Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 252 35
95 % 56 253 48
90 % 56 253 53
70 % 56 253 63
50 % 68 348 28
40 % 68 348 38
30 % 73 420 36
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 254 33
95 % 56 254 44
90 % 56 254 49
70 % 56 254 58
50 % 62 342 36
40 % 69 421 22
30 % 69 422 35
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 20207
95 % 56 261 35
90 % 56 261 39
70 % 62 353 23
50 % 62 354 27
40 % 62 354 37
30 % 62 354 56
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 255 30
95 % 56 255 41
90 % 56 255 46
70 % 56 255 55
50 % 62 347 33
40 % 62 347 45
30 % 67 421 41
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 253 34
95 % 56 253 49
90 % 56 253 54
70 % 56 254 61
50 % 56 254 86
40 % 56 254 107
30 % 56 254 119
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 257 27
95 % 58 262 34
90 % 58 262 38
70 % 58 262 49
50 % 67 355 26
40 % 67 356 36
30 % 67 356 55
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 249 36
95 % 56 254 46
90 % 56 254 51
70 % 56 254 60
50 % 56 254 85
40 % 56 255 106
30 % 62 345 63
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 161 57
95 % 56 248 50
90 % 56 252 55
70 % 56 252 64
50 % 56 252 88
40 % 56 252 109
30 % 56 252 122
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 49 168 56
95 % 50 219 63
90 % 50 219 68
70 % 50 219 78
50 % 50 219 108
40 % 50 219 130
30 % 50 219 142
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 257 26
95 % 57 257 37
90 % 57 257 43
70 % 57 257 52
50 % 63 345 31
40 % 63 345 42
30 % 63 345 60
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 254 28
95 % 56 255 38
90 % 56 255 44
70 % 56 255 53
50 % 62 341 35
40 % 62 342 47
30 % 62 342 62
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 55 202 47
95 % 56 253 47
90 % 56 253 52
70 % 56 253 62
50 % 56 253 87
40 % 56 253 108
30 % 56 253 121
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 244 38
95 % 56 244 54
90 % 56 244 57
70 % 56 244 68
50 % 56 244 92
40 % 56 244 115
30 % 56 244 129
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 218 44
95 % 50 218 64
90 % 50 218 69
70 % 50 218 79
50 % 52 269 79
40 % 52 269 98
30 % 52 269 112
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 247 37
95 % 56 255 39
90 % 56 255 45
70 % 56 255 54
50 % 62 342 34
40 % 62 343 44
30 % 62 343 61
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 254 32
95 % 56 254 43
90 % 56 254 48
70 % 56 254 57
50 % 63 346 30
40 % 63 346 41
30 % 63 348 57
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 259 24
95 % 63 265 33
90 % 63 265 36
70 % 63 265 44
50 % 63 265 82
40 % 63 265 101
30 % 69 304 78
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 258 25
95 % 57 259 36
90 % 57 259 41
70 % 57 259 50
50 % 62 304 51
40 % 62 305 64
30 % 62 305 87
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 254 29
95 % 57 254 40
90 % 57 258 42
70 % 57 258 51
50 % 65 348 29
40 % 66 350 39
30 % 72 425 33
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 163 72
95 % 56 254 45
90 % 56 254 50
70 % 56 254 59
50 % 62 342 37
40 % 62 342 48
30 % 67 416 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 4LFB 11 K ribosomal protein S11 274
12 1VY4 11 AK, CK 30S ribosomal protein S11 274
13 4WOI 11 AK, DK 30S ribosomal protein S11 562
14 5FDU 42 1k, 2k 30S ribosomal protein S11 274
15 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
16 1VY5 11 AK, CK 30S ribosomal protein S11 274
17 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
18 4WQF 44 BK, DK 30S ribosomal protein S11 274
19 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
20 4WPO 44 BK, DK 30S ribosomal protein S11 274
21 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
22 4JI1 11 K RIBOSOMAL PROTEIN S11 274
23 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
24 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
25 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
