Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 269 39
95 % 57 270 53 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 57 270 58
70 % 57 270 69
50 % 75 428 26
40 % 75 428 38
30 % 81 535 32
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 271 35
95 % 57 271 49 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 57 271 54
70 % 57 271 65
50 % 69 422 32
40 % 77 546 19
30 % 77 546 31
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 22931
95 % 57 278 39 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 57 278 44
70 % 69 426 18
50 % 69 439 24
40 % 69 439 36
30 % 69 439 56
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 272 33
95 % 57 272 46 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 57 272 51
70 % 57 272 62
50 % 69 426 31
40 % 69 426 44
30 % 75 535 35
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 270 36
95 % 57 270 54
90 % 57 270 59
70 % 57 283 53
50 % 57 283 91
40 % 57 283 112
30 % 57 283 124
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 274 30
95 % 59 279 38 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 59 279 43
70 % 59 279 54
50 % 74 435 25
40 % 74 440 35
30 % 74 440 55
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 266 41
95 % 57 271 51 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 57 271 56
70 % 57 271 67
50 % 57 281 92
40 % 57 281 114
30 % 69 419 63
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 49 178 59
95 % 57 265 56 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.6
PDBFlex
90 % 57 269 60
70 % 57 269 70
50 % 57 269 95
40 % 57 269 117
30 % 57 269 128
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 50 185 57
95 % 51 236 65 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 51 236 69
70 % 51 236 81
50 % 51 236 114
40 % 51 236 137
30 % 51 236 145
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 274 29
95 % 58 274 42 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 58 274 48
70 % 58 274 58
50 % 70 428 28
40 % 70 431 40
30 % 70 431 57
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 271 31
95 % 57 272 43 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.5
PDBFlex
90 % 57 272 49
70 % 57 272 59
50 % 69 415 34
40 % 69 420 45
30 % 69 420 61
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 219 51
95 % 57 270 52 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 57 270 57
70 % 57 270 68
50 % 57 270 94
40 % 57 270 116
30 % 57 270 127
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 261 43
95 % 57 261 59 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.5
PDBFlex
90 % 57 261 63
70 % 57 261 74
50 % 57 261 100
40 % 57 261 122
30 % 57 261 135
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 51 235 49
95 % 51 235 66 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 51 235 70
70 % 51 235 82
50 % 53 309 85
40 % 53 309 103
30 % 53 309 118
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 264 42
95 % 57 272 44 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 57 272 50
70 % 57 272 60
50 % 69 423 29
40 % 69 428 42
30 % 69 428 58
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 271 34
95 % 57 271 48 Flexibility: Low
Max RMSD: 4.7, Avg RMSD: 0.6
PDBFlex
90 % 57 271 53
70 % 57 271 64
50 % 70 423 30
40 % 70 423 43
30 % 70 425 60
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 276 27
95 % 64 282 37 Flexibility: Low
Max RMSD: 2.8, Avg RMSD: 0.8
PDBFlex
90 % 64 282 42
70 % 64 282 52
50 % 64 282 90
40 % 64 282 111
30 % 76 362 93
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 275 28
95 % 58 276 41 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.9
PDBFlex
90 % 58 276 46
70 % 58 276 56
50 % 69 363 66
40 % 69 368 82
30 % 69 368 95
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 271 32
95 % 58 271 45 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 58 275 47
70 % 58 275 57
50 % 72 428 27
40 % 73 434 37
30 % 80 551 30
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 53 180 69
95 % 57 271 50 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.8
PDBFlex
90 % 57 271 55
70 % 57 271 66
50 % 69 417 33
40 % 69 417 46
30 % 75 535 34

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 5J7L 11 AK, BK 30S ribosomal protein S11 562
12 5W4K 42 1k, 2k 30S ribosomal protein S11 274
13 4LFB 11 K ribosomal protein S11 274
14 1VY4 11 AK, CK 30S ribosomal protein S11 274
