BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (1502 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3I5P:1:A|pdbid|entity|chain(s)|sequence                              1008   0.0  
4MHC:1:A|pdbid|entity|chain(s)|sequence                               707   0.0  
3I5Q:1:A,B|pdbid|entity|chain(s)|sequence                             470   e-131
5HB1:1:A|pdbid|entity|chain(s)|sequence                               268   4e-71
5HAY:1:A,B|pdbid|entity|chain(s)|sequence                             218   5e-56
5HAX:1:A|pdbid|entity|chain(s)|sequence                               214   1e-54
5HAZ:1:A|pdbid|entity|chain(s)|sequence                               188   8e-47
5HB0:1:A,B,C,D|pdbid|entity|chain(s)|sequence                         186   2e-46
5IJO:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence                     132   4e-30
5IJN:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence                     132   4e-30
5A9Q:10:A,B|pdbid|entity|chain(s)|sequence                            132   4e-30
4IWB:1:A,B|pdbid|entity|chain(s)|sequence                              36   0.52 
1ORY:1:A|pdbid|entity|chain(s)|sequence                                35   0.87 
1ORJ:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          35   0.87 
5WGY:1:A|pdbid|entity|chain(s)|sequence                                34   2.1  
5WGV:1:A|pdbid|entity|chain(s)|sequence                                34   2.1  
4EXJ:1:A,B|pdbid|entity|chain(s)|sequence                              33   3.1  
5HC8:1:A|pdbid|entity|chain(s)|sequence                                33   5.4  
5HC7:1:A|pdbid|entity|chain(s)|sequence                                33   5.4  
5HC6:1:A|pdbid|entity|chain(s)|sequence                                33   5.4  
5B16:1:A|pdbid|entity|chain(s)|sequence                                32   6.2  
>3I5P:1:A|pdbid|entity|chain(s)|sequence
          Length = 525

 Score = 1008 bits (2605), Expect = 0.0,   Method: Composition-based stats.
 Identities = 512/525 (97%), Positives = 512/525 (97%)

Query: 978  GASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQ 1037
            G SIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQ
Sbjct: 1    GPSIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQ 60

Query: 1038 IVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQY 1097
            IVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQY
Sbjct: 61   IVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQY 120

Query: 1098 YDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLF 1157
            YDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLF
Sbjct: 121  YDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLF 180

Query: 1158 HYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEIL 1217
            HYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEIL
Sbjct: 181  HYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEIL 240

Query: 1218 YRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILS 1277
            YRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILS
Sbjct: 241  YRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILS 300

Query: 1278 LVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIM 1337
            LVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIM
Sbjct: 301  LVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIM 360

Query: 1338 AKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSXXXXXXXXXXXXVCNF 1397
            AKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDS            VCNF
Sbjct: 361  AKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNF 420

Query: 1398 FYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYK 1457
            FYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYK
Sbjct: 421  FYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYK 480

Query: 1458 SDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE 1502
            SDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Sbjct: 481  SDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE 525
>4MHC:1:A|pdbid|entity|chain(s)|sequence
          Length = 826

 Score =  707 bits (1824), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/917 (43%), Positives = 570/917 (62%), Gaps = 92/917 (10%)

Query: 78  SINPNMSNMNEHIRVSGMGTSKPLDLAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSR 137
           S+   + ++  H+++SG+ +S+PL LA +++  L  +D NTP+LD   YY+ G+DYNFS 
Sbjct: 1   SMESELRDVTTHVKISGLTSSEPLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSD 60

Query: 138 EKNGLGAFTPFEKQDVFNIPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINN 197
           E  GLGAFTPF++Q V NIPDE+L + S ++ K+DMGIF ELN CWIT DNKLILWNINN
Sbjct: 61  EVGGLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINN 120

Query: 198 DNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATNELSVF 257
            +EY  +D+++HTI KV LV+P PNTFV +V++LL+++T  ++++  IS +  T+EL++F
Sbjct: 121 SSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIF 180

Query: 258 NTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKS 317
           NT L V V G +V +I+S+ER+G+IFF G   G+N+WEL Y+ S++ FNSK +K+CLTKS
Sbjct: 181 NTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKS 240

Query: 318 ALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTI 377
            L +LLPT ++  IPG   IQ + E    G+ G  +ETI+QL +DQ RG++++LS+KS +
Sbjct: 241 NLANLLPTKLIPSIPGGKLIQKVLE----GDAGTEEETISQLEVDQSRGVLHTLSTKSIV 296

Query: 378 RAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLV 437
           R+Y+IT   L GP+ I+ A+I R +     + +P+L  +  KI KI S++  ENN+LFL 
Sbjct: 297 RSYLITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDLFLA 356

Query: 438 ALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSSVTPEVIXXXXXXXXXXXAKRSFPFFS 497
            +T  GVRLYF GS+ R +I +L+L+S+KFPP+S++  +              +SF    
Sbjct: 357 VITTTGVRLYFKGSISRRSIGSLKLDSVKFPPTSISSSL-----------EQNKSFIIGH 405

