Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 267 40
95 % 56 268 54
90 % 56 268 58
70 % 56 268 69
50 % 74 402 26
40 % 74 402 37
30 % 79 502 32
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 269 37
95 % 56 269 50
90 % 56 269 54
70 % 56 269 64
50 % 68 395 34
40 % 75 501 19
30 % 75 501 33
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 22014
95 % 56 276 40
90 % 56 276 44
70 % 68 406 22
50 % 68 412 25
40 % 68 412 35
30 % 68 412 55
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 270 35
95 % 56 270 47
90 % 56 270 52
70 % 56 270 62
50 % 68 400 33
40 % 68 400 45
30 % 73 502 36
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 268 38
95 % 56 268 55
90 % 56 268 59
70 % 56 271 61
50 % 56 271 90
40 % 56 271 111
30 % 56 271 124
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 272 30
95 % 58 277 39
90 % 58 277 43
70 % 58 277 55
50 % 73 408 27
40 % 73 411 36
30 % 73 411 56
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 264 41
95 % 56 269 52
90 % 56 269 56
70 % 56 269 66
50 % 56 272 89
40 % 56 272 110
30 % 68 396 64
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 176 58
95 % 56 263 57
90 % 56 267 60
70 % 56 267 70
50 % 56 267 94
40 % 56 267 115
30 % 56 267 127
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 49 183 56
95 % 50 234 65
90 % 50 234 70
70 % 50 234 81
50 % 50 234 108
40 % 50 234 133
30 % 50 234 142
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 272 29
95 % 57 272 43
90 % 57 272 48
70 % 57 272 58
50 % 69 400 30
40 % 69 403 41
30 % 69 403 58
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 269 33
95 % 56 270 44
90 % 56 270 50
70 % 56 270 59
50 % 68 392 37
40 % 68 395 46
30 % 68 395 62
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 55 217 51
95 % 56 268 53
90 % 56 268 57
70 % 56 268 68
50 % 56 268 93
40 % 56 268 114
30 % 56 268 126
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 259 43
95 % 56 259 59
90 % 56 259 63
70 % 56 259 75
50 % 56 259 98
40 % 56 259 120
30 % 56 259 131
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 233 48
95 % 50 233 66
90 % 50 233 71
70 % 50 233 82
50 % 52 306 83
40 % 52 306 102
30 % 52 306 114
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 262 42
95 % 56 270 45
90 % 56 270 51
70 % 56 270 60
50 % 68 396 32
40 % 68 399 43
30 % 68 399 61
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 269 36
95 % 56 269 49
90 % 56 269 53
70 % 56 269 63
50 % 69 400 31
40 % 69 400 44
30 % 69 402 59
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 274 27
95 % 63 280 37
90 % 63 280 41
70 % 63 280 52
50 % 63 280 87
40 % 63 280 106
30 % 75 336 93
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 273 28
95 % 57 274 41
90 % 57 274 45
70 % 57 274 56
50 % 68 339 71
40 % 68 342 84
30 % 68 342 97
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 269 34
95 % 57 269 46
90 % 57 273 46
70 % 57 273 57
50 % 71 401 28
40 % 72 405 38
30 % 78 514 30
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 178 68
95 % 56 269 51
90 % 56 269 55
70 % 56 269 65
50 % 68 395 35
40 % 68 395 47
30 % 73 501 35

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 5J7L 11 AK, BK 30S ribosomal protein S11 562
12 4LFB 11 K ribosomal protein S11 274
13 1VY4 11 AK, CK 30S ribosomal protein S11 274
14 4WOI 11 AK, DK 30S ribosomal protein S11 562
15 5FDU 42 1k, 2k 30S ribosomal protein S11 274
16 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
17 5JC9 11 AK, BK 30S ribosomal protein S11 562
18 1VY5 11 AK, CK 30S ribosomal protein S11 274
19 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
20 4WQF 44 BK, DK 30S ribosomal protein S11 274
21 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
22 4WPO 44 BK, DK 30S ribosomal protein S11 274
23 5J8A 11 AK, BK 30S ribosomal protein S11 562
24 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
25 4JI1 11 K RIBOSOMAL PROTEIN S11 274
26 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