15 4WOI 11 AK, DK 30S ribosomal protein S11 562
16 5FDU 42 1k, 2k 30S ribosomal protein S11 274
17 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
18 5JC9 11 AK, BK 30S ribosomal protein S11 562
19 1VY5 11 AK, CK 30S ribosomal protein S11 274
20 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
21 4WQF 44 BK, DK 30S ribosomal protein S11 274
22 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
23 4WPO 44 BK, DK 30S ribosomal protein S11 274
24 5J8A 11 AK, BK 30S ribosomal protein S11 562
25 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
26 4JI1 11 K RIBOSOMAL PROTEIN S11 274
27 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
28 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
29 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
30 5J5B 11 AK, BK 30S ribosomal protein S11 562
31 5HD1 42 1k, 2k 30S ribosomal protein S11 274
32 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
33 4DR6 11 K 30S ribosomal protein S11 274
34 4LF7 11 K ribosomal protein S11 274
35 4LF8 11 K ribosomal protein S11 274
36 4WSD 11 2A, 2I 30S ribosomal protein S11 274
37 4WQU 44 BK, DK 30S ribosomal protein S11 274
38 5E81 11 2A, 2I 30S ribosomal protein S11 274
39 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
40 4U27 11 AK, CK 30S ribosomal protein S11 562
41 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
42 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
43 5HCR 42 1k, 2k 30S ribosomal protein S11 274
44 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
45 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
46 4DV6 11 K ribosomal protein S11 274
47 4JYA 11 K 30S ribosomal protein S11 274
48 5IBB 11 2A, 2I 30S ribosomal protein S11 274
49 4DR5 11 K 30S ribosomal protein S11 274
50 5J4C 42 1k, 2k 30S ribosomal protein S11 274
51 4KHP 11 K 30S Ribosomal protein S11 274
52 4DR2 11 K 30S ribosomal protein S11 274
53 4WRO 15 2I 30S ribosomal protein S11 274
54 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
55 4LF9 11 K ribosomal protein S11 274
56 4WQY 44 BK, DK 30S ribosomal protein S11 274
57 4DUY 11 K ribosomal protein S11 274
58 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
59 4DV7 11 K ribosomal protein S11 274
60 4WRA 11 2A, 2I 30S ribosomal protein S11 274
61 5IB7 11 2A, 2I 30S ribosomal protein S11 274
62 4U26 11 AK, CK 30S ribosomal protein S11 562
63 4X64 11 K 30S ribosomal protein S11 274
64 5HCP 42 1k, 2k 30S ribosomal protein S11 274
65 5IT8 11 AK, BK 30S ribosomal protein S11 562
66 4V9D 11 AK, BK 30S ribosomal protein S11 562
67 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
68 4V9H 5 AK 30S ribosomal protein S11 274
69 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
70 5J91 11 AK, BK 30S ribosomal protein S11 562
71 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
72 4DR3 11 K 30S ribosomal protein S11 274
73 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
74 4JI3 11 K RIBOSOMAL PROTEIN S11 274
75 4WQR 11 2A, 2I 30S ribosomal protein S11 274
76 4JI6 11 K RIBOSOMAL PROTEIN S11 274
77 4JI8 11 K RIBOSOMAL PROTEIN S11 274
78 2UXC 11 K RIBOSOMAL PROTEIN S11 274
79 5IB8 11 2A, 2I 30S ribosomal protein S11 274
80 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
81 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
82 5EL6 11 2A, 2I 30S ribosomal protein S11 274
83 5EL7 11 2A, 2I 30S ribosomal protein S11 274
84 5VP2 42 1k, 2k 30S ribosomal protein S11 274
85 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
86 4LF4 11 K ribosomal protein S11 274
87 5DFE 45 QK, XK 30S ribosomal protein S11 274
88 4LF6 11 K ribosomal protein S11 274
89 4JI7 11 K RIBOSOMAL PROTEIN S11 274
90 5J88 11 AK, BK 30S ribosomal protein S11 562
91 4U24 11 AK, CK 30S ribosomal protein S11 562
92 4WU1 11 2A, 2I 30S ribosomal protein S11 274
93 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
94 5EL4 11 2A, 2I 30S ribosomal protein S11 274
95 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
96 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
97 4WR6 11 2A, 2I 30S ribosomal protein S11 274
98 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
99 5HAU 44 1k, 2k 30S ribosomal protein S11 274
100 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
101 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