Query: 498 N-LMSSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQQTHQQEKKENSXXXXX 556
           + L + +   L  QK SS  + TT ASTIISPGI+F+ V           K+ NS     
Sbjct: 406 HPLNTHDTGPLSTQKASSTYINTTCASTIISPGIYFTCV----------RKRANSGELSK 455

Query: 557 XXXXXXXXXXQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLETAGPVQQIIPLSGLFN 616
                     ++    +HKL+VS PDYGILK +GKYVEN   L+T   +++I+PL+  FN
Sbjct: 456 GITNKALLENKE----EHKLYVSAPDYGILKNYGKYVENTALLDTTDEIKEIVPLTRSFN 511

Query: 617 ATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFEDLIDNPLPFVLNYGAA 676
            T+ PQG+AN FA+QY++E L+VAVLTS ++EIY YRTPDE+FE LI+NPLPF+ +YG +
Sbjct: 512 YTSTPQGYANVFASQYSAEPLKVAVLTSNALEIYCYRTPDEVFESLIENPLPFIHSYGLS 571

Query: 677 EACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRYSVSTVSSLLSKPTLST 736
           EACSTAL++ CK NKSE ++S+AL F + GIPGVV+IKP  +R S S        P +S 
Sbjct: 572 EACSTALYLACKFNKSEHIKSSALAFFSAGIPGVVEIKPKSSRESGSV-------PPIS- 623

Query: 737 ATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRLLRDIWGRHVFMTFTDN 796
              NL      F K         + D ++LSPRFYG ALLITRL   IW   VF+     
Sbjct: 624 --QNL------FDKSG-------ECDGIVLSPRFYGSALLITRLFSQIWEERVFV----- 663

Query: 797 RVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIEYYLSSINILNEFFITY 856
                 F  +S          K++++         +SI++  +EYYLSSI++L +FF  +
Sbjct: 664 ------FKRAS----------KTEKMDA-----FGISITRPQVEYYLSSISVLADFFNIH 702

Query: 857 GDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMVQSIKEGLSFLNVLYEE 916
             S      P      SN          A+ AESIA+NA+I ++ SIK+ LS +NV YE 
Sbjct: 703 RPSFVSFVPP----KGSNAI-------TASDAESIAMNALILLINSIKDALSLINVFYE- 750

Query: 917 SEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTKSLIREILLSIINRNIT 976
            +++ F +                ++    L F DLF PN KTK LI+EIL+ ++N NI 
Sbjct: 751 -DIDAFKSLLNTLMGAGGVYDSKTREYFFDLKFHDLFTPNAKTKQLIKEILIEVVNANIA 809

Query: 977 KGASIEYTATALQERCG 993
            G S +Y    L+ER G
Sbjct: 810 SGTSADYIVNVLKERFG 826
>3I5Q:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 252

 Score =  470 bits (1209), Expect = e-131,   Method: Composition-based stats.
 Identities = 238/250 (95%), Positives = 238/250 (95%)

Query: 1253 QRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFA 1312
            QRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFA
Sbjct: 3    QRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFA 62

Query: 1313 VPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLI 1372
            VPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLI
Sbjct: 63   VPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLI 122

Query: 1373 KIGKNVQDSXXXXXXXXXXXXVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKE 1432
            KIGKNVQDS            VCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKE
Sbjct: 123  KIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKE 182

Query: 1433 LIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSG 1492
            LIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSG
Sbjct: 183  LIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSG 242

Query: 1493 NNLGICFYKE 1502
            NNLGICFYKE
Sbjct: 243  NNLGICFYKE 252
>5HB1:1:A|pdbid|entity|chain(s)|sequence
          Length = 830

 Score =  268 bits (686), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 177/592 (29%), Positives = 303/592 (51%), Gaps = 63/592 (10%)

Query: 762  DDVILSPRFYGIALLITRLLRDIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDE 821
            + V LS R   +AL +TRL+R +W   V       +V S + ISS+ P +  +       
Sbjct: 92   ESVRLSSRHDALALYLTRLVRTLWKAKVV------QVGSGSDISSTIPTSKLVT------ 139

Query: 822  ISQNRNIISKVSISKDCIEYYLSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKT 881
            I +N                    +  L  F      +I  ++ P       + R+  + 
Sbjct: 140  IQEN--------------------VERLRNFLEANKSTIQGLAPP-------SERLFGRQ 172

Query: 882  EEVANQAESIAINAMIKMVQSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQ 941
            E++ANQ E  A++A+ K+++SI EG+SF+ +L++E              DI + +    Q
Sbjct: 173  EDIANQKEHQALHALQKLMESISEGISFVLMLFDER-----------VSDIYARLDAVSQ 221

Query: 942  KDLVKLDFKDLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDI 1001
            + L  L ++ LF+     K L + ++ +I+NRNI  GA++E  A AL+ RCGSFCS  D+
Sbjct: 222  QQLKDLTYEQLFS-QTPGKELAKVLVKAIVNRNIASGANVETVADALRRRCGSFCSPDDV 280

Query: 1002 LGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYP 1061
            + F+A E L+RA E    N   L   L  +  L EQ+   L+   L  AV   +S+ YY 
Sbjct: 281  VTFKAQEQLQRASEQA-HNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISLKYYA 339