26 5HD1 42 1k, 2k 30S ribosomal protein S11 274
27 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
28 4DR6 11 K 30S ribosomal protein S11 274
29 4LF7 11 K ribosomal protein S11 274
30 4LF8 11 K ribosomal protein S11 274
31 4WSD 11 2A, 2I 30S ribosomal protein S11 274
32 4WQU 44 BK, DK 30S ribosomal protein S11 274
33 5E81 11 2A, 2I 30S ribosomal protein S11 274
34 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
35 4U27 11 AK, CK 30S ribosomal protein S11 562
36 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
37 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
38 5HCR 42 1k, 2k 30S ribosomal protein S11 274
39 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
40 4DV6 11 K ribosomal protein S11 274
41 4JYA 11 K 30S ribosomal protein S11 274
42 5IBB 11 2A, 2I 30S ribosomal protein S11 274
43 4DR5 11 K 30S ribosomal protein S11 274
44 5J4C 42 1k, 2k 30S ribosomal protein S11 274
45 4KHP 11 K 30S Ribosomal protein S11 274
46 4DR2 11 K 30S ribosomal protein S11 274
47 4WRO 15 2I 30S ribosomal protein S11 274
48 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
49 4LF9 11 K ribosomal protein S11 274
50 4WQY 44 BK, DK 30S ribosomal protein S11 274
51 4DUY 11 K ribosomal protein S11 274
52 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
53 4DV7 11 K ribosomal protein S11 274
54 4WRA 11 2A, 2I 30S ribosomal protein S11 274
55 5IB7 11 2A, 2I 30S ribosomal protein S11 274
56 4U26 11 AK, CK 30S ribosomal protein S11 562
57 4X64 11 K 30S ribosomal protein S11 274
58 5HCP 42 1k, 2k 30S ribosomal protein S11 274
59 4V9D 11 AK, BK 30S ribosomal protein S11 562
60 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
61 4V9H 5 AK 30S ribosomal protein S11 274
62 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
63 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
64 4DR3 11 K 30S ribosomal protein S11 274
65 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
66 4JI3 11 K RIBOSOMAL PROTEIN S11 274
67 4WQR 11 2A, 2I 30S ribosomal protein S11 274
68 4JI6 11 K RIBOSOMAL PROTEIN S11 274
69 4JI8 11 K RIBOSOMAL PROTEIN S11 274
70 2UXC 11 K RIBOSOMAL PROTEIN S11 274
71 5IB8 11 2A, 2I 30S ribosomal protein S11 274
72 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
73 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
74 5EL6 11 2A, 2I 30S ribosomal protein S11 274
75 5EL7 11 2A, 2I 30S ribosomal protein S11 274
76 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
77 4LF4 11 K ribosomal protein S11 274
78 4LF6 11 K ribosomal protein S11 274
79 4JI7 11 K RIBOSOMAL PROTEIN S11 274
80 4U24 11 AK, CK 30S ribosomal protein S11 562
81 4WU1 11 2A, 2I 30S ribosomal protein S11 274
82 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
83 5EL4 11 2A, 2I 30S ribosomal protein S11 274
84 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
85 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
86 4WR6 11 2A, 2I 30S ribosomal protein S11 274
87 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
88 5HAU 44 1k, 2k 30S ribosomal protein S11 274
89 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
90 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
91 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
92 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
93 4WF1 11 AK, CK 30S ribosomal protein S11 562
94 4U25 11 AK, CK 30S ribosomal protein S11 562
95 4V95 11 AK, CK 30S Ribosomal Protein S11 274
96 4WWW 42 QK, XK 30S ribosomal protein S11 562
97 4V7T 11 AK, CK 30S ribosomal protein S11 562
98 1VY7 11 AK, CK 30S ribosomal protein S11 274
99 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
100 5E7K 11 2A, 2I 30S ribosomal protein S11 274
101 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
102 5EL5 11 2A, 2I 30S ribosomal protein S11 274
103 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
104 4LNT 11 QK, XK 30S ribosomal protein S11 274
105 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
