Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 270 38
95 % 57 271 53 Flexibility: Low
Max RMSD: 2.0, Avg RMSD: 1.1
PDBFlex
90 % 57 271 57
70 % 57 271 69
50 % 75 432 26
40 % 75 432 40
30 % 81 545 34
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 272 35
95 % 57 272 49 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 57 272 53
70 % 57 272 65
50 % 69 426 33
40 % 77 557 19
30 % 77 557 33
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 23216
95 % 57 279 39 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 57 279 44
70 % 69 430 18
50 % 69 443 24
40 % 69 443 38
30 % 69 443 57
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 273 33
95 % 57 273 47 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 57 273 51
70 % 57 273 62
50 % 69 430 32
40 % 69 430 45
30 % 75 546 37
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 271 36
95 % 57 271 55 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.9
PDBFlex
90 % 57 271 59
70 % 57 284 54
50 % 57 284 92
40 % 57 284 115
30 % 57 284 124
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 275 30
95 % 59 280 38 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 59 280 43
70 % 59 280 55
50 % 74 439 25
40 % 74 444 37
30 % 74 444 56
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 267 41
95 % 57 272 51
90 % 57 272 55
70 % 57 272 67
50 % 57 282 93
40 % 57 282 116
30 % 69 423 65
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 49 179 61
95 % 57 266 56 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.6
PDBFlex
90 % 57 270 60
70 % 57 270 70
50 % 57 270 97
40 % 57 270 120
30 % 57 270 128
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 50 186 59
95 % 51 237 66 Flexibility: Low
Max RMSD: 3.4, Avg RMSD: 0.8
PDBFlex
90 % 51 237 70
70 % 51 237 84
50 % 51 237 117
40 % 51 237 140
30 % 51 237 145
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 275 29
95 % 58 275 43 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 58 275 48
70 % 58 275 59
50 % 70 432 29
40 % 70 435 41
30 % 70 435 59
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 272 31
95 % 57 273 44 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.5
PDBFlex
90 % 57 273 49
70 % 57 273 60
50 % 69 419 35
40 % 69 424 46
30 % 69 424 63
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 220 53
95 % 57 271 52 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 57 271 56
70 % 57 271 68
50 % 57 271 96
40 % 57 271 119
30 % 57 271 127
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 262 43
95 % 57 262 59 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 57 262 63
70 % 57 262 75
50 % 57 262 102
40 % 57 262 125
30 % 57 262 133
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 51 236 49
95 % 51 236 67 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 51 236 71
70 % 51 236 85
50 % 53 310 86
40 % 53 310 106
30 % 53 310 118
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 265 42
95 % 57 273 45 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 57 273 50
70 % 57 273 61
50 % 69 427 30
40 % 69 432 43
30 % 69 432 60
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 272 34
95 % 57 272 48 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 57 272 52
70 % 57 272 63
50 % 70 427 31
40 % 70 427 44
30 % 70 429 62
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 277 27
95 % 64 283 37 Flexibility: Low
Max RMSD: 2.8, Avg RMSD: 0.8
PDBFlex
90 % 64 283 42
70 % 64 283 52
50 % 64 283 91
40 % 64 283 114
30 % 76 366 94
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 276 28
95 % 58 277 40 Flexibility: Low
Max RMSD: 2.2, Avg RMSD: 0.8
PDBFlex
90 % 58 277 45
70 % 58 277 56
50 % 69 367 66
40 % 69 372 84
30 % 69 372 96
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 58 272 32
95 % 58 272 46 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 58 276 46
70 % 58 276 57
50 % 72 432 28
40 % 73 438 39
30 % 80 562 32
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 53 181 71
95 % 57 272 50 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.8
PDBFlex
90 % 57 272 54
70 % 57 272 66
50 % 69 421 34
40 % 69 421 47
30 % 75 546 35

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 5J7L 11 AK, BK 30S ribosomal protein S11 562
