016
             Y    +   L  A + D+GN A  +V+ G    D RK  +D+R   Y LI +++  ++ 
Sbjct: 60   KYYAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLES 119

Query: 1017 DYTS----IEQSPSIANISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYL 1072
            D+      ++  P++A        ++ +   Y+V+ +S++  FH+  Y+W +     D +
Sbjct: 120  DFAGEPELVDGRPTLA--------ATKRMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRI 171

Query: 1073 LRLDSQFVLPYLKERAEKSLEISNLLWFYLFKEEHFLEAADVLYALASSDFDLKLSERIE 1132
            L +DS  V+ YL+  AE     + LL  +      F EAA V   LA SD ++ L +RI 
Sbjct: 172  LSIDSPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRII 231

Query: 1133 CLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLT 1192
             L+RA G    +T    +    QL+    EL +IA IQDDLL  +  + RI E+ + ++ 
Sbjct: 232  LLSRAKGNASVNTIGISRQQQQQLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIE 291

Query: 1193 LKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMK------ 1246
              L+G +  L+DLFND AD  +YY++ L IF  + F + + I   WN L++         
Sbjct: 292  EFLDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFEAEQR 351

Query: 1247 -----------NAPSPDVGSVGQESF-LSSISNTLIRIGKTTRDTDVVFPVHFLMNKILE 1294
                       + P+  +  + +       +S  +  I   T    ++FPV+ L+  +  
Sbjct: 352  REYWEIVQAGGDLPAGVIAPIAEPPLPYVYVSQQIQLIAHRTSLDSLIFPVNSLLPVVCA 411

Query: 1295 SFI----DKSSAADGS-VCSMFLLAGVSHLKLYYILSRIIENSEGNVELAKKEMV 1344
              I    D S  AD      +FL  GV H  +  +L  +++  E      ++++V
Sbjct: 412  YAINNGQDASIGADPCWPIQLFLNLGVPHALVVQVLENVLDTQEAPFTGRRRKLV 466
>5HB0:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 549

 Score =  169 bits (428), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 125/473 (26%), Positives = 223/473 (47%), Gaps = 37/473 (7%)

Query: 900  DILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNY 959
            D++ ++A E L+ A + +  +S + R  L  ++ L+E+ A ++    L   V+  + L Y
Sbjct: 2    DVVTFKAQEQLQRASE-QAHNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISLKY 60

Query: 960  QPKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKVFYDKRINVYTLIFEIVKSVD-DY 1018
                +   L  A + D+GN A  +V+ G    D RK  +D+R   Y LI +++  ++ D+
Sbjct: 61   YAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLESDF 120

Query: 1019 TS----IEQSPSIANISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLR 1074
                  ++  P++A        ++ +   Y+V+ +S++  FH+  Y+W +     D +L 
Sbjct: 121  AGEPELVDGRPTLA--------ATKRMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRILS 172

Query: 1075 LDSQFVLPYLKERAEKSLEISNLLWFYLFKEEHFLEAADVLYALASSDFDLKLSERIECL 1134
            +DS  V+ YL+  AE     + LL  +      F EAA V   LA SD ++ L +RI  L
Sbjct: 173  IDSPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRIILL 232

Query: 1135 ARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLTLK 1194
            +RA G    +T    +    QL+    EL +IA IQDDLL  +  + RI E+ + ++   
Sbjct: 233  SRAKGNASVNTIGISRQQQQQLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIEEF 292

Query: 1195 LNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMK-------- 1246
            L+G +  L+DLFND AD  +YY++ L IF  + F + + I   WN L++           
Sbjct: 293  LDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFEAEQRRE 352

Query: 1247 ---------NAPSPDVGSVGQESF-LSSISNTLIRIGKTTRDTDVVFPVHFLMNKILESF 1296
                     + P+  +  + +       +S  +  I   T    ++FPV+ L+  +    
Sbjct: 353  YWEIVQAGGDLPAGVIAPIAEPPLPYVYVSQQIQLIAHRTSLDSLIFPVNSLLPVVCAYA 412

Query: 1297 I----DKSSAADGS-VCSMFLLAGVSHLKLYYILSRIIENSEGNVELAKKEMV 1344
            I    D S  AD      +FL  GV H  +  +L  +++  E      ++++V
Sbjct: 413  INNGQDASIGADPCWPIQLFLNLGVPHALVVQVLENVLDTQEAPFTGRRRKLV 465
>5IJO:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence
          Length = 1391