Query: 1062 KSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVD-ELAE 1120
             +I+  L +A   D+G  A  +V +G   ND RK+ +D+R + Y+L+   L K++ + A 
Sbjct: 340  GAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLESDFAG 399

Query: 1121 KKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETP 1180
            + +    +  ++ +       R ++Y      +D +FH+ +Y+W + +   +++L I++P
Sbjct: 400  EPELVDGRPTLAATK------RMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRILSIDSP 453

Query: 1181 FILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRA- 1239
             ++ YL   A +  + + +L  +Y+ RS+FFE+A++   LA S+ +I+L +RI  LSRA 
Sbjct: 454  HVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRIILLSRAK 513

Query: 1240 -NGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLD 1298
             N   N++    Q+Q+  QL     +  E+A IQ D+L  +  D RI    K E+ + LD
Sbjct: 514  GNASVNTIGISRQQQQ--QLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIEEFLD 571

Query: 1299 GKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRME 1350
            G I + ++LFND+A   +Y+++ L IF  ADF +   I+  W+ L      E
Sbjct: 572  GPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFE 623
>5HAY:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 586

 Score =  218 bits (556), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 123/375 (32%), Positives = 206/375 (54%), Gaps = 12/375 (3%)

Query: 979  ASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQI 1038
            +++E  A AL+ RCGSFCS  D++ F+A E L+RA E    N   L   L  +  L EQ+
Sbjct: 1    SNVETVADALRRRCGSFCSPDDVVTFKAQEQLQRASEQA-HNSPVLRALLAESLRLFEQV 59

Query: 1039 VDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYY 1098
               L+   L  AV  M+S+ YY  +I+  L +A   D+G  A  +V +G   ND RK+ +
Sbjct: 60   AGSLTPANLTTAVEQMISLKYYAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAF 119

Query: 1099 DKRILVYDLVFDTLIKVD-ELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLF 1157
            D+R + Y+L+   L K++ + A + +    +  ++ +       R ++Y      +D +F
Sbjct: 120  DERKICYNLIHQVLDKLESDFAGEPELVDGRPTLAATK------RMEAYNVVNDSSDEVF 173

Query: 1158 HYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEIL 1217
            H+ MY+W + +   +++L I++P ++ YL   A +  + + +L  +Y+ RS+FFE+A++ 
Sbjct: 174  HFDMYEWYIEKGWTDRILSIDSPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQ 233

Query: 1218 YRLATSNFDITLFERIEFLSRA--NGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDI 1275
              LA S+ +I+L +RI  LSRA  N   N++    Q+Q+  QL     +  E+A IQ D+
Sbjct: 234  TNLAKSDLNISLKDRIILLSRAKGNASVNTIGISRQQQQ--QLNHEASELLEIAHIQDDL 291

Query: 1276 LSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEV 1335
            L  +  D RI    K E+ + LDG I + ++LFND+A   +Y+++ L IF  ADF +   
Sbjct: 292  LERLVADPRIPEERKAEIEEFLDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRT 351

Query: 1336 IMAKWDELFQSLRME 1350
            IM  W+ L      E
Sbjct: 352  IMDTWNNLINQSHFE 366
>5HAX:1:A|pdbid|entity|chain(s)|sequence
          Length = 742

 Score =  214 bits (544), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 229/913 (25%), Positives = 376/913 (41%), Gaps = 212/913 (23%)

Query: 100 PLDLAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSREKNGLGAFTPFEKQDVFNIPDE 159
           P+  A + ++     D + P LD  SY   G   ++  + +   ++ PF      NIPD+
Sbjct: 5   PVAKAAQVVNQTLQLDDSYPDLD--SYCRPGASSDYEMQSSD-SSWAPFHVVRHHNIPDK 61

Query: 160 ILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDN-EYQVVDDMKHTIQKVALVR 218
           +    +  +  T +G+F E+   W +ID+ L LW+  + N E    ++  HTI  VALV 
Sbjct: 62  VFEHLNAGEVFTKLGLFAEIGYAWASIDSSLFLWDYTHPNPELIGYEEATHTITAVALVP 121

Query: 219 PKPNTFVPAVKHLLLISTTMELFMFAISLD---KATNELSVFNTHLSVPVQGIDVIDIVS 275
           PKP  FV  + H+L+++TT E+ +  +S       +  L++++T +SV   G DV  IV 
Sbjct: 122 PKPGVFVKTITHVLVVATTSEIILLGVSATPTPSGSKSLTLYSTRMSVHRGGSDVSFIVG 181

Query: 276 HERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVD 335
             + GRIF  G+ S  +I E+ Y   + WF+S+C K+                       
Sbjct: 182 -TKDGRIFLGGE-SDTDIHEIFYQQEERWFSSRCGKI----------------------- 216

Query: 336 FIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVITEKSLEGPMS--- 392
                  ++S+  G   QE +  L +D  R ++YSLS++STIR Y      +EGP     
Sbjct: 217 -------NHSHPFGSRQQEWLRGLYVDDTRNLLYSLSNRSTIRTY-----HMEGPEKLTK 264