12 5W4K 42 1k, 2k 30S ribosomal protein S11 274
13 4LFB 11 K ribosomal protein S11 274
14 1VY4 11 AK, CK 30S ribosomal protein S11 274
15 4WOI 11 AK, DK 30S ribosomal protein S11 562
16 5FDU 42 1k, 2k 30S ribosomal protein S11 274
17 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
18 5JC9 11 AK, BK 30S ribosomal protein S11 562
19 1VY5 11 AK, CK 30S ribosomal protein S11 274
20 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
21 4WQF 44 BK, DK 30S ribosomal protein S11 274
22 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
23 4WPO 44 BK, DK 30S ribosomal protein S11 274
24 5J8A 11 AK, BK 30S ribosomal protein S11 562
25 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
26 4JI1 11 K RIBOSOMAL PROTEIN S11 274
27 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
28 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
29 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
30 5J5B 11 AK, BK 30S ribosomal protein S11 562
31 5HD1 42 1k, 2k 30S ribosomal protein S11 274
32 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
33 4DR6 11 K 30S ribosomal protein S11 274
34 4LF7 11 K ribosomal protein S11 274
35 4LF8 11 K ribosomal protein S11 274
36 4WSD 11 2A, 2I 30S ribosomal protein S11 274
37 4WQU 44 BK, DK 30S ribosomal protein S11 274
38 5E81 11 2A, 2I 30S ribosomal protein S11 274
39 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
40 4U27 11 AK, CK 30S ribosomal protein S11 562
41 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
42 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
43 5HCR 42 1k, 2k 30S ribosomal protein S11 274
44 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
45 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
46 4DV6 11 K ribosomal protein S11 274
47 4JYA 11 K 30S ribosomal protein S11 274
48 5IBB 11 2A, 2I 30S ribosomal protein S11 274
49 4DR5 11 K 30S ribosomal protein S11 274
50 5J4C 42 1k, 2k 30S ribosomal protein S11 274
51 4KHP 11 K 30S Ribosomal protein S11 274
52 4DR2 11 K 30S ribosomal protein S11 274
53 4WRO 15 2I 30S ribosomal protein S11 274
54 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
55 4LF9 11 K ribosomal protein S11 274
56 4WQY 44 BK, DK 30S ribosomal protein S11 274
57 4DUY 11 K ribosomal protein S11 274
58 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
59 4DV7 11 K ribosomal protein S11 274
60 4WRA 11 2A, 2I 30S ribosomal protein S11 274
61 5IB7 11 2A, 2I 30S ribosomal protein S11 274
62 4U26 11 AK, CK 30S ribosomal protein S11 562
63 4X64 11 K 30S ribosomal protein S11 274
64 5HCP 42 1k, 2k 30S ribosomal protein S11 274
65 5IT8 11 AK, BK 30S ribosomal protein S11 562
66 4V9D 11 AK, BK 30S ribosomal protein S11 562
67 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
68 4V9H 5 AK 30S ribosomal protein S11 274
69 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
70 5J91 11 AK, BK 30S ribosomal protein S11 562
71 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
72 4DR3 11 K 30S ribosomal protein S11 274
73 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
74 4JI3 11 K RIBOSOMAL PROTEIN S11 274
75 4WQR 11 2A, 2I 30S ribosomal protein S11 274
76 4JI6 11 K RIBOSOMAL PROTEIN S11 274
77 4JI8 11 K RIBOSOMAL PROTEIN S11 274
78 2UXC 11 K RIBOSOMAL PROTEIN S11 274
79 5IB8 11 2A, 2I 30S ribosomal protein S11 274
80 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
81 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
82 5EL6 11 2A, 2I 30S ribosomal protein S11 274
83 5EL7 11 2A, 2I 30S ribosomal protein S11 274
84 5VP2 42 1k, 2k 30S ribosomal protein S11 274
85 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
86 4LF4 11 K ribosomal protein S11 274
87 5DFE 45 QK, XK 30S ribosomal protein S11 274
88 5NDK 6 2A, 2I 30S ribosomal protein S11 274
89 4LF6 11 K ribosomal protein S11 274
90 4JI7 11 K RIBOSOMAL PROTEIN S11 274
91 5J88 11 AK, BK 30S ribosomal protein S11 562
92 4U24 11 AK, CK 30S ribosomal protein S11 562
93 4WU1 11 2A, 2I 30S ribosomal protein S11 274
94 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
95 5EL4 11 2A, 2I 30S ribosomal protein S11 274
96 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