102 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
103 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
104 4WF1 11 AK, CK 30S ribosomal protein S11 562
105 4U25 11 AK, CK 30S ribosomal protein S11 562
106 4V95 11 AK, CK 30S Ribosomal Protein S11 274
107 4WWW 42 QK, XK 30S ribosomal protein S11 562
108 4V7T 11 AK, CK 30S ribosomal protein S11 562
109 1VY7 11 AK, CK 30S ribosomal protein S11 274
110 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
111 5E7K 11 2A, 2I 30S ribosomal protein S11 274
112 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
113 5EL5 11 2A, 2I 30S ribosomal protein S11 274
114 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
115 4LNT 11 QK, XK 30S ribosomal protein S11 274
116 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
117 4DR1 11 K 30S ribosomal protein S11 274
118 4LFA 11 K ribosomal protein S11 274
119 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
120 4DV4 11 K ribosomal protein S11 274
121 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
122 4YZV 11 QK, XK 30S ribosomal protein S11 274
123 4JI0 11 K ribosomal protein S11 274
124 5IWA 10 K 30S ribosomal protein S11 274
125 4V7U 11 AK, CK 30S ribosomal protein S11 562
126 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
127 4JI2 11 K RIBOSOMAL PROTEIN S11 274
128 4V6C 10 AK, CK 30S ribosomal protein S11 562
129 4JV5 11 K 30S ribosomal protein S11 274
130 4DR7 11 K 30S ribosomal protein S11 274
131 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
132 4GKK 11 K 30S ribosomal protein S11 274
133 4DUZ 11 K ribosomal protein S11 274
134 4V7V 11 AK, CK 30S ribosomal protein S11 562
135 4X65 11 K 30S ribosomal protein S11 274
136 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
137 4GKJ 11 K 30S ribosomal protein S11 274
138 4DV3 11 K ribosomal protein S11 274
139 4V7S 11 AK, CK 30S ribosomal protein S11 562
140 4DV5 11 K ribosomal protein S11 274
141 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
142 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
143 4LFC 11 K ribosomal protein S11 274
144 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
145 3T1Y 11 K 30S ribosomal protein S11 274
146 4WZO 11 2A, 2I 30S ribosomal protein S11 274
147 4JI4 11 K RIBOSOMAL PROTEIN S11 274
148 1VY6 11 AK, CK 30S ribosomal protein S11 274
149 1XMQ 13 K 30S Ribosomal Protein S11 274
150 4U20 11 AK, CK 30S ribosomal protein S11 562
151 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
152 4DV0 11 K ribosomal protein S11 274
153 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
154 4U1V 11 AK, CK 30S ribosomal protein S11 562
155 4V6F 41 BN, CN 30S ribosomal protein S11 274
156 4X62 11 K 30S ribosomal protein S11 274
157 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
158 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
159 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
160 4DV2 11 K ribosomal protein S11 274
161 4DV1 11 K ribosomal protein S11 274
162 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
163 5F8K 42 1k, 2k 30S ribosomal protein S11 274
164 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
165 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
166 4JI5 11 K RIBOSOMAL PROTEIN S11 274
167 4K0K 11 K 30S ribosomal protein S11 274
168 4W2E 44 k 30S ribosomal protein S11 274
169 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
170 5BR8 11 K 30S ribosomal protein S11 274
171 4LF5 11 K ribosomal protein S11 274
172 5J4D 45 TA, YC 30S ribosomal protein S11 274
173 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
174 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
175 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
176 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
177 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
178 4V7Y 11 AK, CK 30S ribosomal protein S11 274
179 4V9C 11 AK, CK 30S ribosomal protein S11 562
180 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
181 5J30 42 QK, XK 30S ribosomal protein S11 274
182 4DR4 11 K 30S ribosomal protein S11 274
183 4WZD 11 2A, 2I 30S ribosomal protein S11 274
184 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
185 4X66 11 K 30S ribosomal protein S11 274
186 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
187 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
