BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (528 letters)

Database: pdb_polypeptide 
           204,666 sequences; 50,680,114 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3P3D:1:A|pdbid|entity|chain(s)|sequence                               105   2e-22
2M4M:1:A|pdbid|entity|chain(s)|sequence                                74   7e-13
>3P3D:1:A|pdbid|entity|chain(s)|sequence
          Length = 132

 Score =  105 bits (263), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/138 (39%), Positives = 84/138 (60%), Gaps = 30/138 (21%)

Query: 270 AIIVFGYPESISNELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTV 329
           AI+VFGYPE+++N++I +F  FG I+EDF+VLR  + +                      
Sbjct: 9   AILVFGYPETMANQVIAYFQEFGTILEDFEVLRKPQAM---------------------- 46

Query: 330 NKSITLKGRNNESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSK 389
             ++ L+ R      +  PIF+G SW K+TY++P+SA+ AL ENG +F G L+G IPY+K
Sbjct: 47  --TVGLQDR------QFVPIFSGNSWTKITYDNPASAVDALLENGAVFNGVLLGVIPYTK 98

Query: 390 NAVEQLAGCKIDNVDDIG 407
           +AVE+L   K+ + +DIG
Sbjct: 99  DAVERLQKRKLTSSEDIG 116
>2M4M:1:A|pdbid|entity|chain(s)|sequence
          Length = 124

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 23/127 (18%)

Query: 270 AIIVFGYPESISNELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTV 329
           A++VFGY E+I+ +++ +F+ FG I+ED +   LG      T   F              
Sbjct: 12  AVVVFGYREAITKQILAYFAQFGEILEDLES-ELGDTETMRTPGYFFQQ----------- 59

Query: 330 NKSITLKGRNNESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSK 389
                        N ++     G +W KLTY + SS LRAL+E+GTI+ G+ IGC+PY  
Sbjct: 60  -----------APNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKH 108

Query: 390 NAVEQLA 396
             + +L+
Sbjct: 109 ELISELS 115
  Database: pdb_polypeptide
    Posted date:  Nov 11, 2017  1:04 AM
  Number of letters in database: 50,680,114
  Number of sequences in database:  204,666
  
Lambda     K      H
   0.312    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 204666
Number of Hits to DB: 46,256,716
Number of extensions: 1714103
Number of successful extensions: 2660
Number of sequences better than 10.0: 2
Number of HSP's gapped: 2702
Number of HSP's successfully gapped: 4
Length of query: 528
Length of database: 50,680,114
Length adjustment: 112
Effective length of query: 416
Effective length of database: 27,757,522
Effective search space: 11547129152
Effective search space used: 11547129152
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)