106 4DR1 11 K 30S ribosomal protein S11 274
107 4LFA 11 K ribosomal protein S11 274
108 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
109 4DV4 11 K ribosomal protein S11 274
110 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
111 4YZV 11 QK, XK 30S ribosomal protein S11 274
112 4JI0 11 K ribosomal protein S11 274
113 5IWA 10 K 30S ribosomal protein S11 274
114 4V7U 11 AK, CK 30S ribosomal protein S11 562
115 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
116 4JI2 11 K RIBOSOMAL PROTEIN S11 274
117 4V6C 10 AK, CK 30S ribosomal protein S11 562
118 4JV5 11 K 30S ribosomal protein S11 274
119 4DR7 11 K 30S ribosomal protein S11 274
120 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
121 4GKK 11 K 30S ribosomal protein S11 274
122 4DUZ 11 K ribosomal protein S11 274
123 4V7V 11 AK, CK 30S ribosomal protein S11 562
124 4X65 11 K 30S ribosomal protein S11 274
125 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
126 4GKJ 11 K 30S ribosomal protein S11 274
127 4DV3 11 K ribosomal protein S11 274
128 4V7S 11 AK, CK 30S ribosomal protein S11 562
129 4DV5 11 K ribosomal protein S11 274
130 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
131 4LFC 11 K ribosomal protein S11 274
132 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
133 3T1Y 11 K 30S ribosomal protein S11 274
134 4WZO 11 2A, 2I 30S ribosomal protein S11 274
135 4JI4 11 K RIBOSOMAL PROTEIN S11 274
136 1VY6 11 AK, CK 30S ribosomal protein S11 274
137 1XMQ 13 K 30S Ribosomal Protein S11 274
138 4U20 11 AK, CK 30S ribosomal protein S11 562
139 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
140 4DV0 11 K ribosomal protein S11 274
141 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
142 4U1V 11 AK, CK 30S ribosomal protein S11 562
143 4V6F 41 BN, CN 30S ribosomal protein S11 274
144 4X62 11 K 30S ribosomal protein S11 274
145 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
146 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
147 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
148 4DV2 11 K ribosomal protein S11 274
149 4DV1 11 K ribosomal protein S11 274
150 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
151 5F8K 42 1k, 2k 30S ribosomal protein S11 274
152 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
153 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
154 4JI5 11 K RIBOSOMAL PROTEIN S11 274
155 4K0K 11 K 30S ribosomal protein S11 274
156 4W2E 44 k 30S ribosomal protein S11 274
157 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
158 5BR8 11 K 30S ribosomal protein S11 274
159 4LF5 11 K ribosomal protein S11 274
160 5J4D 45 TA, YC 30S ribosomal protein S11 274
161 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
162 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
163 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
164 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
165 4V7Y 11 AK, CK 30S ribosomal protein S11 274
166 4V9C 11 AK, CK 30S ribosomal protein S11 562
167 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
168 4DR4 11 K 30S ribosomal protein S11 274
169 4WZD 11 2A, 2I 30S ribosomal protein S11 274
170 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
171 4X66 11 K 30S ribosomal protein S11 274
172 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
173 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
174 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
175 4V85 11 AK 30S ribosomal protein S11 562
176 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
177 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
178 4W4G 11 QK, XK 30S ribosomal protein S11 274
179 4NXM 11 K ribosomal protein S11 274
180 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
181 4YPB 11 QK, XK 30S ribosomal protein S11 274
182 4V7X 11 AK, CK 30S ribosomal protein S11 274
183 4U1U 11 AK, CK 30S ribosomal protein S11 562