27 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
28 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
29 5J5B 11 AK, BK 30S ribosomal protein S11 562
30 5HD1 42 1k, 2k 30S ribosomal protein S11 274
31 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
32 4DR6 11 K 30S ribosomal protein S11 274
33 4LF7 11 K ribosomal protein S11 274
34 4LF8 11 K ribosomal protein S11 274
35 4WSD 11 2A, 2I 30S ribosomal protein S11 274
36 4WQU 44 BK, DK 30S ribosomal protein S11 274
37 5E81 11 2A, 2I 30S ribosomal protein S11 274
38 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
39 4U27 11 AK, CK 30S ribosomal protein S11 562
40 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
41 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
42 5HCR 42 1k, 2k 30S ribosomal protein S11 274
43 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
44 4DV6 11 K ribosomal protein S11 274
45 4JYA 11 K 30S ribosomal protein S11 274
46 5IBB 11 2A, 2I 30S ribosomal protein S11 274
47 4DR5 11 K 30S ribosomal protein S11 274
48 5J4C 42 1k, 2k 30S ribosomal protein S11 274
49 4KHP 11 K 30S Ribosomal protein S11 274
50 4DR2 11 K 30S ribosomal protein S11 274
51 4WRO 15 2I 30S ribosomal protein S11 274
52 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
53 4LF9 11 K ribosomal protein S11 274
54 4WQY 44 BK, DK 30S ribosomal protein S11 274
55 4DUY 11 K ribosomal protein S11 274
56 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
57 4DV7 11 K ribosomal protein S11 274
58 4WRA 11 2A, 2I 30S ribosomal protein S11 274
59 5IB7 11 2A, 2I 30S ribosomal protein S11 274
60 4U26 11 AK, CK 30S ribosomal protein S11 562
61 4X64 11 K 30S ribosomal protein S11 274
62 5HCP 42 1k, 2k 30S ribosomal protein S11 274
63 5IT8 11 AK, BK 30S ribosomal protein S11 562
64 4V9D 11 AK, BK 30S ribosomal protein S11 562
65 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
66 4V9H 5 AK 30S ribosomal protein S11 274
67 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
68 5J91 11 AK, BK 30S ribosomal protein S11 562
69 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
70 4DR3 11 K 30S ribosomal protein S11 274
71 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
72 4JI3 11 K RIBOSOMAL PROTEIN S11 274
73 4WQR 11 2A, 2I 30S ribosomal protein S11 274
74 4JI6 11 K RIBOSOMAL PROTEIN S11 274
75 4JI8 11 K RIBOSOMAL PROTEIN S11 274
76 2UXC 11 K RIBOSOMAL PROTEIN S11 274
77 5IB8 11 2A, 2I 30S ribosomal protein S11 274
78 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
79 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
80 5EL6 11 2A, 2I 30S ribosomal protein S11 274
81 5EL7 11 2A, 2I 30S ribosomal protein S11 274
82 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
83 4LF4 11 K ribosomal protein S11 274
84 5DFE 45 QK, XK 30S ribosomal protein S11 274
85 4LF6 11 K ribosomal protein S11 274
86 4JI7 11 K RIBOSOMAL PROTEIN S11 274
87 5J88 11 AK, BK 30S ribosomal protein S11 562
88 4U24 11 AK, CK 30S ribosomal protein S11 562
89 4WU1 11 2A, 2I 30S ribosomal protein S11 274
90 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
91 5EL4 11 2A, 2I 30S ribosomal protein S11 274
92 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
93 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
94 4WR6 11 2A, 2I 30S ribosomal protein S11 274
95 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
96 5HAU 44 1k, 2k 30S ribosomal protein S11 274
97 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
98 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
99 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
100 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
101 4WF1 11 AK, CK 30S ribosomal protein S11 562
102 4U25 11 AK, CK 30S ribosomal protein S11 562
103 4V95 11 AK, CK 30S Ribosomal Protein S11 274
104 4WWW 42 QK, XK 30S ribosomal protein S11 562
105 4V7T 11 AK, CK 30S ribosomal protein S11 562