 Score =  110 bits (275), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 160/346 (46%), Gaps = 57/346 (16%)

Query: 146 IPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIEHTILKVK 205
           +P E++ Q  + +    MG+F  ++  W+T D+ + +WN  +  +    D +  TIL V 
Sbjct: 89  LPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVG 148

Query: 206 LVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIFNTGLKVNV---------- 255
           LVKP    F   V +LL++AT  DI IL +S+ +      + N  L   +          
Sbjct: 149 LVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSL 208

Query: 256 -TGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKSNLANLLP 314
            T       I+    G+IF  G  DG  ++E+ Y      F+ +  KI  +KS+L+ L+P
Sbjct: 209 PTDNTYLLTITSTDNGRIFLAG-KDGC-LYEVAYQAEAGWFSQRCRKINHSKSSLSFLVP 266

Query: 315 TKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYLITSNGLV 374
           +          L+Q        +E++ I Q+ +D SR +L+T S K +++ Y +  +G  
Sbjct: 267 S----------LLQFTF-----SEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDG-- 309

Query: 375 GPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAK---------IVSISMCENN---DLFL 422
                      +GM+ +   +   + + A  IA+         IV I++ EN+   D  L
Sbjct: 310 -----------QGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQL 358

Query: 423 AVITTTGVRLYFKGSISRRSIG---SLKLDSVKFPPT-SISSSLEQ 464
             +T  GVRLYF     R+ +    +L L  V+ PP  S SS++E+
Sbjct: 359 LAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEK 404

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 130/638 (20%), Positives = 257/638 (40%), Gaps = 77/638 (12%)

Query: 703  IVLSPRFYGSALLITRLFSQIWE-----ERVFVFKRASKTEKMDAFGISITRPQVEYYLS 757
            IV S +  G  +  +R+   IW+     ER+F     S   ++ A   S+    +E  L 
Sbjct: 657  IVYSGKHNGICIYFSRIMGNIWDASLVVERIF----KSGNREITAIESSVPCQLLESVLQ 712

Query: 758  SISVLADFFN---------IHRPS--------FVSFVPPKGSNAIT-----------ASD 789
             +  L +F +         +  P+         + F+ P+  N              A  
Sbjct: 713  ELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQL 772

Query: 790  AESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDLKF 849
            +E I++ A+  L+     AL+L  +  E    F  ++  L         + +E      F
Sbjct: 773  SEKISLQAIQQLVRKSYQALALWKLLCEH--QFTIIVAEL-------QKELQEQLKITTF 823

Query: 850  HDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFGSFCHSADILCYRAGEH 909
             DL     + K+L   ++  ++N  I    + D I   L++       + D +C +A E 
Sbjct: 824  KDLVI---RDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL 880

Query: 910  LEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNYQPKTVGFLLR 969
            L+ +++ +    K     L  ++  Y++ +  ++L     V     ++ +    V   L 
Sbjct: 881  LQRSRQVQNKTEK--ERMLRESLKEYQKISNQVDLSN---VCAQYRQVRFYEGVVELSLT 935

Query: 970  FADKIDKGNQAQEYVSRGCNTADPRKV-FYDKRINVYTLIFEIVKS-VDDYTSIEQSPSI 1027
             A+K D       +   G    D   +  + +R+N Y  I + ++  V+   +  QSPS+
Sbjct: 936  AAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSV 995

Query: 1028 A------------NISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLRL 1075
                         N+     A    +++  +   S +  F    Y+WL+     D LL++
Sbjct: 996  PKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQV 1055

Query: 1076 DSQFVLPYLKERA---EKSLEISNLLWFYLFKEEHFLEAADVLYALAS-SDFDLKLSERI 1131
             S F+ P+L   A   +  +   +LLW Y  K   F  AA VL  LA     ++ L +R+
Sbjct: 1056 ASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRL 1115

Query: 1132 ECLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
            E +ARA     SST+     A  +    + E  ++A IQ  +   ++ +       +  +
Sbjct: 1116 EYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAV 1175

Query: 1192 TLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMKNAPSP 1251
            + +L+  ++ ++ L+ + ADP    E KL I   + + D  ++Q  W  +++   +    
Sbjct: 1176 S-QLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELS---- 1230

Query: 1252 DVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVHFLM 1289
            D  ++     + ++S  ++ +GK    T   FP+ F++
Sbjct: 1231 DSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIV 1268
>5IJN:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence
          Length = 1391