Query: 393 -IEPAYISRIIG-TTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGGVRLYFN- 449
            IE    S +      A ++P+   K   IV +S +   E + L L+ALT  G RL+ + 
Sbjct: 265 VIEKDKTSCLRDFAHMADSSPLFTDK-TNIVALSPIPATEASKLHLMALTDTGCRLFLSA 323

Query: 450 --------GSMGRFNIEALRLESIKFPPSSVTPEVIXXXXXXXXXXXAKRSFPFFSNLMS 501
                   G       ++++L+ +KFPP                     R  P     ++
Sbjct: 324 TSSASYTMGGATSLAPQSMQLQFVKFPP---------------------RESPTRIRTLN 362

Query: 502 SEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQQTHQQEKKENSXXXXXXXXXX 561
            + +  +  K S   L+ +      SPG FF  V K   Q                    
Sbjct: 363 GQIIDSQLDKTSRA-LDPSALGFRFSPGYFFDVVRKHPNQD------------------- 402

Query: 562 XXXXXQQPVTLQHKLFVSVPDYGILKTHG-----KYVENATF--LETAGPVQQIIPLSGL 614
                         LFVS PD G +K        KY E  T+  LE      +I   +  
Sbjct: 403 -------------MLFVSAPDTGRIKVTQPASALKYFEQGTWIELENGNRTIEIGLTTAP 449

Query: 615 FNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFEDLIDNPLP------ 668
           F A  +P GF NE A Q+       AVLT+T + I + R   +IF   + N +       
Sbjct: 450 FAAAKQPLGFGNELAVQFDQVPGEFAVLTNTGVHIVRRRRLVDIFAKALGNCVSASDDAL 509

Query: 669 ------FVLNYGAAEACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRYSV 722
                 F+  YG  E  + AL V C   +   LR+     +      +   +  +  Y  
Sbjct: 510 EREVRKFINQYGRVETIAAALAVAC--GQGSDLRTGTGRGMDRNTENLA--RAAFIEYG- 564

Query: 723 STVSSLLSKPTLSTATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRLLR 782
                   +P L  A ++ +QS++               + V LS R   +AL +TRL+R
Sbjct: 565 -------GQPRL--AESDGKQSVS---------------ESVRLSSRHDALALYLTRLVR 600

Query: 783 DIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIEYY 842
            +W   V       +V S + ISS+ P +  +       I +N                 
Sbjct: 601 TLWKAKVV------QVGSGSDISSTIPTSKLVT------IQEN----------------- 631

Query: 843 LSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMVQS 902
              +  L  F      +I  ++ P       + R+  + E++ANQ E  A++A+ K+++S
Sbjct: 632 ---VERLRNFLEANKSTIQGLAPP-------SERLFGRQEDIANQKEHQALHALQKLMES 681

Query: 903 IKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTKSL 962
           I EG+SF+ +L++E              DI + +    Q+ L  L ++ LF+     K L
Sbjct: 682 ISEGISFVLMLFDER-----------VSDIYARLDAVSQQQLKDLTYEQLFS-QTPGKEL 729

Query: 963 IREILLSIINRNI 975
            + ++ +I+NRNI
Sbjct: 730 AKVLVKAIVNRNI 742
>5HAZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 567

 Score =  188 bits (477), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 109/356 (30%), Positives = 191/356 (53%), Gaps = 12/356 (3%)

Query: 998  ASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSV 1057
            + D++ F+A E L+RA E    N   L   L  +  L EQ+   L+   L  AV   +S+
Sbjct: 1    SDDVVTFKAQEQLQRASEQA-HNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISL 59

Query: 1058 NYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVD- 1116
             YY  +I+  L +A   D+G  A  +V +G   ND RK+ +D+R + Y+L+   L K++ 
Sbjct: 60   KYYAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLES 119

Query: 1117 ELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLD 1176
            + A + +    +  ++ +       R ++Y      +D +FH+ +Y+W + +   +++L 
Sbjct: 120  DFAGEPELVDGRPTLAATK------RMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRILS 173

Query: 1177 IETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFL 1236
            I++P ++ YL   A +  + + +L  +Y+ RS+FFE+A++   LA S+ +I+L +RI  L
Sbjct: 174  IDSPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRIILL 233

Query: 1237 SRA--NGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELI 1294
            SRA  N   N++    Q+Q+  QL     +  E+A IQ D+L  +  D RI    K E+ 
Sbjct: 234  SRAKGNASVNTIGISRQQQQ--QLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIE 291

Query: 1295 KTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRME 1350
            + LDG I + ++LFND+A   +Y+++ L IF  ADF +   I+  W+ L      E
Sbjct: 292  EFLDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFE 347
>5HB0:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 549

 Score =  186 bits (473), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 109/354 (30%), Positives = 190/354 (53%), Gaps = 12/354 (3%)

Query: 1000 DILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNY 1059
            D++ F+A E L+RA E    N   L   L  +  L EQ+   L+   L  AV   +S+ Y
Sbjct: 2    DVVTFKAQEQLQRASEQA-HNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISLKY 60

