BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (528 letters)

Database: pdb_polypeptide 
           208,233 sequences; 51,655,582 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3P3D:1:A|pdbid|entity|chain(s)|sequence                               105   2e-22
5UAZ:1:A,B|pdbid|entity|chain(s)|sequence                             105   3e-22
2M4M:1:A|pdbid|entity|chain(s)|sequence                                74   7e-13
>3P3D:1:A|pdbid|entity|chain(s)|sequence
          Length = 132

 Score =  105 bits (263), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/138 (39%), Positives = 84/138 (60%), Gaps = 30/138 (21%)

Query: 270 AIIVFGYPESISNELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTV 329
           AI+VFGYPE+++N++I +F  FG I+EDF+VLR  + +                      
Sbjct: 9   AILVFGYPETMANQVIAYFQEFGTILEDFEVLRKPQAM---------------------- 46

Query: 330 NKSITLKGRNNESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSK 389
             ++ L+ R      +  PIF+G SW K+TY++P+SA+ AL ENG +F G L+G IPY+K
Sbjct: 47  --TVGLQDR------QFVPIFSGNSWTKITYDNPASAVDALLENGAVFNGVLLGVIPYTK 98

Query: 390 NAVEQLAGCKIDNVDDIG 407
           +AVE+L   K+ + +DIG
Sbjct: 99  DAVERLQKRKLTSSEDIG 116
>5UAZ:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 111

 Score =  105 bits (261), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 79/127 (62%), Gaps = 24/127 (18%)

Query: 270 AIIVFGYPESISNELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTV 329
           AII+FGYPE+I+N +I HF++FG I+EDF+V++  + +N                    +
Sbjct: 8   AIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLN-----------------SKNM 50

Query: 330 NKSITLKGRNNESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSK 389
           +KS +L         +KYPI+TG+ WVKLTY S  S  RALQENG I  G+LIGC+ YS 
Sbjct: 51  SKSPSLTA-------QKYPIYTGDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSP 103

Query: 390 NAVEQLA 396
            A++QLA
Sbjct: 104 AALKQLA 110
>2M4M:1:A|pdbid|entity|chain(s)|sequence
          Length = 124

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 23/127 (18%)

Query: 270 AIIVFGYPESISNELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTV 329
           A++VFGY E+I+ +++ +F+ FG I+ED +   LG      T   F              
Sbjct: 12  AVVVFGYREAITKQILAYFAQFGEILEDLES-ELGDTETMRTPGYFFQQ----------- 59

Query: 330 NKSITLKGRNNESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSK 389
                        N ++     G +W KLTY + SS LRAL+E+GTI+ G+ IGC+PY  
Sbjct: 60  -----------APNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKH 108

Query: 390 NAVEQLA 396
             + +L+
Sbjct: 109 ELISELS 115
  Database: pdb_polypeptide
    Posted date:  Jan 12, 2018  7:20 PM
  Number of letters in database: 51,655,582
  Number of sequences in database:  208,233
  
Lambda     K      H
   0.312    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 208233
Number of Hits to DB: 47,146,014
Number of extensions: 1747186
Number of successful extensions: 2715
Number of sequences better than 10.0: 3
Number of HSP's gapped: 2756
Number of HSP's successfully gapped: 5
Length of query: 528
Length of database: 51,655,582
Length adjustment: 112
Effective length of query: 416
Effective length of database: 28,333,486
Effective search space: 11786730176
Effective search space used: 11786730176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)