106 1VY7 11 AK, CK 30S ribosomal protein S11 274
107 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
108 5E7K 11 2A, 2I 30S ribosomal protein S11 274
109 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
110 5EL5 11 2A, 2I 30S ribosomal protein S11 274
111 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
112 4LNT 11 QK, XK 30S ribosomal protein S11 274
113 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
114 4DR1 11 K 30S ribosomal protein S11 274
115 4LFA 11 K ribosomal protein S11 274
116 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
117 4DV4 11 K ribosomal protein S11 274
118 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
119 4YZV 11 QK, XK 30S ribosomal protein S11 274
120 4JI0 11 K ribosomal protein S11 274
121 5IWA 10 K 30S ribosomal protein S11 274
122 4V7U 11 AK, CK 30S ribosomal protein S11 562
123 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
124 4JI2 11 K RIBOSOMAL PROTEIN S11 274
125 4V6C 10 AK, CK 30S ribosomal protein S11 562
126 4JV5 11 K 30S ribosomal protein S11 274
127 4DR7 11 K 30S ribosomal protein S11 274
128 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
129 4GKK 11 K 30S ribosomal protein S11 274
130 4DUZ 11 K ribosomal protein S11 274
131 4V7V 11 AK, CK 30S ribosomal protein S11 562
132 4X65 11 K 30S ribosomal protein S11 274
133 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
134 4GKJ 11 K 30S ribosomal protein S11 274
135 4DV3 11 K ribosomal protein S11 274
136 4V7S 11 AK, CK 30S ribosomal protein S11 562
137 4DV5 11 K ribosomal protein S11 274
138 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
139 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
140 4LFC 11 K ribosomal protein S11 274
141 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
142 3T1Y 11 K 30S ribosomal protein S11 274
143 4WZO 11 2A, 2I 30S ribosomal protein S11 274
144 4JI4 11 K RIBOSOMAL PROTEIN S11 274
145 1VY6 11 AK, CK 30S ribosomal protein S11 274
146 1XMQ 13 K 30S Ribosomal Protein S11 274
147 4U20 11 AK, CK 30S ribosomal protein S11 562
148 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
149 4DV0 11 K ribosomal protein S11 274
150 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
151 4U1V 11 AK, CK 30S ribosomal protein S11 562
152 4V6F 41 BN, CN 30S ribosomal protein S11 274
153 4X62 11 K 30S ribosomal protein S11 274
154 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
155 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
156 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
157 4DV2 11 K ribosomal protein S11 274
158 4DV1 11 K ribosomal protein S11 274
159 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
160 5F8K 42 1k, 2k 30S ribosomal protein S11 274
161 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
162 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
163 4JI5 11 K RIBOSOMAL PROTEIN S11 274
164 4K0K 11 K 30S ribosomal protein S11 274
165 4W2E 44 k 30S ribosomal protein S11 274
166 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
167 5BR8 11 K 30S ribosomal protein S11 274
168 4LF5 11 K ribosomal protein S11 274
169 5J4D 45 TA, YC 30S ribosomal protein S11 274
170 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
171 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
172 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
173 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
174 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
175 4V7Y 11 AK, CK 30S ribosomal protein S11 274
176 4V9C 11 AK, CK 30S ribosomal protein S11 562
177 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
178 5J30 42 QK, XK 30S ribosomal protein S11 274
179 4DR4 11 K 30S ribosomal protein S11 274
180 4WZD 11 2A, 2I 30S ribosomal protein S11 274
181 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
182 4X66 11 K 30S ribosomal protein S11 274