 Score =  110 bits (275), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 160/346 (46%), Gaps = 57/346 (16%)

Query: 146 IPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIEHTILKVK 205
           +P E++ Q  + +    MG+F  ++  W+T D+ + +WN  +  +    D +  TIL V 
Sbjct: 89  LPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVG 148

Query: 206 LVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIFNTGLKVNV---------- 255
           LVKP    F   V +LL++AT  DI IL +S+ +      + N  L   +          
Sbjct: 149 LVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSL 208

Query: 256 -TGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKSNLANLLP 314
            T       I+    G+IF  G  DG  ++E+ Y      F+ +  KI  +KS+L+ L+P
Sbjct: 209 PTDNTYLLTITSTDNGRIFLAG-KDGC-LYEVAYQAEAGWFSQRCRKINHSKSSLSFLVP 266

Query: 315 TKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYLITSNGLV 374
           +          L+Q        +E++ I Q+ +D SR +L+T S K +++ Y +  +G  
Sbjct: 267 S----------LLQFTF-----SEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDG-- 309

Query: 375 GPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAK---------IVSISMCENN---DLFL 422
                      +GM+ +   +   + + A  IA+         IV I++ EN+   D  L
Sbjct: 310 -----------QGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQL 358

Query: 423 AVITTTGVRLYFKGSISRRSIG---SLKLDSVKFPPT-SISSSLEQ 464
             +T  GVRLYF     R+ +    +L L  V+ PP  S SS++E+
Sbjct: 359 LAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEK 404

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 130/638 (20%), Positives = 257/638 (40%), Gaps = 77/638 (12%)

Query: 703  IVLSPRFYGSALLITRLFSQIWE-----ERVFVFKRASKTEKMDAFGISITRPQVEYYLS 757
            IV S +  G  +  +R+   IW+     ER+F     S   ++ A   S+    +E  L 
Sbjct: 657  IVYSGKHNGICIYFSRIMGNIWDASLVVERIF----KSGNREITAIESSVPCQLLESVLQ 712

Query: 758  SISVLADFFN---------IHRPS--------FVSFVPPKGSNAIT-----------ASD 789
             +  L +F +         +  P+         + F+ P+  N              A  
Sbjct: 713  ELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQL 772

Query: 790  AESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDLKF 849
            +E I++ A+  L+     AL+L  +  E    F  ++  L         + +E      F
Sbjct: 773  SEKISLQAIQQLVRKSYQALALWKLLCEH--QFTIIVAEL-------QKELQEQLKITTF 823

Query: 850  HDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFGSFCHSADILCYRAGEH 909
             DL     + K+L   ++  ++N  I    + D I   L++       + D +C +A E 
Sbjct: 824  KDLVI---RDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL 880

Query: 910  LEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNYQPKTVGFLLR 969
            L+ +++ +    K     L  ++  Y++ +  ++L     V     ++ +    V   L 
Sbjct: 881  LQRSRQVQNKTEK--ERMLRESLKEYQKISNQVDLSN---VCAQYRQVRFYEGVVELSLT 935

Query: 970  FADKIDKGNQAQEYVSRGCNTADPRKV-FYDKRINVYTLIFEIVKS-VDDYTSIEQSPSI 1027
             A+K D       +   G    D   +  + +R+N Y  I + ++  V+   +  QSPS+
Sbjct: 936  AAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSV 995

Query: 1028 A------------NISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLRL 1075
                         N+     A    +++  +   S +  F    Y+WL+     D LL++
Sbjct: 996  PKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQV 1055

Query: 1076 DSQFVLPYLKERA---EKSLEISNLLWFYLFKEEHFLEAADVLYALAS-SDFDLKLSERI 1131
             S F+ P+L   A   +  +   +LLW Y  K   F  AA VL  LA     ++ L +R+
Sbjct: 1056 ASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRL 1115

Query: 1132 ECLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
            E +ARA     SST+     A  +    + E  ++A IQ  +   ++ +       +  +
Sbjct: 1116 EYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAV 1175

Query: 1192 TLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMKNAPSP 1251
            + +L+  ++ ++ L+ + ADP    E KL I   + + D  ++Q  W  +++   +    
Sbjct: 1176 S-QLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELS---- 1230

Query: 1252 DVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVHFLM 1289
            D  ++     + ++S  ++ +GK    T   FP+ F++
Sbjct: 1231 DSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIV 1268
>5A9Q:10:A,B|pdbid|entity|chain(s)|sequence
          Length = 1391