97 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
98 4WR6 11 2A, 2I 30S ribosomal protein S11 274
99 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
100 5HAU 44 1k, 2k 30S ribosomal protein S11 274
101 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
102 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
103 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
104 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
105 4WF1 11 AK, CK 30S ribosomal protein S11 562
106 4U25 11 AK, CK 30S ribosomal protein S11 562
107 4V95 11 AK, CK 30S Ribosomal Protein S11 274
108 4WWW 42 QK, XK 30S ribosomal protein S11 562
109 4V7T 11 AK, CK 30S ribosomal protein S11 562
110 1VY7 11 AK, CK 30S ribosomal protein S11 274
111 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
112 5E7K 11 2A, 2I 30S ribosomal protein S11 274
113 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
114 5EL5 11 2A, 2I 30S ribosomal protein S11 274
115 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
116 4LNT 11 QK, XK 30S ribosomal protein S11 274
117 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
118 4DR1 11 K 30S ribosomal protein S11 274
119 4LFA 11 K ribosomal protein S11 274
120 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
121 4DV4 11 K ribosomal protein S11 274
122 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
123 4YZV 11 QK, XK 30S ribosomal protein S11 274
124 4JI0 11 K ribosomal protein S11 274
125 5IWA 10 K 30S ribosomal protein S11 274
126 4V7U 11 AK, CK 30S ribosomal protein S11 562
127 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
128 4JI2 11 K RIBOSOMAL PROTEIN S11 274
129 4V6C 10 AK, CK 30S ribosomal protein S11 562
130 4JV5 11 K 30S ribosomal protein S11 274
131 4DR7 11 K 30S ribosomal protein S11 274
132 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
133 4GKK 11 K 30S ribosomal protein S11 274
134 4DUZ 11 K ribosomal protein S11 274
135 4V7V 11 AK, CK 30S ribosomal protein S11 562
136 4X65 11 K 30S ribosomal protein S11 274
137 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
138 4GKJ 11 K 30S ribosomal protein S11 274
139 4DV3 11 K ribosomal protein S11 274
140 4V7S 11 AK, CK 30S ribosomal protein S11 562
141 4DV5 11 K ribosomal protein S11 274
142 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
143 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
144 4LFC 11 K ribosomal protein S11 274
145 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
146 3T1Y 11 K 30S ribosomal protein S11 274
147 4WZO 11 2A, 2I 30S ribosomal protein S11 274
148 4JI4 11 K RIBOSOMAL PROTEIN S11 274
149 1VY6 11 AK, CK 30S ribosomal protein S11 274
150 1XMQ 13 K 30S Ribosomal Protein S11 274
151 4U20 11 AK, CK 30S ribosomal protein S11 562
152 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
153 4DV0 11 K ribosomal protein S11 274
154 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
155 4U1V 11 AK, CK 30S ribosomal protein S11 562
156 4V6F 41 BN, CN 30S ribosomal protein S11 274
157 4X62 11 K 30S ribosomal protein S11 274
158 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
159 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
160 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
161 4DV2 11 K ribosomal protein S11 274
162 4DV1 11 K ribosomal protein S11 274
163 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
164 5F8K 42 1k, 2k 30S ribosomal protein S11 274
165 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
166 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
167 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
168 4JI5 11 K RIBOSOMAL PROTEIN S11 274
169 4K0K 11 K 30S ribosomal protein S11 274
170 4W2E 44 k 30S ribosomal protein S11 274
171 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
172 5BR8 11 K 30S ribosomal protein S11 274
173 4LF5 11 K ribosomal protein S11 274
174 5J4D 45 TA, YC 30S ribosomal protein S11 274
175 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
176 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
177 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
178 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
179 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