184 4ZER 42 1k, 2k 30S ribosomal protein S11 274
185 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
186 4V7W 11 AK, CK 30S ribosomal protein S11 274
187 4WT1 11 2A, 2I 30S ribosomal protein S11 274
188 4WT8 11 AK, BK 30S ribosomal protein S11 274
189 5DOX 42 1k, 2k 30S ribosomal protein S11 274
190 4NXN 11 K ribosomal protein S11 274
191 1XNR 13 K 16S Ribosomal protein S11 274
192 4LT8 11 QK, XK 30S ribosomal protein S11 274
193 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
194 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
195 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
196 4V7L 11 AK, CK 30S ribosomal protein S11 274
197 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
198 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
199 1XNQ 13 K Ribosomal protein S11 274
200 4V8A 41 CK, DK 30S ribosomal protein S11 274
201 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
202 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
203 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
204 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
205 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
206 4L47 11 QK, XK 30S ribosomal protein S11 274
207 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
208 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
209 4V7Z 11 AK, CK 30S ribosomal protein S11 274
210 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
211 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
212 4V9I 11 AK, CK 30S Ribosomal protein S11 274
213 1XMO 13 K 30S ribosomal protein S11 274
214 3T1H 11 K 30S ribosomal protein S11 274
215 2UXD 11 K RIBOSOMAL PROTEIN S11 274
216 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
217 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
218 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
219 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
220 4V97 11 AK, CK 30S ribosomal protein S11 274
221 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
222 4V7M 11 AK, CK 30S ribosomal protein S11 274
223 4WSM 11 2A, 2I 30S ribosomal protein S11 274
224 4TUD 11 QK, XK 30S ribosomal protein S11 274
225 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
226 4V6A 11 AK, CK 30S ribosomal protein S11 274
227 4TUE 11 QK, XK 30S ribosomal protein S11 274
228 4TUA 11 QK, XK 30S ribosomal protein S11 274
229 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
230 4V84 11 AK, CK 30S ribosomal protein S11 274
231 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
232 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
233 4V9Q 41 BK, DK 30S ribosomal protein S11 274
234 4TUC 11 QK, XK 30S ribosomal protein S11 274
235 4YHH 11 K 30S ribosomal protein S11 274
236 4TUB 11 QK, XK 30S ribosomal protein S11 274
237 4V9N 14 AK, CK 30S ribosomal protein S11 274
238 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
239 4P70 11 QK, XK 30S ribosomal protein S11 274
240 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
241 4LSK 11 QK, XK 30S ribosomal protein S11 274
242 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
243 4V6D 10 AK, CK 30S ribosomal protein S11 562
244 4P6F 11 QK, XK 30S ribosomal protein S11 274
245 4V67 13 AK, CK 30S ribosomal protein S11 274
246 4V83 11 AK, CK 30S ribosomal protein S11 274
247 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
248 4V5O 20 AK, BK RPS14E 5911
249 1VVJ 11 QK, XK 30S ribosomal protein S11 274
250 4LFZ 11 QK, XK 30S ribosomal protein S11 274
251 2E5L 12 K 30S ribosomal protein S11 274
252 4V6E 10 AK, CK 30S ribosomal protein S11 562
253 4V52 10 AK, CK 30S ribosomal protein S11 562
254 2HHH 11 K 30S ribosomal protein S11 274
255 4V89 11 AK 30S ribosomal protein S11 562
256 4OX9 11 K 30S ribosomal protein S11 274
257 4V54 10 AK, CK 30S ribosomal protein S11 562
258 2UXB 11 K RIBOSOMAL PROTEIN S11 274
259 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