 Score =  110 bits (275), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 160/346 (46%), Gaps = 57/346 (16%)

Query: 146 IPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIEHTILKVK 205
           +P E++ Q  + +    MG+F  ++  W+T D+ + +WN  +  +    D +  TIL V 
Sbjct: 89  LPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVG 148

Query: 206 LVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIFNTGLKVNV---------- 255
           LVKP    F   V +LL++AT  DI IL +S+ +      + N  L   +          
Sbjct: 149 LVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSL 208

Query: 256 -TGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKSNLANLLP 314
            T       I+    G+IF  G  DG  ++E+ Y      F+ +  KI  +KS+L+ L+P
Sbjct: 209 PTDNTYLLTITSTDNGRIFLAG-KDGC-LYEVAYQAEAGWFSQRCRKINHSKSSLSFLVP 266

Query: 315 TKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYLITSNGLV 374
           +          L+Q        +E++ I Q+ +D SR +L+T S K +++ Y +  +G  
Sbjct: 267 S----------LLQFTF-----SEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDG-- 309

Query: 375 GPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAK---------IVSISMCENN---DLFL 422
                      +GM+ +   +   + + A  IA+         IV I++ EN+   D  L
Sbjct: 310 -----------QGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQL 358

Query: 423 AVITTTGVRLYFKGSISRRSIG---SLKLDSVKFPPT-SISSSLEQ 464
             +T  GVRLYF     R+ +    +L L  V+ PP  S SS++E+
Sbjct: 359 LAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEK 404

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 130/638 (20%), Positives = 257/638 (40%), Gaps = 77/638 (12%)

Query: 703  IVLSPRFYGSALLITRLFSQIWE-----ERVFVFKRASKTEKMDAFGISITRPQVEYYLS 757
            IV S +  G  +  +R+   IW+     ER+F     S   ++ A   S+    +E  L 
Sbjct: 657  IVYSGKHNGICIYFSRIMGNIWDASLVVERIF----KSGNREITAIESSVPCQLLESVLQ 712

Query: 758  SISVLADFFN---------IHRPS--------FVSFVPPKGSNAIT-----------ASD 789
             +  L +F +         +  P+         + F+ P+  N              A  
Sbjct: 713  ELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQL 772

Query: 790  AESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDLKF 849
            +E I++ A+  L+     AL+L  +  E    F  ++  L         + +E      F
Sbjct: 773  SEKISLQAIQQLVRKSYQALALWKLLCEH--QFTIIVAEL-------QKELQEQLKITTF 823

Query: 850  HDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFGSFCHSADILCYRAGEH 909
             DL     + K+L   ++  ++N  I    + D I   L++       + D +C +A E 
Sbjct: 824  KDLVI---RDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL 880

Query: 910  LEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNYQPKTVGFLLR 969
            L+ +++ +    K     L  ++  Y++ +  ++L     V     ++ +    V   L 
Sbjct: 881  LQRSRQVQNKTEK--ERMLRESLKEYQKISNQVDLSN---VCAQYRQVRFYEGVVELSLT 935

Query: 970  FADKIDKGNQAQEYVSRGCNTADPRKV-FYDKRINVYTLIFEIVKS-VDDYTSIEQSPSI 1027
             A+K D       +   G    D   +  + +R+N Y  I + ++  V+   +  QSPS+
Sbjct: 936  AAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSV 995

Query: 1028 A------------NISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLRL 1075
                         N+     A    +++  +   S +  F    Y+WL+     D LL++
Sbjct: 996  PKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQV 1055

Query: 1076 DSQFVLPYLKERA---EKSLEISNLLWFYLFKEEHFLEAADVLYALAS-SDFDLKLSERI 1131
             S F+ P+L   A   +  +   +LLW Y  K   F  AA VL  LA     ++ L +R+
Sbjct: 1056 ASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRL 1115

Query: 1132 ECLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
            E +ARA     SST+     A  +    + E  ++A IQ  +   ++ +       +  +
Sbjct: 1116 EYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAV 1175

Query: 1192 TLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMKNAPSP 1251
            + +L+  ++ ++ L+ + ADP    E KL I   + + D  ++Q  W  +++   +    
Sbjct: 1176 S-QLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELS---- 1230

Query: 1252 DVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVHFLM 1289
            D  ++     + ++S  ++ +GK    T   FP+ F++
Sbjct: 1231 DSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIV 1268
>4P1N:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 275