180 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
181 4V7Y 11 AK, CK 30S ribosomal protein S11 274
182 4V9C 11 AK, CK 30S ribosomal protein S11 562
183 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
184 5J30 42 QK, XK 30S ribosomal protein S11 274
185 4DR4 11 K 30S ribosomal protein S11 274
186 4WZD 11 2A, 2I 30S ribosomal protein S11 274
187 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
188 4X66 11 K 30S ribosomal protein S11 274
189 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
190 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
191 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
192 4V85 11 AK 30S ribosomal protein S11 562
193 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
194 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
195 4W4G 11 QK, XK 30S ribosomal protein S11 274
196 4NXM 11 K ribosomal protein S11 274
197 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
198 4YPB 11 QK, XK 30S ribosomal protein S11 274
199 4V7X 11 AK, CK 30S ribosomal protein S11 274
200 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
201 4U1U 11 AK, CK 30S ribosomal protein S11 562
202 4ZER 42 1k, 2k 30S ribosomal protein S11 274
203 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
204 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
205 4V7W 11 AK, CK 30S ribosomal protein S11 274
206 4WT1 11 2A, 2I 30S ribosomal protein S11 274
207 4WT8 11 AK, BK 30S ribosomal protein S11 274
208 5DOX 42 1k, 2k 30S ribosomal protein S11 274
209 4NXN 11 K ribosomal protein S11 274
210 1XNR 13 K 16S Ribosomal protein S11 274
211 4LT8 11 QK, XK 30S ribosomal protein S11 274
212 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
213 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
214 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
215 4V7L 11 AK, CK 30S ribosomal protein S11 274
216 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
217 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
218 1XNQ 13 K Ribosomal protein S11 274
219 4V8A 41 CK, DK 30S ribosomal protein S11 274
220 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
221 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
222 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
223 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
224 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
225 5J3C 42 QK, XK 30S ribosomal protein S11 274
226 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
227 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
228 4L47 11 QK, XK 30S ribosomal protein S11 274
229 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
230 4ZSN 11 QK, XK 30S ribosomal protein S11 274
231 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
232 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
233 4V7Z 11 AK, CK 30S ribosomal protein S11 274
234 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
235 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
236 4V9I 11 AK, CK 30S Ribosomal protein S11 274
237 1XMO 13 K 30S ribosomal protein S11 274
238 3T1H 11 K 30S ribosomal protein S11 274
239 2UXD 11 K RIBOSOMAL PROTEIN S11 274
240 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
241 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
242 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
243 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
244 4V97 11 AK, CK 30S ribosomal protein S11 274
245 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
246 4V7M 11 AK, CK 30S ribosomal protein S11 274
247 4WSM 11 2A, 2I 30S ribosomal protein S11 274
248 4TUD 11 QK, XK 30S ribosomal protein S11 274
249 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
250 4V6A 11 AK, CK 30S ribosomal protein S11 274
251 4TUE 11 QK, XK 30S ribosomal protein S11 274
252 4TUA 11 QK, XK 30S ribosomal protein S11 274
253 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
254 4V84 11 AK, CK 30S ribosomal protein S11 274
255 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
256 4YY3 11 K 30S ribosomal protein S11 274
257 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
258 4V9Q 41 BK, DK 30S ribosomal protein S11 274