183 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
184 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
185 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
186 4V85 11 AK 30S ribosomal protein S11 562
187 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
188 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
189 4W4G 11 QK, XK 30S ribosomal protein S11 274
190 4NXM 11 K ribosomal protein S11 274
191 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
192 4YPB 11 QK, XK 30S ribosomal protein S11 274
193 4V7X 11 AK, CK 30S ribosomal protein S11 274
194 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
195 4U1U 11 AK, CK 30S ribosomal protein S11 562
196 4ZER 42 1k, 2k 30S ribosomal protein S11 274
197 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
198 4V7W 11 AK, CK 30S ribosomal protein S11 274
199 4WT1 11 2A, 2I 30S ribosomal protein S11 274
200 4WT8 11 AK, BK 30S ribosomal protein S11 274
201 5DOX 42 1k, 2k 30S ribosomal protein S11 274
202 4NXN 11 K ribosomal protein S11 274
203 1XNR 13 K 16S Ribosomal protein S11 274
204 4LT8 11 QK, XK 30S ribosomal protein S11 274
205 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
206 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
207 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
208 4V7L 11 AK, CK 30S ribosomal protein S11 274
209 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
210 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
211 1XNQ 13 K Ribosomal protein S11 274
212 4V8A 41 CK, DK 30S ribosomal protein S11 274
213 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
214 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
215 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
216 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
217 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
218 5J3C 42 QK, XK 30S ribosomal protein S11 274
219 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
220 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
221 4L47 11 QK, XK 30S ribosomal protein S11 274
222 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
223 4ZSN 11 QK, XK 30S ribosomal protein S11 274
224 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
225 4V7Z 11 AK, CK 30S ribosomal protein S11 274
226 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
227 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
228 4V9I 11 AK, CK 30S Ribosomal protein S11 274
229 1XMO 13 K 30S ribosomal protein S11 274
230 3T1H 11 K 30S ribosomal protein S11 274
231 2UXD 11 K RIBOSOMAL PROTEIN S11 274
232 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
233 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
234 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
235 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
236 4V97 11 AK, CK 30S ribosomal protein S11 274
237 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
238 4V7M 11 AK, CK 30S ribosomal protein S11 274
239 4WSM 11 2A, 2I 30S ribosomal protein S11 274
240 4TUD 11 QK, XK 30S ribosomal protein S11 274
241 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
242 4V6A 11 AK, CK 30S ribosomal protein S11 274
243 4TUE 11 QK, XK 30S ribosomal protein S11 274
244 4TUA 11 QK, XK 30S ribosomal protein S11 274
245 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
246 4V84 11 AK, CK 30S ribosomal protein S11 274
247 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
248 4YY3 11 K 30S ribosomal protein S11 274
249 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
250 4V9Q 41 BK, DK 30S ribosomal protein S11 274
251 4TUC 11 QK, XK 30S ribosomal protein S11 274
252 4YHH 11 K 30S ribosomal protein S11 274
253 4TUB 11 QK, XK 30S ribosomal protein S11 274
254 4V9N 14 AK, CK 30S ribosomal protein S11 274
255 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
256 4P70 11 QK, XK 30S ribosomal protein S11 274