188 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
189 4V85 11 AK 30S ribosomal protein S11 562
190 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
191 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
192 4W4G 11 QK, XK 30S ribosomal protein S11 274
193 4NXM 11 K ribosomal protein S11 274
194 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
195 4YPB 11 QK, XK 30S ribosomal protein S11 274
196 4V7X 11 AK, CK 30S ribosomal protein S11 274
197 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
198 4U1U 11 AK, CK 30S ribosomal protein S11 562
199 4ZER 42 1k, 2k 30S ribosomal protein S11 274
200 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
201 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
202 4V7W 11 AK, CK 30S ribosomal protein S11 274
203 4WT1 11 2A, 2I 30S ribosomal protein S11 274
204 4WT8 11 AK, BK 30S ribosomal protein S11 274
205 5DOX 42 1k, 2k 30S ribosomal protein S11 274
206 4NXN 11 K ribosomal protein S11 274
207 1XNR 13 K 16S Ribosomal protein S11 274
208 4LT8 11 QK, XK 30S ribosomal protein S11 274
209 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
210 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
211 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
212 4V7L 11 AK, CK 30S ribosomal protein S11 274
213 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
214 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
215 1XNQ 13 K Ribosomal protein S11 274
216 4V8A 41 CK, DK 30S ribosomal protein S11 274
217 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
218 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
219 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
220 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
221 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
222 5J3C 42 QK, XK 30S ribosomal protein S11 274
223 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
224 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
225 4L47 11 QK, XK 30S ribosomal protein S11 274
226 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
227 4ZSN 11 QK, XK 30S ribosomal protein S11 274
228 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
229 4V7Z 11 AK, CK 30S ribosomal protein S11 274
230 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
231 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
232 4V9I 11 AK, CK 30S Ribosomal protein S11 274
233 1XMO 13 K 30S ribosomal protein S11 274
234 3T1H 11 K 30S ribosomal protein S11 274
235 2UXD 11 K RIBOSOMAL PROTEIN S11 274
236 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
237 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
238 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
239 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
240 4V97 11 AK, CK 30S ribosomal protein S11 274
241 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
242 4V7M 11 AK, CK 30S ribosomal protein S11 274
243 4WSM 11 2A, 2I 30S ribosomal protein S11 274
244 4TUD 11 QK, XK 30S ribosomal protein S11 274
245 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
246 4V6A 11 AK, CK 30S ribosomal protein S11 274
247 4TUE 11 QK, XK 30S ribosomal protein S11 274
248 4TUA 11 QK, XK 30S ribosomal protein S11 274
249 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
250 4V84 11 AK, CK 30S ribosomal protein S11 274
251 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
252 4YY3 11 K 30S ribosomal protein S11 274
253 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
254 4V9Q 41 BK, DK 30S ribosomal protein S11 274
255 4TUC 11 QK, XK 30S ribosomal protein S11 274
256 4YHH 11 K 30S ribosomal protein S11 274
257 4TUB 11 QK, XK 30S ribosomal protein S11 274
258 4V9N 14 AK, CK 30S ribosomal protein S11 274
259 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
260 4P70 11 QK, XK 30S ribosomal protein S11 274
261 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
262 4LSK 11 QK, XK 30S ribosomal protein S11 274
263 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
264 4V6D 10 AK, CK 30S ribosomal protein S11 562
265 4P6F 11 QK, XK 30S ribosomal protein S11 274
266 4V67 13 AK, CK 30S ribosomal protein S11 274
267 4V83 11 AK, CK 30S ribosomal protein S11 274
268 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
269 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