259 4TUC 11 QK, XK 30S ribosomal protein S11 274
260 4YHH 11 K 30S ribosomal protein S11 274
261 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
262 4TUB 11 QK, XK 30S ribosomal protein S11 274
263 4V9N 14 AK, CK 30S ribosomal protein S11 274
264 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
265 4P70 11 QK, XK 30S ribosomal protein S11 274
266 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
267 4LSK 11 QK, XK 30S ribosomal protein S11 274
268 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
269 4V6D 10 AK, CK 30S ribosomal protein S11 562
270 4P6F 11 QK, XK 30S ribosomal protein S11 274
271 4V67 13 AK, CK 30S ribosomal protein S11 274
272 4V83 11 AK, CK 30S ribosomal protein S11 274
273 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
274 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
275 4V5O 20 AK, BK RPS14E 5911
276 1VVJ 11 QK, XK 30S ribosomal protein S11 274
277 4LFZ 11 QK, XK 30S ribosomal protein S11 274
278 2E5L 12 K 30S ribosomal protein S11 274
279 4V6E 10 AK, CK 30S ribosomal protein S11 562
280 4V52 10 AK, CK 30S ribosomal protein S11 562
281 5CZP 42 QK, XK 30S ribosomal protein S11 274
282 2HHH 11 K 30S ribosomal protein S11 274
283 4V89 11 AK 30S ribosomal protein S11 562
284 4OX9 11 K 30S ribosomal protein S11 274
285 4V54 10 AK, CK 30S ribosomal protein S11 562
286 2UXB 11 K RIBOSOMAL PROTEIN S11 274
287 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
288 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
289 4V9K 10 AK, CK 30S ribosomal protein S11 274
290 4V50 13 AK, CK 30S ribosomal protein S11 562
291 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
292 4V57 10 AK, CK 30S ribosomal protein S11 562
293 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
294 4V63 13 AK, CK 30S ribosomal protein S11 274
295 4L71 11 QK, XK 30S ribosomal protein S11 274
296 4KVB 11 K 30S ribosomal protein S11 274
297 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
298 4V64 10 AK, CK 30S ribosomal protein S11 562
299 4V7P 11 AK, DK 30S ribosomal protein S11 274
300 4V8J 11 AK, CK 30S ribosomal protein S11 274
301 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
302 2ZM6 11 K 30S ribosomal protein S11 274
303 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
304 4V4Q 10 AK, CK 30S ribosomal protein S11 562
305 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
306 5D8B 38 HC, LA 30S ribosomal protein S11 274
307 4LEL 11 QK, XK 30S ribosomal protein S11 274
308 4V53 10 AK, CK 30S ribosomal protein S11 562
309 2F4V 12 K 30S ribosomal protein S11 274
310 4V9L 10 AK, CK 30S ribosomal protein S11 274
311 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
312 4V56 10 AK, CK 30S ribosomal protein S11 562
313 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
314 4V9J 10 AK, CK 30S ribosomal protein S11 274
315 4V55 10 AK, CK 30S ribosomal protein S11 562
316 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
317 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
318 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
319 4V9M 10 AK, CK 30S ribosomal protein S11 274
320 4W29 10 AK, CK 30S ribosomal protein S11 274
321 4V5Y 10 AK, CK 30S ribosomal protein S11 562
322 4V4Y 13 AN 30S ribosomal protein S11 274
323 4V4J 44 l 30S ribosomal protein S11 274
324 4V4X 13 AN 30S ribosomal protein S11 274
325 4V4Z 14 AN 30S ribosomal protein S11 274
326 4V4I 44 l 30S ribosomal protein S11 274
327 4V4P 46 BN 30S ribosomal protein S11 274
328 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
329 4V4R 14 AK 30S ribosomal protein S11 274
330 4V4S 14 AK 30S ribosomal protein S11 274
331 4V4T 14 AK 30S ribosomal protein S11 274
332 4KZZ 15 O 40S Ribosomal Protein S14 9986
333 4KZX 15 O 40S ribosomal protein S14 9986
334 4KZY 15 O 40S Ribosomal Protein S14 9986
335 4V49 13 AK 30S ribosomal protein S11 562
336 4V4A 11 AK 30S ribosomal protein S11 562
337 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
338 6ENU 11 k 30S ribosomal protein S11 562
339 6ENJ 41 k 30S ribosomal protein S11 562
340 6ENF 11 k 30S ribosomal protein S11 562
341 6EML 22 Z 40S ribosomal protein S14-A 4932
342 6AZ1 15 O ribosomal protein S11 5661