257 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
258 4LSK 11 QK, XK 30S ribosomal protein S11 274
259 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
260 4V6D 10 AK, CK 30S ribosomal protein S11 562
261 4P6F 11 QK, XK 30S ribosomal protein S11 274
262 4V67 13 AK, CK 30S ribosomal protein S11 274
263 4V83 11 AK, CK 30S ribosomal protein S11 274
264 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
265 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
266 4V5O 20 AK, BK RPS14E 5911
267 1VVJ 11 QK, XK 30S ribosomal protein S11 274
268 4LFZ 11 QK, XK 30S ribosomal protein S11 274
269 2E5L 12 K 30S ribosomal protein S11 274
270 4V6E 10 AK, CK 30S ribosomal protein S11 562
271 4V52 10 AK, CK 30S ribosomal protein S11 562
272 5CZP 42 QK, XK 30S ribosomal protein S11 274
273 2HHH 11 K 30S ribosomal protein S11 274
274 4V89 11 AK 30S ribosomal protein S11 562
275 4OX9 11 K 30S ribosomal protein S11 274
276 4V54 10 AK, CK 30S ribosomal protein S11 562
277 2UXB 11 K RIBOSOMAL PROTEIN S11 274
278 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
279 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
280 4V9K 10 AK, CK 30S ribosomal protein S11 274
281 4V50 13 AK, CK 30S ribosomal protein S11 562
282 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
283 4V57 10 AK, CK 30S ribosomal protein S11 562
284 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
285 4V63 13 AK, CK 30S ribosomal protein S11 274
286 4L71 11 QK, XK 30S ribosomal protein S11 274
287 4KVB 11 K 30S ribosomal protein S11 274
288 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
289 4V64 10 AK, CK 30S ribosomal protein S11 562
290 4V7P 11 AK, DK 30S ribosomal protein S11 274
291 4V8J 11 AK, CK 30S ribosomal protein S11 274
292 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
293 2ZM6 11 K 30S ribosomal protein S11 274
294 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
295 4V4Q 10 AK, CK 30S ribosomal protein S11 562
296 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
297 5D8B 38 HC, LA 30S ribosomal protein S11 274
298 4LEL 11 QK, XK 30S ribosomal protein S11 274
299 4V53 10 AK, CK 30S ribosomal protein S11 562
300 2F4V 12 K 30S ribosomal protein S11 274
301 4V9L 10 AK, CK 30S ribosomal protein S11 274
302 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
303 4V56 10 AK, CK 30S ribosomal protein S11 562
304 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
305 4V9J 10 AK, CK 30S ribosomal protein S11 274
306 4V55 10 AK, CK 30S ribosomal protein S11 562
307 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
308 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
309 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
310 4V9M 10 AK, CK 30S ribosomal protein S11 274
311 4W29 10 AK, CK 30S ribosomal protein S11 274
312 4V5Y 10 AK, CK 30S ribosomal protein S11 562
313 4V4Y 13 AN 30S ribosomal protein S11 274
314 4V4J 44 l 30S ribosomal protein S11 274
315 4V4X 13 AN 30S ribosomal protein S11 274
316 4V4Z 14 AN 30S ribosomal protein S11 274
317 4V4I 44 l 30S ribosomal protein S11 274
318 4V4P 46 BN 30S ribosomal protein S11 274
319 4V4R 14 AK 30S ribosomal protein S11 274
320 4V4S 14 AK 30S ribosomal protein S11 274
321 4V4T 14 AK 30S ribosomal protein S11 274
322 4KZZ 15 O 40S Ribosomal Protein S14 9986
323 4KZX 15 O 40S ribosomal protein S14 9986
324 4KZY 15 O 40S Ribosomal Protein S14 9986
325 4V49 13 AK 30S ribosomal protein S11 562
326 4V4A 11 AK 30S ribosomal protein S11 562
327 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
328 5NO2 9 K 30S ribosomal protein S11 562
329 5UZ4 10 K 30S ribosomal protein S11 562
330 5MY1 10 K 30S ribosomal protein S11 562
331 5WYJ 45 SP 40S ribosomal protein S14-A 4932
332 5WYK 41 SP 40S ribosomal protein S14-A 4932
333 5U9F 49 K 30S ribosomal protein S11 562
334 5U9G 49 K 30S ribosomal protein S11 562
335 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