270 4V5O 20 AK, BK RPS14E 5911
271 1VVJ 11 QK, XK 30S ribosomal protein S11 274
272 4LFZ 11 QK, XK 30S ribosomal protein S11 274
273 2E5L 12 K 30S ribosomal protein S11 274
274 4V6E 10 AK, CK 30S ribosomal protein S11 562
275 4V52 10 AK, CK 30S ribosomal protein S11 562
276 5CZP 42 QK, XK 30S ribosomal protein S11 274
277 2HHH 11 K 30S ribosomal protein S11 274
278 4V89 11 AK 30S ribosomal protein S11 562
279 4OX9 11 K 30S ribosomal protein S11 274
280 4V54 10 AK, CK 30S ribosomal protein S11 562
281 2UXB 11 K RIBOSOMAL PROTEIN S11 274
282 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
283 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
284 4V9K 10 AK, CK 30S ribosomal protein S11 274
285 4V50 13 AK, CK 30S ribosomal protein S11 562
286 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
287 4V57 10 AK, CK 30S ribosomal protein S11 562
288 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
289 4V63 13 AK, CK 30S ribosomal protein S11 274
290 4L71 11 QK, XK 30S ribosomal protein S11 274
291 4KVB 11 K 30S ribosomal protein S11 274
292 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
293 4V64 10 AK, CK 30S ribosomal protein S11 562
294 4V7P 11 AK, DK 30S ribosomal protein S11 274
295 4V8J 11 AK, CK 30S ribosomal protein S11 274
296 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
297 2ZM6 11 K 30S ribosomal protein S11 274
298 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
299 4V4Q 10 AK, CK 30S ribosomal protein S11 562
300 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
301 5D8B 38 HC, LA 30S ribosomal protein S11 274
302 4LEL 11 QK, XK 30S ribosomal protein S11 274
303 4V53 10 AK, CK 30S ribosomal protein S11 562
304 2F4V 12 K 30S ribosomal protein S11 274
305 4V9L 10 AK, CK 30S ribosomal protein S11 274
306 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
307 4V56 10 AK, CK 30S ribosomal protein S11 562
308 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
309 4V9J 10 AK, CK 30S ribosomal protein S11 274
310 4V55 10 AK, CK 30S ribosomal protein S11 562
311 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
312 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
313 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
314 4V9M 10 AK, CK 30S ribosomal protein S11 274
315 4W29 10 AK, CK 30S ribosomal protein S11 274
316 4V5Y 10 AK, CK 30S ribosomal protein S11 562
317 4V4Y 13 AN 30S ribosomal protein S11 274
318 4V4J 44 l 30S ribosomal protein S11 274
319 4V4X 13 AN 30S ribosomal protein S11 274
320 4V4Z 14 AN 30S ribosomal protein S11 274
321 4V4I 44 l 30S ribosomal protein S11 274
322 4V4P 46 BN 30S ribosomal protein S11 274
323 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
324 4V4R 14 AK 30S ribosomal protein S11 274
325 4V4S 14 AK 30S ribosomal protein S11 274
326 4V4T 14 AK 30S ribosomal protein S11 274
327 4KZZ 15 O 40S Ribosomal Protein S14 9986
328 4KZX 15 O 40S ribosomal protein S14 9986
329 4KZY 15 O 40S Ribosomal Protein S14 9986
330 4V49 13 AK 30S ribosomal protein S11 562
331 4V4A 11 AK 30S ribosomal protein S11 562
332 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
333 6AWB 16 N 30S ribosomal protein S11 562
334 6AWC 16 N 30S ribosomal protein S11 562
335 6AWD 15 N 30S ribosomal protein S11 562
336 5OQL 42 t 40S ribosomal protein S14-like protein 209285
337 5WLC 40 NG rpS14_uS11 4932
338 5XYU 10 K 30S ribosomal protein S11 1772
339 5XYI 16 O Ribosomal protein S14 5722
340 5XXU 16 O Ribosomal protein uS11 5811
341 5OA3 19 O 40S ribosomal protein S14 9606
342 5O61 45 BK 30S ribosomal protein S11 1772
343 5O5J 11 K 30S ribosomal protein S11 1772
344 5O2R 45 k 30S ribosomal protein S11 562
345 5NWY 45 A 30S ribosomal protein S11 562
346 5NP6 14 N 30S ribosomal protein S11 562
347 5NO2 9 K 30S ribosomal protein S11 562
348 5NO3 10 K 30S ribosomal protein S11 562
349 5NO4 10 K 30S ribosomal protein S11 562
350 5NJT 11 K 30S ribosomal protein S11 1423
351 5V93 42 k 30S ribosomal protein S11 1773
352 5NGM 11 Ak 30S ribosomal protein S11 1280
353 5NG8 11 Ak, Bk 30S ribosomal protein S11 1280
354 5ND8 11 k 30S ribosomal protein S11 1280
355 5ND9 11 k 30S ribosomal protein S11 1280
356 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
357 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
358 5UYK 41 K 30S ribosomal protein S11 562