Query: 1060 YPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVD-EL 1118
            Y  +I+  L +A   D+G  A  +V +G   ND RK+ +D+R + Y+L+   L K++ + 
Sbjct: 61   YAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLESDF 120

Query: 1119 AEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIE 1178
            A + +    +  ++ +       R ++Y      +D +FH+ +Y+W + +   +++L I+
Sbjct: 121  AGEPELVDGRPTLAATK------RMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRILSID 174

Query: 1179 TPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSR 1238
            +P ++ YL   A +  + + +L  +Y+ RS+FFE+A++   LA S+ +I+L +RI  LSR
Sbjct: 175  SPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRIILLSR 234

Query: 1239 A--NGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKT 1296
            A  N   N++    Q+Q+  QL     +  E+A IQ D+L  +  D RI    K E+ + 
Sbjct: 235  AKGNASVNTIGISRQQQQ--QLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIEEF 292

Query: 1297 LDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRME 1350
            LDG I + ++LFND+A   +Y+++ L IF  ADF +   I+  W+ L      E
Sbjct: 293  LDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFE 346
>5IJO:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence
          Length = 1391

 Score =  132 bits (333), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 156/329 (47%), Gaps = 38/329 (11%)

Query: 156 IPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVA 215
           +P E++ +F   Q    MG+FP ++R W+TID+ + +WN  +  +    D +  TI  V 
Sbjct: 89  LPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVG 148

Query: 216 LVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATNELSVFNTHL------------SV 263
           LV+PK   F P V+HLL+++T +++ +  +S         V N  L            S+
Sbjct: 149 LVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSL 208

Query: 264 PVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKSALLSLL 323
           P     ++ I S + +GRIF AG+   L  +E+ Y     WF+ +C K+  +KS+L  L+
Sbjct: 209 PTDNTYLLTITSTD-NGRIFLAGKDGCL--YEVAYQAEAGWFSQRCRKINHSKSSLSFLV 265

Query: 324 PTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVIT 383
           P+           +Q  F ++         + I Q+ ID  R I+Y+ S K  I+ Y + 
Sbjct: 266 PS----------LLQFTFSED---------DPILQIAIDNSRNILYTRSEKGVIQVYDLG 306

Query: 384 EKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGG 443
           +   +G   +     + I+      A  I    +  IV+I+ +   E+ +  L+A+T  G
Sbjct: 307 QDG-QGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAG 365

Query: 444 VRLYFNGSMGRFNI---EALRLESIKFPP 469
           VRLYF+    R  +     L L  ++ PP
Sbjct: 366 VRLYFSTCPFRQPLARPNTLTLVHVRLPP 394

 Score =  125 bits (314), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 115/509 (22%), Positives = 232/509 (45%), Gaps = 43/509 (8%)

Query: 885  ANQAESIAINAMIKMVQSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDL 944
            A  +E I++ A+ ++V+   + L+   +L E             F  I++ +  ++Q+ L
Sbjct: 770  AQLSEKISLQAIQQLVRKSYQALALWKLLCEHQ-----------FTIIVAELQKELQEQL 818

Query: 945  VKLDFKDLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGF 1004
                FKDL     + K L   ++ S+IN  I   A+++  +  LQ+ C    S  D +  
Sbjct: 819  KITTFKDLVI---RDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICS 875

Query: 1005 RAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSI 1064
            +A E L+R++++  +N       L+ +    ++I + +    L    +    V +Y   +
Sbjct: 876  KANELLQRSRQV--QNKTEKERMLRESLKEYQKISNQVD---LSNVCAQYRQVRFYEGVV 930

Query: 1065 EFLLNIANSMDKGKLACQYVANGFLENDDRK-QYYDKRILVYDLVFDTLIKVDELAEKKQ 1123
            E  L  A   D   L   +  +G  E D    Q + +R+  Y  + DTL    EL  + +
Sbjct: 931  ELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTL---QELVNQSK 987

Query: 1124 SSKTQNQIS--------------ISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQN 1169
            ++     +               +SN++     ++  + + +  D LF   +Y+WL+  +
Sbjct: 988  AAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVD 1047

Query: 1170 REEKLLDIETPFILPYLMEKAG---SSLKISNILWVYYSRRSKFFESAEILYRLA-TSNF 1225
              +KLL + +PF+ P+L+  A    + ++  ++LW YY +   F  +A +L RLA   + 
Sbjct: 1048 LADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHST 1107

Query: 1226 DITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARI 1285
            +I+L +R+E+++RA     S + +S      +    +++  EVA IQ  I   +      
Sbjct: 1108 EISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSH 1167

Query: 1286 DSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQ 1345
             S+++D  +  LD +++  ++L+ +FA P    E  L I   A + D  ++   W ++ +
Sbjct: 1168 HSSVQDA-VSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIE 1226

Query: 1346 SLRMEFNNTGKKEDSMNFINLLSNVLIKI 1374
               +  + T    D M+ ++L   +L KI
Sbjct: 1227 K-ELSDSVTLSSSDRMHALSLKIVLLGKI 1254
>5IJN:1:A,B,E,K,Q,W|pdbid|entity|chain(s)|sequence
          Length = 1391