260 4V9K 10 AK, CK 30S ribosomal protein S11 274
261 4V50 13 AK, CK 30S ribosomal protein S11 562
262 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
263 4V57 10 AK, CK 30S ribosomal protein S11 562
264 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
265 4V63 13 AK, CK 30S ribosomal protein S11 274
266 4L71 11 QK, XK 30S ribosomal protein S11 274
267 4KVB 11 K 30S ribosomal protein S11 274
268 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
269 4V64 10 AK, CK 30S ribosomal protein S11 562
270 4V7P 11 AK, DK 30S ribosomal protein S11 274
271 4V8J 11 AK, CK 30S ribosomal protein S11 274
272 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
273 2ZM6 11 K 30S ribosomal protein S11 274
274 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
275 4V4Q 10 AK, CK 30S ribosomal protein S11 562
276 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
277 5D8B 38 HC, LA 30S ribosomal protein S11 274
278 4LEL 11 QK, XK 30S ribosomal protein S11 274
279 4V53 10 AK, CK 30S ribosomal protein S11 562
280 2F4V 12 K 30S ribosomal protein S11 274
281 4V9L 10 AK, CK 30S ribosomal protein S11 274
282 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
283 4V56 10 AK, CK 30S ribosomal protein S11 562
284 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
285 4V9J 10 AK, CK 30S ribosomal protein S11 274
286 4V55 10 AK, CK 30S ribosomal protein S11 562
287 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
288 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
289 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
290 4V9M 10 AK, CK 30S ribosomal protein S11 274
291 4W29 10 AK, CK 30S ribosomal protein S11 274
292 4V5Y 10 AK, CK 30S ribosomal protein S11 562
293 4V4Y 13 AN 30S ribosomal protein S11 274
294 4V4J 44 l 30S ribosomal protein S11 274
295 4V4X 13 AN 30S ribosomal protein S11 274
296 4V4Z 14 AN 30S ribosomal protein S11 274
297 4V4I 44 l 30S ribosomal protein S11 274
298 4V4P 46 BN 30S ribosomal protein S11 274
299 4V4R 14 AK 30S ribosomal protein S11 274
300 4V4S 14 AK 30S ribosomal protein S11 274
301 4V4T 14 AK 30S ribosomal protein S11 274
302 4KZZ 15 O 40S Ribosomal Protein S14 9986
303 4KZX 15 O 40S ribosomal protein S14 9986
304 4KZY 15 O 40S Ribosomal Protein S14 9986
305 4V49 13 AK 30S ribosomal protein S11 562
306 4V4A 11 AK 30S ribosomal protein S11 562
307 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
308 5IT7 62 O 40S ribosomal protein S14 28985
309 5IT9 15 O Ribosomal protein uS14 28985
310 5IQR 41 p 30S ribosomal protein S11 562
311 5IMQ 18 O 30S ribosomal protein S11 274
312 5IMR 11 O 30S ribosomal protein S11 274
313 3JCN 42 l 30S ribosomal protein S11 562
314 3JCJ 47 q 30S ribosomal protein S11 562
315 3JCD 10 k 30S ribosomal protein S11 562
316 3JCE 10 k 30S ribosomal protein S11 562
317 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
318 3JBU 10 K 30S ribosomal protein S11 8333
319 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
320 3JBN 26 P 40S ribosomal protein uS11 5833
321 3JBO 32 P 40S ribosomal protein uS11 5833
322 3JBP 26 P 40S ribosomal protein uS11 5833
323 5A9Z 44 BO 30S ribosomal protein S11 274
324 5AA0 44 BO 30S ribosomal protein S11 274
325 3JAP 18 O uS11 28985
326 3JAQ 18 O uS11 28985
327 3JAM 16 O uS11 28985
328 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
329 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
330 3JAG 66 OO uS11 9986
331 3JAH 66 OO uS11 9986
332 3JAI 66 OO uS11 9986
333 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
334 3JA1 11 SK 30S ribosomal protein S11 562
335 3J9Z 5 SK 30S ribosomal protein S11 562
336 3J9Y 7 k 30S ribosomal protein S11 562
337 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
338 3J9W 11 AK 30S ribosomal protein uS11 1423
339 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
340 5AJ0 64 BO 40S ribosomal protein S14 9606