359 5UYL 41 K 30S ribosomal protein S11 562
360 5UYM 41 K 30S ribosomal protein S11 562
361 5UYN 41 K 30S ribosomal protein S11 562
362 5UYP 41 K 30S ribosomal protein S11 562
363 5UYQ 41 K 30S ribosomal protein S11 562
364 5UZ4 10 K 30S ribosomal protein S11 562
365 5MYJ 11 AK 30S ribosomal protein S11 1358
366 5MY1 10 K 30S ribosomal protein S11 562
367 5WYJ 45 SP 40S ribosomal protein S14-A 4932
368 5WYK 41 SP 40S ribosomal protein S14-A 4932
369 5U9F 49 K 30S ribosomal protein S11 562
370 5U9G 49 K 30S ribosomal protein S11 562
371 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
372 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
373 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
374 5MGP 42 k 30S ribosomal protein S11 562
375 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
376 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
377 5MDV 48 p 30S ribosomal protein S11 562
378 5MDW 48 p 30S ribosomal protein S11 562
379 5MDY 48 p 30S ribosomal protein S11 562
380 5MDZ 46 p 30S ribosomal protein S11 562
381 5H5U 49 r 30S ribosomal protein S11 562
382 5MC6 27 Z 40S ribosomal protein S14-A 4932
383 5M1J 22 O2 40S ribosomal protein S14-A 4932
384 5LZS 65 OO uS11,Uncharacterized protein 9986
385 5LZT 66 OO uS11 9986
386 5LZU 65 OO uS11 9986
387 5LZV 66 OO uS11 9986
388 5LZW 66 OO uS11 9986
389 5LZX 66 OO uS11 9986
390 5LZY 64 OO uS11 9986
391 5LZZ 66 OO uS11 9986
392 5LZA 11 k 30S ribosomal protein S11 562
393 5LZB 11 k 30S ribosomal protein S11 562
394 5LZC 11 k 30S ribosomal protein S11 562
395 5LZD 11 k 30S ribosomal protein S11 562
396 5LZE 11 k 30S ribosomal protein S11 562
397 5LZF 11 k 30S ribosomal protein S11 562
398 5TCU 10 S2 30S ribosomal protein S11 1280
399 5T7V 3 S2 30S ribosomal protein S11 1280
400 5T2A 63 AH uS11 5661
401 5T2C 80 AO 40S ribosomal protein S14 9606
402 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
403 5LMO 11 K 30S ribosomal protein S11 274
404 5LMP 11 K 30S ribosomal protein S11 274
405 5LMQ 11 K 30S ribosomal protein S11 274
406 5LMR 11 K 30S ribosomal protein S11 274
407 5LMS 11 K 30S ribosomal protein S11 274
408 5LMT 11 K 30S ribosomal protein S11 274
409 5LMU 11 K 30S ribosomal protein S11 274
410 5LMV 11 K 30S ribosomal protein S11 274
411 5LL6 12 Z 40S ribosomal protein S14-A 4932
412 5LKS 74 SO 40S ribosomal protein S14 9606
413 5LI0 11 k 30S ribosomal protein S11 1280
414 5KPS 42 16 30S ribosomal protein S11 562
415 5KPV 41 15 30S ribosomal protein S11 562
416 5KPW 41 15 30S ribosomal protein S11 562
417 5KPX 41 15 30S ribosomal protein S11 562
418 5KCR 43 1k 30S ribosomal protein S11 562
419 5KCS 45 1k 30S ribosomal protein S11 562
420 5L3P 42 k 30S ribosomal protein S11 562
421 5K0Y 32 j ribosomal protein uS11 9986
422 5JU8 11 AK 30S ribosomal protein S11 562
423 5JUO 64 LB uS11 (yeast S14) 4932
424 5JUP 64 LB uS11 (yeast S14) 4932
425 5JUS 64 LB uS11 (yeast S14) 4932
426 5JUT 64 LB uS11 (yeast S14) 4932
427 5JUU 64 LB uS11 (yeast S14) 4932
428 5JTE 11 AK 30S ribosomal protein S11 562
429 5JPQ 29 w uS11 209285
430 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
431 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
432 5IT7 62 O 40S ribosomal protein S14 28985
433 5IT9 15 O Ribosomal protein uS14 28985
434 5IQR 41 p 30S ribosomal protein S11 562
435 5IMQ 18 O 30S ribosomal protein S11 274
436 5IMR 11 O 30S ribosomal protein S11 274
437 3JCN 42 l 30S ribosomal protein S11 562
438 3JCJ 47 q 30S ribosomal protein S11 562
439 3JCD 10 k 30S ribosomal protein S11 562
440 3JCE 10 k 30S ribosomal protein S11 562
441 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
442 3JBU 10 K 30S ribosomal protein S11 8333
443 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
444 3JBN 26 P 40S ribosomal protein uS11 5833
445 3JBO 32 P 40S ribosomal protein uS11 5833
446 3JBP 26 P 40S ribosomal protein uS11 5833
447 5A9Z 44 BO 30S ribosomal protein S11 274
448 5AA0 44 BO 30S ribosomal protein S11 274
449 3JAP 18 O uS11 28985
450 3JAQ 18 O uS11 28985
451 3JAM 16 O uS11 28985
452 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
453 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
454 3JAG 66 OO uS11 9986
455 3JAH 66 OO uS11 9986
456 3JAI 66 OO uS11 9986
457 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