 Score =  132 bits (333), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 156/329 (47%), Gaps = 38/329 (11%)

Query: 156 IPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVA 215
           +P E++ +F   Q    MG+FP ++R W+TID+ + +WN  +  +    D +  TI  V 
Sbjct: 89  LPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVG 148

Query: 216 LVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATNELSVFNTHL------------SV 263
           LV+PK   F P V+HLL+++T +++ +  +S         V N  L            S+
Sbjct: 149 LVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSL 208

Query: 264 PVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKSALLSLL 323
           P     ++ I S + +GRIF AG+   L  +E+ Y     WF+ +C K+  +KS+L  L+
Sbjct: 209 PTDNTYLLTITSTD-NGRIFLAGKDGCL--YEVAYQAEAGWFSQRCRKINHSKSSLSFLV 265

Query: 324 PTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVIT 383
           P+           +Q  F ++         + I Q+ ID  R I+Y+ S K  I+ Y + 
Sbjct: 266 PS----------LLQFTFSED---------DPILQIAIDNSRNILYTRSEKGVIQVYDLG 306

Query: 384 EKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGG 443
           +   +G   +     + I+      A  I    +  IV+I+ +   E+ +  L+A+T  G
Sbjct: 307 QDG-QGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAG 365

Query: 444 VRLYFNGSMGRFNI---EALRLESIKFPP 469
           VRLYF+    R  +     L L  ++ PP
Sbjct: 366 VRLYFSTCPFRQPLARPNTLTLVHVRLPP 394

 Score =  125 bits (314), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 115/509 (22%), Positives = 232/509 (45%), Gaps = 43/509 (8%)

Query: 885  ANQAESIAINAMIKMVQSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDL 944
            A  +E I++ A+ ++V+   + L+   +L E             F  I++ +  ++Q+ L
Sbjct: 770  AQLSEKISLQAIQQLVRKSYQALALWKLLCEHQ-----------FTIIVAELQKELQEQL 818

Query: 945  VKLDFKDLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGF 1004
                FKDL     + K L   ++ S+IN  I   A+++  +  LQ+ C    S  D +  
Sbjct: 819  KITTFKDLVI---RDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICS 875

Query: 1005 RAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSI 1064
            +A E L+R++++  +N       L+ +    ++I + +    L    +    V +Y   +
Sbjct: 876  KANELLQRSRQV--QNKTEKERMLRESLKEYQKISNQVD---LSNVCAQYRQVRFYEGVV 930

Query: 1065 EFLLNIANSMDKGKLACQYVANGFLENDDRK-QYYDKRILVYDLVFDTLIKVDELAEKKQ 1123
            E  L  A   D   L   +  +G  E D    Q + +R+  Y  + DTL    EL  + +
Sbjct: 931  ELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTL---QELVNQSK 987

Query: 1124 SSKTQNQIS--------------ISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQN 1169
            ++     +               +SN++     ++  + + +  D LF   +Y+WL+  +
Sbjct: 988  AAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVD 1047

Query: 1170 REEKLLDIETPFILPYLMEKAG---SSLKISNILWVYYSRRSKFFESAEILYRLA-TSNF 1225
              +KLL + +PF+ P+L+  A    + ++  ++LW YY +   F  +A +L RLA   + 
Sbjct: 1048 LADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHST 1107

Query: 1226 DITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARI 1285
            +I+L +R+E+++RA     S + +S      +    +++  EVA IQ  I   +      
Sbjct: 1108 EISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSH 1167

Query: 1286 DSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQ 1345
             S+++D  +  LD +++  ++L+ +FA P    E  L I   A + D  ++   W ++ +
Sbjct: 1168 HSSVQDA-VSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIE 1226

Query: 1346 SLRMEFNNTGKKEDSMNFINLLSNVLIKI 1374
               +  + T    D M+ ++L   +L KI
Sbjct: 1227 K-ELSDSVTLSSSDRMHALSLKIVLLGKI 1254
>5A9Q:10:A,B|pdbid|entity|chain(s)|sequence
          Length = 1391

 Score =  132 bits (333), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 156/329 (47%), Gaps = 38/329 (11%)

Query: 156 IPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVA 215
           +P E++ +F   Q    MG+FP ++R W+TID+ + +WN  +  +    D +  TI  V 
Sbjct: 89  LPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVG 148

Query: 216 LVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATNELSVFNTHL------------SV 263
           LV+PK   F P V+HLL+++T +++ +  +S         V N  L            S+
Sbjct: 149 LVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSL 208

Query: 264 PVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKSALLSLL 323
           P     ++ I S + +GRIF AG+   L  +E+ Y     WF+ +C K+  +KS+L  L+
Sbjct: 209 PTDNTYLLTITSTD-NGRIFLAGKDGCL--YEVAYQAEAGWFSQRCRKINHSKSSLSFLV 265

Query: 324 PTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVIT 383
           P+           +Q  F ++         + I Q+ ID  R I+Y+ S K  I+ Y + 
Sbjct: 266 PS----------LLQFTFSED---------DPILQIAIDNSRNILYTRSEKGVIQVYDLG 306