341 5AFI 11 k 30S ribosomal protein S11 562
342 4UER 21 K US11 4934
343 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
344 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
345 4V3P 9 SK 40S ribosomal protein S14 4565
346 3J81 16 O uS11 28985
347 3J80 12 O uS11 28985
348 3J7P 64 SO Ribosomal protein uS11 9823
349 3J7R 65 SO Ribosomal protein uS11 9823
350 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
351 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
352 3J7A 16 P 40S ribosomal protein uS11 5833
353 3J77 60 14 40S ribosomal protein S14 4932
354 3J78 60 14 40S ribosomal protein S14 4932
355 3J6X 61 14 40S ribosomal protein S14 4932
356 3J6Y 61 14 40S ribosomal protein S14 4932
357 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
358 4V92 17 BO US11 28985
359 4V7E 16 BO 40S ribosomal protein S11 4565
360 4V7D 45 BK 30S ribosomal protein S11 562
361 4V7C 11 AK 30S ribosomal protein S11 562
362 4V7B 11 AK 30S ribosomal protein S11 562
363 4V6Y 10 AK 30S ribosomal protein S11 562
364 4V6Z 10 AK 30S ribosomal protein S11 562
365 4V70 10 AK 30S ribosomal protein S11 562
366 4V71 10 AK 30S ribosomal protein S11 562
367 4V72 10 AK 30S ribosomal protein S11 562
368 4V73 10 AK 30S ribosomal protein S11 562
369 4V74 10 AK 30S ribosomal protein S11 562
370 4V75 10 AK 30S ribosomal protein S11 562
371 4V76 10 AK 30S ribosomal protein S11 562
372 4V77 10 AK 30S ribosomal protein S11 562
373 4V78 10 AK 30S ribosomal protein S11 562
374 4V79 10 AK 30S ribosomal protein S11 562
375 4V7A 10 AK 30S ribosomal protein S11 562
376 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
377 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
378 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
379 4V6W 5 AO 40S ribosomal protein S14 7227
380 4V6X 5 AO 40S ribosomal protein S14 9606
381 4V6V 2 AK 30S ribosomal protein S11 562
382 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
383 4V6U 14 AM 30S ribosomal protein S11P 2261
384 4V6T 11 AK 30S ribosomal protein S11 562
385 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
386 4V6S 47 BM 30S ribosomal protein S11 562
387 4V6P 14 AN 30S ribosomal protein S11 562
388 4V6Q 14 AN 30S ribosomal protein S11 562
389 4V6R 14 AN 30S ribosomal protein S11 562
390 4V6N 48 BN 30S ribosomal protein S11 562
391 4V6O 14 AN 30S ribosomal protein S11 562
392 3J0O 12 K Ribosomal protein S14 9986
393 3J0L 12 K Ribosomal protein S14 9986
394 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
395 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
396 4V6M 15 AK 30S ribosomal protein S11 562
397 4V6K 47 BO 30S ribosomal protein S11 562
398 4V6L 14 AO 30S ribosomal protein S11 562
399 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
400 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
401 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
402 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
403 4V7I 46 BK 30S ribosomal protein S11 562
404 4V7H 10 AK 40S ribosomal protein S14(A) 5541
405 3IY8 6 K 30S ribosomal protein S11 562
406 4V68 7 AK 30S ribosomal protein S11 274
407 4V69 2 AK 30S ribosomal protein S11 562
408 4V65 5 AC 30S ribosomal protein S11 562
409 4V66 5 AC 30S ribosomal protein S11 562
410 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
411 4V4V 12 AK 30S ribosomal subunit protein S11 562
412 4V4W 12 AK 30S ribosomal subunit protein S11 562
413 1X18 7 G 30S ribosomal protein S11 274
414 4V4B 11 AK 40S ribosomal protein S14-A 4932
415 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
416 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
417 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
418 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
419 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
420 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
421 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274