336 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
337 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
338 5MGP 42 k 30S ribosomal protein S11 562
339 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
340 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
341 5MDV 48 p 30S ribosomal protein S11 562
342 5MDW 48 p 30S ribosomal protein S11 562
343 5MDY 48 p 30S ribosomal protein S11 562
344 5MDZ 46 p 30S ribosomal protein S11 562
345 5H5U 49 r 30S ribosomal protein S11 562
346 5MC6 27 Z 40S ribosomal protein S14-A 4932
347 5M1J 22 O2 40S ribosomal protein S14-A 4932
348 5LZA 11 k 30S ribosomal protein S11 562
349 5LZB 11 k 30S ribosomal protein S11 562
350 5LZC 11 k 30S ribosomal protein S11 562
351 5LZD 11 k 30S ribosomal protein S11 562
352 5LZE 11 k 30S ribosomal protein S11 562
353 5LZF 11 k 30S ribosomal protein S11 562
354 5TCU 10 S2 30S ribosomal protein S11 1280
355 5T2A 63 AH uS11 5661
356 5T2C 80 AO 40S ribosomal protein S14 9606
357 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
358 5LMO 11 K 30S ribosomal protein S11 274
359 5LMP 11 K 30S ribosomal protein S11 274
360 5LMQ 11 K 30S ribosomal protein S11 274
361 5LMR 11 K 30S ribosomal protein S11 274
362 5LMS 11 K 30S ribosomal protein S11 274
363 5LMT 11 K 30S ribosomal protein S11 274
364 5LMU 11 K 30S ribosomal protein S11 274
365 5LMV 11 K 30S ribosomal protein S11 274
366 5LL6 12 Z 40S ribosomal protein S14-A 4932
367 5LKS 74 SO 40S ribosomal protein S14 9606
368 5LI0 11 k 30S ribosomal protein S11 1280
369 5KPS 42 16 30S ribosomal protein S11 562
370 5KPV 41 15 30S ribosomal protein S11 562
371 5KPW 41 15 30S ribosomal protein S11 562
372 5KPX 41 15 30S ribosomal protein S11 562
373 5KCR 43 1k 30S ribosomal protein S11 562
374 5KCS 45 1k 30S ribosomal protein S11 562
375 5L3P 42 k 30S ribosomal protein S11 562
376 5K0Y 32 j ribosomal protein uS11 9986
377 5JU8 11 AK 30S ribosomal protein S11 562
378 5JUO 64 LB uS11 (yeast S14) 4932
379 5JUP 64 LB uS11 (yeast S14) 4932
380 5JUS 64 LB uS11 (yeast S14) 4932
381 5JUT 64 LB uS11 (yeast S14) 4932
382 5JUU 64 LB uS11 (yeast S14) 4932
383 5JTE 11 AK 30S ribosomal protein S11 562
384 5JPQ 29 w uS11 209285
385 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
386 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
387 5IT7 62 O 40S ribosomal protein S14 28985
388 5IT9 15 O Ribosomal protein uS14 28985
389 5IQR 41 p 30S ribosomal protein S11 562
390 5IMQ 18 O 30S ribosomal protein S11 274
391 5IMR 11 O 30S ribosomal protein S11 274
392 3JCN 42 l 30S ribosomal protein S11 562
393 3JCJ 47 q 30S ribosomal protein S11 562
394 3JCD 10 k 30S ribosomal protein S11 562
395 3JCE 10 k 30S ribosomal protein S11 562
396 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
397 3JBU 10 K 30S ribosomal protein S11 8333
398 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
399 3JBN 26 P 40S ribosomal protein uS11 5833
400 3JBO 32 P 40S ribosomal protein uS11 5833
401 3JBP 26 P 40S ribosomal protein uS11 5833
402 5A9Z 44 BO 30S ribosomal protein S11 274
403 5AA0 44 BO 30S ribosomal protein S11 274
404 3JAP 18 O uS11 28985
405 3JAQ 18 O uS11 28985
406 3JAM 16 O uS11 28985
407 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
408 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
409 3JAG 66 OO uS11 9986
410 3JAH 66 OO uS11 9986
411 3JAI 66 OO uS11 9986
412 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
413 3JA1 11 SK 30S ribosomal protein S11 562
414 3J9Z 5 SK 30S ribosomal protein S11 562
415 3J9Y 7 k 30S ribosomal protein S11 562
416 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
417 3J9W 11 AK 30S ribosomal protein uS11 1423
418 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
419 5AJ0 64 BO 40S ribosomal protein S14 9606
420 5AFI 11 k 30S ribosomal protein S11 562
421 4UER 21 K US11 4934