 Score = 34.3 bits (77), Expect = 1.5,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 11/73 (15%)

Query: 1185 EDYRKQLTLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGE------- 1237
            E+  K  TLKLN  V  + D FN+C D  ++  ++L++  ++Q +D +V+  E       
Sbjct: 129  ENESKNCTLKLNILVQWIRDRFNECLDKAEF--LRLKLHTLNQSEDPQVLDDEPTIFVEK 186

Query: 1238 --WNRLLDSMKNA 1248
              ++R LD  +NA
Sbjct: 187  LIYDRALDISRNA 199
>3J6B:18:R|pdbid|entity|chain(s)|sequence
          Length = 371

 Score = 33.5 bits (75), Expect = 3.1,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 43/89 (48%)

Query: 1103 FKEEHFLEAADVLYALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHE 1162
            F   ++L+  + L A   S  + KLSE +  +   + L +SSTSF+ K  L Q      +
Sbjct: 216  FNSRYYLKEEERLKARRESWTNEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEK 275

Query: 1163 LFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
                A + +DL      ET+ D++Y K L
Sbjct: 276  QALKAKLLEDLEKSQHLETKKDKNYIKAL 304
>3BJD:1:A,B,C|pdbid|entity|chain(s)|sequence
          Length = 332

 Score = 33.1 bits (74), Expect = 3.2,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 1105 EEHFLEAADVLYALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENI-HEL 1163
            EE F+ AAD+  AL+  DF  +L + I   +R      S   F    +  QL   + H+ 
Sbjct: 92   EERFMPAADLSRALSEEDFQKRLEQEIAAQSRERHPM-SQYVFSGSASRAQLQVFLRHQW 150

Query: 1164 FDIASIQDDLLNLVRNETRIDE 1185
            F    +  D  +L+ N T +DE
Sbjct: 151  FRTFRLYRDAADLLVNLTDVDE 172
>5MRF:18:R|pdbid|entity|chain(s)|sequence
          Length = 337

 Score = 33.1 bits (74), Expect = 3.3,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 43/89 (48%)

Query: 1103 FKEEHFLEAADVLYALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHE 1162
            F   ++L+  + L A   S  + KLSE +  +   + L +SSTSF+ K  L Q      +
Sbjct: 182  FNSRYYLKEEERLKARRESWTNEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEK 241

Query: 1163 LFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
                A + +DL      ET+ D++Y K L
Sbjct: 242  QALKAKLLEDLEKSQHLETKKDKNYIKAL 270
>5MRE:18:R|pdbid|entity|chain(s)|sequence
          Length = 337

 Score = 33.1 bits (74), Expect = 3.3,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 43/89 (48%)

Query: 1103 FKEEHFLEAADVLYALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHE 1162
            F   ++L+  + L A   S  + KLSE +  +   + L +SSTSF+ K  L Q      +
Sbjct: 182  FNSRYYLKEEERLKARRESWTNEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEK 241

Query: 1163 LFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
                A + +DL      ET+ D++Y K L
Sbjct: 242  QALKAKLLEDLEKSQHLETKKDKNYIKAL 270
>5MRC:18:R|pdbid|entity|chain(s)|sequence
          Length = 337

 Score = 33.1 bits (74), Expect = 3.3,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 43/89 (48%)

Query: 1103 FKEEHFLEAADVLYALASSDFDLKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHE 1162
            F   ++L+  + L A   S  + KLSE +  +   + L +SSTSF+ K  L Q      +
Sbjct: 182  FNSRYYLKEEERLKARRESWTNEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEK 241

Query: 1163 LFDIASIQDDLLNLVRNETRIDEDYRKQL 1191
                A + +DL      ET+ D++Y K L
Sbjct: 242  QALKAKLLEDLEKSQHLETKKDKNYIKAL 270
  Database: pdb_polypeptide
    Posted date:  Sep 15, 2017  6:19 PM
  Number of letters in database: 49,994,932
  Number of sequences in database:  202,155
  
Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 202155
Number of Hits to DB: 131,154,849
Number of extensions: 5427906
Number of successful extensions: 13291
Number of sequences better than 10.0: 17
Number of HSP's gapped: 13426
Number of HSP's successfully gapped: 20
Length of query: 1391
Length of database: 49,994,932
Length adjustment: 119
Effective length of query: 1272
Effective length of database: 25,938,487
Effective search space: 32993755464
Effective search space used: 32993755464
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)