Query: 384 EKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGG 443
           +   +G   +     + I+      A  I    +  IV+I+ +   E+ +  L+A+T  G
Sbjct: 307 QDG-QGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAG 365

Query: 444 VRLYFNGSMGRFNI---EALRLESIKFPP 469
           VRLYF+    R  +     L L  ++ PP
Sbjct: 366 VRLYFSTCPFRQPLARPNTLTLVHVRLPP 394

 Score =  125 bits (314), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 115/509 (22%), Positives = 232/509 (45%), Gaps = 43/509 (8%)

Query: 885  ANQAESIAINAMIKMVQSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDL 944
            A  +E I++ A+ ++V+   + L+   +L E             F  I++ +  ++Q+ L
Sbjct: 770  AQLSEKISLQAIQQLVRKSYQALALWKLLCEHQ-----------FTIIVAELQKELQEQL 818

Query: 945  VKLDFKDLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGF 1004
                FKDL     + K L   ++ S+IN  I   A+++  +  LQ+ C    S  D +  
Sbjct: 819  KITTFKDLVI---RDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICS 875

Query: 1005 RAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSI 1064
            +A E L+R++++  +N       L+ +    ++I + +    L    +    V +Y   +
Sbjct: 876  KANELLQRSRQV--QNKTEKERMLRESLKEYQKISNQVD---LSNVCAQYRQVRFYEGVV 930

Query: 1065 EFLLNIANSMDKGKLACQYVANGFLENDDRK-QYYDKRILVYDLVFDTLIKVDELAEKKQ 1123
            E  L  A   D   L   +  +G  E D    Q + +R+  Y  + DTL    EL  + +
Sbjct: 931  ELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTL---QELVNQSK 987

Query: 1124 SSKTQNQIS--------------ISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQN 1169
            ++     +               +SN++     ++  + + +  D LF   +Y+WL+  +
Sbjct: 988  AAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVD 1047

Query: 1170 REEKLLDIETPFILPYLMEKAG---SSLKISNILWVYYSRRSKFFESAEILYRLA-TSNF 1225
              +KLL + +PF+ P+L+  A    + ++  ++LW YY +   F  +A +L RLA   + 
Sbjct: 1048 LADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHST 1107

Query: 1226 DITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARI 1285
            +I+L +R+E+++RA     S + +S      +    +++  EVA IQ  I   +      
Sbjct: 1108 EISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSH 1167

Query: 1286 DSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQ 1345
             S+++D  +  LD +++  ++L+ +FA P    E  L I   A + D  ++   W ++ +
Sbjct: 1168 HSSVQDA-VSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIE 1226

Query: 1346 SLRMEFNNTGKKEDSMNFINLLSNVLIKI 1374
               +  + T    D M+ ++L   +L KI
Sbjct: 1227 K-ELSDSVTLSSSDRMHALSLKIVLLGKI 1254
>4IWB:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 165

 Score = 36.2 bits (82), Expect = 0.52,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 1035 LEQIV--DDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLEND 1092
            LEQI+   D +IE L+ A+ +   VN   K  EF+ NI    D            FL+++
Sbjct: 58   LEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYD-----IISALKSFLDHE 112

Query: 1093 DRKQYYDKRILVYDLVFDTLIKVDELAEKKQ 1123
              K+       +Y ++ +TL+KVD+  E+ Q
Sbjct: 113  KGKEIAKNLDTIYTIILNTLVKVDKTKEELQ 143
>1ORY:1:A|pdbid|entity|chain(s)|sequence
          Length = 130

 Score = 35.4 bits (80), Expect = 0.87,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 1035 LEQIV--DDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLEND 1092
            LEQI+   D +IE L+ A+ +   VN   K  EF+ NI    D            FL+++
Sbjct: 19   LEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYD-----IISALKSFLDHE 73

Query: 1093 DRKQYYDKRILVYDLVFDTLIKVDELAEKKQ 1123
              K+       +Y ++ +TL+KVD+  E+ Q
Sbjct: 74   KGKEIAKNLDTIYTIILNTLVKVDKTKEELQ 104
>1ORJ:1:A,B,C,D|pdbid|entity|chain(s)|sequence
          Length = 130

 Score = 35.4 bits (80), Expect = 0.87,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 1035 LEQIV--DDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLEND 1092
            LEQI+   D +IE L+ A+ +   VN   K  EF+ NI    D            FL+++
Sbjct: 19   LEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYD-----IISALKSFLDHE 73

Query: 1093 DRKQYYDKRILVYDLVFDTLIKVDELAEKKQ 1123
              K+       +Y ++ +TL+KVD+  E+ Q
Sbjct: 74   KGKEIAKNLDTIYTIILNTLVKVDKTKEELQ 104
>5WGY:1:A|pdbid|entity|chain(s)|sequence
          Length = 667

 Score = 33.9 bits (76), Expect = 2.1,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 904 KEGLSFLNVLYEESEVEGFDNQYL----GFKDIISFVSLDVQKDLVKLDFKDLFAPNDKT 959
           K G S L + Y   ++ G    YL    G KD +SF  LD +      DF  + AP    
Sbjct: 78  KIGESTLPIFYTWCKLHGISAAYLLRLFGLKDGLSFYFLDRENQGQYTDFSSVGAPGLVL 137

