BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (472 letters)

Database: pdb_polypeptide 
           215,536 sequences; 53,529,942 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

5CWS:4:D,J|pdbid|entity|chain(s)|sequence                              39   0.028
2LLZ:1:A|pdbid|entity|chain(s)|sequence                                31   6.2  
5I7D:1:A,B|pdbid|entity|chain(s)|sequence                              30   9.0  
5I6J:1:A|pdbid|entity|chain(s)|sequence                                30   9.0  
5I6R:1:A|pdbid|entity|chain(s)|sequence                                30   9.6  
>5CWS:4:D,J|pdbid|entity|chain(s)|sequence
          Length = 227

 Score = 38.5 bits (88), Expect = 0.028,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 64/165 (38%), Gaps = 27/165 (16%)

Query: 273 IRQEIEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVAYLLKSESATSQYLKQDLKK 332
           ++QEI ++D+ IQK ++    + A    H E + +IP DV ++ +        L  D+  
Sbjct: 5   LQQEIAKIDEEIQKCIRDKEAVDAFLPAHGEQLAAIPTDVNFVTRKSEGAHNALSSDILA 64

Query: 333 ISSFKSLIDEDLLDTQTFSVLLQQLLTP---------------------------GSKIS 365
           I   + L+ +D  + +     +  L  P                               S
Sbjct: 65  IDQLRELVKQDADNARLSFKAIDNLKLPMQYHQAGLWSKQMGGAGTAGASGASADADGQS 124

Query: 366 SNDLDKFFQKKIHLYEKKLEDYCRILSDIETAVNGIDTDLFGAPN 410
           + DL  +F K     E+ ++ + + +++IE  + G++       N
Sbjct: 125 NADLISYFSKTADEMEEMMKKFEKTITEIEAHLTGVEAHAMAMQN 169
>2LLZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 100

 Score = 30.8 bits (68), Expect = 6.2,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 399 NGIDTDLFGAPN--NPNSTAITADLGSSEAENLLQLK 433
           + I  D +G P   N NS AIT  L +SE E+L++LK
Sbjct: 39  SSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLK 75
>5I7D:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 484

 Score = 30.0 bits (66), Expect = 9.0,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 67/142 (47%), Gaps = 11/142 (7%)

Query: 264 TRISELPPQIRQEIEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVA-----YLLKS 318
           T++ E+  Q+ ++++ LDQ  + +VQ+   L+       E+     R++      +L K+
Sbjct: 19  TQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKT 78

Query: 319 ESATSQYLKQD---LKKISSFKSLIDE---DLLDTQTFSVLLQQLLTPGSKISSNDLDKF 372
            S   Q  K+D   L  ++ +  L+++   +  D  T S +    + P     S D  + 
Sbjct: 79  RSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRL 138

Query: 373 FQKKIHLYEKKLEDYCRILSDI 394
           F+K   + ++  +D  ++L+++
Sbjct: 139 FKKSKEVGQQLQDDLMKVLNEL 160
>5I6J:1:A|pdbid|entity|chain(s)|sequence
          Length = 484

 Score = 30.0 bits (66), Expect = 9.0,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 67/142 (47%), Gaps = 11/142 (7%)

Query: 264 TRISELPPQIRQEIEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVA-----YLLKS 318
           T++ E+  Q+ ++++ LDQ  + +VQ+   L+       E+     R++      +L K+
Sbjct: 19  TQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKT 78

Query: 319 ESATSQYLKQD---LKKISSFKSLIDE---DLLDTQTFSVLLQQLLTPGSKISSNDLDKF 372
            S   Q  K+D   L  ++ +  L+++   +  D  T S +    + P     S D  + 
Sbjct: 79  RSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRL 138

Query: 373 FQKKIHLYEKKLEDYCRILSDI 394
           F+K   + ++  +D  ++L+++
Sbjct: 139 FKKSKEVGQQLQDDLMKVLNEL 160
>5I6R:1:A|pdbid|entity|chain(s)|sequence
          Length = 484

 Score = 30.0 bits (66), Expect = 9.6,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 67/142 (47%), Gaps = 11/142 (7%)

Query: 264 TRISELPPQIRQEIEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVA-----YLLKS 318
           T++ E+  Q+ ++++ LDQ  + +VQ+   L+       E+     R++      +L K+
Sbjct: 19  TQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKT 78

Query: 319 ESATSQYLKQD---LKKISSFKSLIDE---DLLDTQTFSVLLQQLLTPGSKISSNDLDKF 372
            S   Q  K+D   L  ++ +  L+++   +  D  T S +    + P     S D  + 
Sbjct: 79  RSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRL 138

Query: 373 FQKKIHLYEKKLEDYCRILSDI 394
           F+K   + ++  +D  ++L+++
Sbjct: 139 FKKSKEVGQQLQDDLMKVLNEL 160
  Database: pdb_polypeptide
    Posted date:  May 18, 2018  7:31 PM
  Number of letters in database: 53,529,942
  Number of sequences in database:  215,536
  
Lambda     K      H
   0.313    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 215536
Number of Hits to DB: 32,385,545
Number of extensions: 1027919
Number of successful extensions: 2179
Number of sequences better than 10.0: 10
Number of HSP's gapped: 2240
Number of HSP's successfully gapped: 10
Length of query: 472
Length of database: 53,529,942
Length adjustment: 111
Effective length of query: 361
Effective length of database: 29,605,446
Effective search space: 10687566006
Effective search space used: 10687566006
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)