422 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
423 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
424 4V3P 9 SK 40S ribosomal protein S14 4565
425 3J81 16 O uS11 28985
426 3J80 12 O uS11 28985
427 3J7P 64 SO Ribosomal protein uS11 9823
428 3J7R 65 SO Ribosomal protein uS11 9823
429 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
430 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
431 3J7A 16 P 40S ribosomal protein uS11 5833
432 3J77 60 14 40S ribosomal protein S14 4932
433 3J78 60 14 40S ribosomal protein S14 4932
434 3J6X 61 14 40S ribosomal protein S14 4932
435 3J6Y 61 14 40S ribosomal protein S14 4932
436 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
437 4V92 17 BO US11 28985
438 4V7E 16 BO 40S ribosomal protein S11 4565
439 4V7D 45 BK 30S ribosomal protein S11 562
440 4V7C 11 AK 30S ribosomal protein S11 562
441 4V7B 11 AK 30S ribosomal protein S11 562
442 4V6Y 10 AK 30S ribosomal protein S11 562
443 4V6Z 10 AK 30S ribosomal protein S11 562
444 4V70 10 AK 30S ribosomal protein S11 562
445 4V71 10 AK 30S ribosomal protein S11 562
446 4V72 10 AK 30S ribosomal protein S11 562
447 4V73 10 AK 30S ribosomal protein S11 562
448 4V74 10 AK 30S ribosomal protein S11 562
449 4V75 10 AK 30S ribosomal protein S11 562
450 4V76 10 AK 30S ribosomal protein S11 562
451 4V77 10 AK 30S ribosomal protein S11 562
452 4V78 10 AK 30S ribosomal protein S11 562
453 4V79 10 AK 30S ribosomal protein S11 562
454 4V7A 10 AK 30S ribosomal protein S11 562
455 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
456 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
457 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
458 4V6W 5 AO 40S ribosomal protein S14 7227
459 4V6X 5 AO 40S ribosomal protein S14 9606
460 4V6V 2 AK 30S ribosomal protein S11 562
461 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
462 4V6U 14 AM 30S ribosomal protein S11P 2261
463 4V6T 11 AK 30S ribosomal protein S11 562
464 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
465 4V6S 47 BM 30S ribosomal protein S11 562
466 4V6P 14 AN 30S ribosomal protein S11 562
467 4V6Q 14 AN 30S ribosomal protein S11 562
468 4V6R 14 AN 30S ribosomal protein S11 562
469 4V6N 48 BN 30S ribosomal protein S11 562
470 4V6O 14 AN 30S ribosomal protein S11 562
471 3J0O 12 K Ribosomal protein S14 9986
472 3J0L 12 K Ribosomal protein S14 9986
473 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
474 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
475 4V6M 15 AK 30S ribosomal protein S11 562
476 4V6K 47 BO 30S ribosomal protein S11 562
477 4V6L 14 AO 30S ribosomal protein S11 562
478 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
479 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
480 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
481 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
482 4V7I 46 BK 30S ribosomal protein S11 562
483 4V7H 10 AK 40S ribosomal protein S14(A) 5541
484 3IY8 6 K 30S ribosomal protein S11 562
485 4V68 7 AK 30S ribosomal protein S11 274
486 4V69 2 AK 30S ribosomal protein S11 562
487 4V65 5 AC 30S ribosomal protein S11 562
488 4V66 5 AC 30S ribosomal protein S11 562
489 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
490 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
491 4V4V 12 AK 30S ribosomal subunit protein S11 562
492 4V4W 12 AK 30S ribosomal subunit protein S11 562
493 1X18 7 G 30S ribosomal protein S11 274
494 4V4B 11 AK 40S ribosomal protein S14-A 4932
495 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
496 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
497 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
498 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
499 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
500 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
501 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274