Query: 960 KSL-----IREILLSIINR----NITKGASIEYTATALQ 989
            SL     + E+L +I+ +    N+  G  +++ +T +Q
Sbjct: 138 ASLQIERPMSELLFTILAQRNGVNVYHGREVDFKSTVVQ 176
>5WGV:1:A|pdbid|entity|chain(s)|sequence
          Length = 667

 Score = 33.9 bits (76), Expect = 2.1,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 904 KEGLSFLNVLYEESEVEGFDNQYL----GFKDIISFVSLDVQKDLVKLDFKDLFAPNDKT 959
           K G S L + Y   ++ G    YL    G KD +SF  LD +      DF  + AP    
Sbjct: 78  KIGESTLPIFYTWCKLHGISAAYLLRLFGLKDGLSFYFLDRENQGQYTDFSSVGAPGLVL 137

Query: 960 KSL-----IREILLSIINR----NITKGASIEYTATALQ 989
            SL     + E+L +I+ +    N+  G  +++ +T +Q
Sbjct: 138 ASLQIERPMSELLFTILAQRNGVNVYHGREVDFKSTVVQ 176
>4EXJ:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 238

 Score = 33.5 bits (75), Expect = 3.1,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 1160 HMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVY----YSRRSKFFESAE 1215
            HM+ W     +E+  L +    I+P L++  G+ +  SN + +Y    Y +  KFF S +
Sbjct: 31   HMFHWPTKDIQEDWYLKLNPAGIVPTLVDDKGTPITESNNILLYIADTYDKEHKFFYSLK 90

Query: 1216 ILYRLATSNFDITLFERIEFLSRANGFCNS 1245
               +L     ++  ++  +F S+     N+
Sbjct: 91   QDPKLYWEQNELLFYQATQFQSQTLTIANA 120
>5HC8:1:A|pdbid|entity|chain(s)|sequence
          Length = 261

 Score = 32.7 bits (73), Expect = 5.4,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 286 GQASGLNIWELHYSGSDDWFN--SKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFED 343
            ++ G+ + E H +G ++W +  S+ S++ +    + +L P N       VDF+  ++ED
Sbjct: 27  AKSRGVTVQEGHQTGVNNWKHIISRASQLGIKLLTIWALSPQNFNRSKMEVDFLMRIYED 86

Query: 344 NSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYV 381
                  F +  + +L   QQ     ++  KS +  Y+
Sbjct: 87  -------FLRSDVKELVTSQQDIQFSAIGDKSRLPEYL 117
>5HC7:1:A|pdbid|entity|chain(s)|sequence
          Length = 261

 Score = 32.7 bits (73), Expect = 5.4,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 286 GQASGLNIWELHYSGSDDWFN--SKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFED 343
            ++ G+ + E H +G ++W +  S+ S++ +    + +L P N       VDF+  ++ED
Sbjct: 27  AKSRGVTVQEGHQTGVNNWKHIISRASQLGIKLLTIWALSPQNFNRSKMEVDFLMRIYED 86

Query: 344 NSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYV 381
                  F +  + +L   QQ     ++  KS +  Y+
Sbjct: 87  -------FLRSDVKELVTSQQDIQFSAIGDKSRLPEYL 117
>5HC6:1:A|pdbid|entity|chain(s)|sequence
          Length = 261

 Score = 32.7 bits (73), Expect = 5.4,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 286 GQASGLNIWELHYSGSDDWFN--SKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFED 343
            ++ G+ + E H +G ++W +  S+ S++ +    + +L P N       VDF+  ++ED
Sbjct: 27  AKSRGVTVQEGHQTGVNNWKHIISRASQLGIKLLTIWALSPQNFNRSKMEVDFLMRIYED 86

Query: 344 NSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYV 381
                  F +  + +L   QQ     ++  KS +  Y+
Sbjct: 87  -------FLRSDVKELVTSQQDIQFSAIGDKSRLPEYL 117
>5B16:1:A|pdbid|entity|chain(s)|sequence
          Length = 986

 Score = 32.3 bits (72), Expect = 6.2,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 1013 AKEIGLRNYDSLNYHLKNATAL--------LEQIVDDLSIEKLKEAVSMMLSVNYYPKSI 1064
            A+E+G++ Y   N   K   AL        L+  +  L I+K  E V   ++V ++P+  
Sbjct: 804  AEELGMQEYAITNDKTKRPVALRTKTLADLLQSFIAALYIDKDLEYVHTFMNVCFFPRLK 863

Query: 1065 EFLLN 1069
            EF+LN
Sbjct: 864  EFILN 868
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 136,663,943
Number of extensions: 5510346
Number of successful extensions: 12897
Number of sequences better than 10.0: 27
Number of HSP's gapped: 13173
Number of HSP's successfully gapped: 34
Length of query: 1502
Length of database: 50,680,114
Length adjustment: 120
Effective length of query: 1382
Effective length of database: 26,120,194
Effective search space: 36098108108
Effective search space used: 36098108108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)