458 3JA1 11 SK 30S ribosomal protein S11 562
459 3J9Z 5 SK 30S ribosomal protein S11 562
460 3J9Y 7 k 30S ribosomal protein S11 562
461 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
462 3J9W 11 AK 30S ribosomal protein uS11 1423
463 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
464 5AJ0 64 BO 40S ribosomal protein S14 9606
465 5AFI 11 k 30S ribosomal protein S11 562
466 4UER 21 K US11 4934
467 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
468 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
469 4V3P 9 SK 40S ribosomal protein S14 4565
470 3J81 16 O uS11 28985
471 3J80 12 O uS11 28985
472 3J7P 64 SO Ribosomal protein uS11 9823
473 3J7R 65 SO Ribosomal protein uS11 9823
474 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
475 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
476 3J7A 16 P 40S ribosomal protein uS11 5833
477 3J77 60 14 40S ribosomal protein S14 4932
478 3J78 60 14 40S ribosomal protein S14 4932
479 3J6X 61 14 40S ribosomal protein S14 4932
480 3J6Y 61 14 40S ribosomal protein S14 4932
481 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
482 4V92 17 BO US11 28985
483 4V7E 16 BO 40S ribosomal protein S11 4565
484 4V7D 45 BK 30S ribosomal protein S11 562
485 4V7C 11 AK 30S ribosomal protein S11 562
486 4V7B 11 AK 30S ribosomal protein S11 562
487 4V6Y 10 AK 30S ribosomal protein S11 562
488 4V6Z 10 AK 30S ribosomal protein S11 562
489 4V70 10 AK 30S ribosomal protein S11 562
490 4V71 10 AK 30S ribosomal protein S11 562
491 4V72 10 AK 30S ribosomal protein S11 562
492 4V73 10 AK 30S ribosomal protein S11 562
493 4V74 10 AK 30S ribosomal protein S11 562
494 4V75 10 AK 30S ribosomal protein S11 562
495 4V76 10 AK 30S ribosomal protein S11 562
496 4V77 10 AK 30S ribosomal protein S11 562
497 4V78 10 AK 30S ribosomal protein S11 562
498 4V79 10 AK 30S ribosomal protein S11 562
499 4V7A 10 AK 30S ribosomal protein S11 562
500 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
501 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
502 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
503 4V6W 5 AO 40S ribosomal protein S14 7227
504 4V6X 5 AO 40S ribosomal protein S14 9606
505 4V6V 2 AK 30S ribosomal protein S11 562
506 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
507 4V6U 14 AM 30S ribosomal protein S11P 2261
508 4V6T 11 AK 30S ribosomal protein S11 562
509 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
510 4V6S 47 BM 30S ribosomal protein S11 562
511 4V6P 14 AN 30S ribosomal protein S11 562
512 4V6Q 14 AN 30S ribosomal protein S11 562
513 4V6R 14 AN 30S ribosomal protein S11 562
514 4V6N 48 BN 30S ribosomal protein S11 562
515 4V6O 14 AN 30S ribosomal protein S11 562
516 3J0O 12 K Ribosomal protein S14 9986
517 3J0L 12 K Ribosomal protein S14 9986
518 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
519 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
520 4V6M 15 AK 30S ribosomal protein S11 562
521 4V6K 47 BO 30S ribosomal protein S11 562
522 4V6L 14 AO 30S ribosomal protein S11 562
523 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
524 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
525 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
526 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
527 4V7I 46 BK 30S ribosomal protein S11 562
528 4V7H 10 AK 40S ribosomal protein S14(A) 5541
529 3IY8 6 K 30S ribosomal protein S11 562
530 4V68 7 AK 30S ribosomal protein S11 274
531 4V69 2 AK 30S ribosomal protein S11 562
532 4V65 5 AC 30S ribosomal protein S11 562
533 4V66 5 AC 30S ribosomal protein S11 562
534 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
535 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
536 4V4V 12 AK 30S ribosomal subunit protein S11 562
537 4V4W 12 AK 30S ribosomal subunit protein S11 562
538 1X18 7 G 30S ribosomal protein S11 274
539 4V4B 11 AK 40S ribosomal protein S14-A 4932
540 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
541 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
542 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
543 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
544 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
545 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
546 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274