343 6AWB 16 N 30S ribosomal protein S11 562
344 6AWC 16 N 30S ribosomal protein S11 562
345 6AWD 15 N 30S ribosomal protein S11 562
346 5OQL 42 t 40S ribosomal protein S14-like protein 209285
347 5OPT 14 V 40S ribosomal protein S14, putative 5693
348 5WLC 40 NG rpS14_uS11 4932
349 5XYU 10 K 30S ribosomal protein S11 1772
350 5XYI 16 O Ribosomal protein S14 5722
351 5XXU 16 O Ribosomal protein uS11 5811
352 5OA3 19 O 40S ribosomal protein S14 9606
353 5O61 45 BK 30S ribosomal protein S11 1772
354 5O5J 11 K 30S ribosomal protein S11 1772
355 5O2R 45 k 30S ribosomal protein S11 562
356 5NWY 45 A 30S ribosomal protein S11 562
357 5NP6 14 N 30S ribosomal protein S11 562
358 5NO2 9 K 30S ribosomal protein S11 562
359 5NO3 10 K 30S ribosomal protein S11 562
360 5NO4 10 K 30S ribosomal protein S11 562
361 5NJT 11 K 30S ribosomal protein S11 1423
362 5V93 42 k 30S ribosomal protein S11 1773
363 5NGM 11 Ak 30S ribosomal protein S11 1280
364 5NG8 11 Ak, Bk 30S ribosomal protein S11 1280
365 5ND8 11 k 30S ribosomal protein S11 1280
366 5ND9 11 k 30S ribosomal protein S11 1280
367 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
368 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
369 5UYK 41 K 30S ribosomal protein S11 562
370 5UYL 41 K 30S ribosomal protein S11 562
371 5UYM 41 K 30S ribosomal protein S11 562
372 5UYN 41 K 30S ribosomal protein S11 562
373 5UYP 41 K 30S ribosomal protein S11 562
374 5UYQ 41 K 30S ribosomal protein S11 562
375 5UZ4 10 K 30S ribosomal protein S11 562
376 5MYJ 11 AK 30S ribosomal protein S11 1358
377 5MY1 10 K 30S ribosomal protein S11 562
378 5WYJ 45 SP 40S ribosomal protein S14-A 4932
379 5WYK 41 SP 40S ribosomal protein S14-A 4932
380 5U9F 49 K 30S ribosomal protein S11 562
381 5U9G 49 K 30S ribosomal protein S11 562
382 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
383 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
384 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
385 5MGP 42 k 30S ribosomal protein S11 562
386 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
387 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
388 5MDV 48 p 30S ribosomal protein S11 562
389 5MDW 48 p 30S ribosomal protein S11 562
390 5MDY 48 p 30S ribosomal protein S11 562
391 5MDZ 46 p 30S ribosomal protein S11 562
392 5H5U 49 r 30S ribosomal protein S11 562
393 5MC6 27 Z 40S ribosomal protein S14-A 4932
394 5M1J 22 O2 40S ribosomal protein S14-A 4932
395 5LZS 65 OO uS11,Uncharacterized protein 9986
396 5LZT 66 OO uS11 9986
397 5LZU 65 OO uS11 9986
398 5LZV 66 OO uS11 9986
399 5LZW 66 OO uS11 9986
400 5LZX 66 OO uS11 9986
401 5LZY 64 OO uS11 9986
402 5LZZ 66 OO uS11 9986
403 5LZA 11 k 30S ribosomal protein S11 562
404 5LZB 11 k 30S ribosomal protein S11 562
405 5LZC 11 k 30S ribosomal protein S11 562
406 5LZD 11 k 30S ribosomal protein S11 562
407 5LZE 11 k 30S ribosomal protein S11 562
408 5LZF 11 k 30S ribosomal protein S11 562
409 5TCU 10 S2 30S ribosomal protein S11 1280
410 5T7V 3 S2 30S ribosomal protein S11 1280
411 5T2A 63 AH uS11 5661
412 5T2C 80 AO 40S ribosomal protein S14 9606
413 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
414 5LMO 11 K 30S ribosomal protein S11 274
415 5LMP 11 K 30S ribosomal protein S11 274
416 5LMQ 11 K 30S ribosomal protein S11 274
417 5LMR 11 K 30S ribosomal protein S11 274
418 5LMS 11 K 30S ribosomal protein S11 274
419 5LMT 11 K 30S ribosomal protein S11 274
420 5LMU 11 K 30S ribosomal protein S11 274
421 5LMV 11 K 30S ribosomal protein S11 274
422 5LL6 12 Z 40S ribosomal protein S14-A 4932
423 5LKS 74 SO 40S ribosomal protein S14 9606
424 5LI0 11 k 30S ribosomal protein S11 1280
425 5KPS 42 16 30S ribosomal protein S11 562
426 5KPV 41 15 30S ribosomal protein S11 562
427 5KPW 41 15 30S ribosomal protein S11 562
428 5KPX 41 15 30S ribosomal protein S11 562
429 5KCR 43 1k 30S ribosomal protein S11 562
430 5KCS 45 1k 30S ribosomal protein S11 562
431 5L3P 42 k 30S ribosomal protein S11 562
432 5K0Y 32 j ribosomal protein uS11 9986
433 5JU8 11 AK 30S ribosomal protein S11 562
434 5JUO 64 LB uS11 (yeast S14) 4932
435 5JUP 64 LB uS11 (yeast S14) 4932
436 5JUS 64 LB uS11 (yeast S14) 4932
437 5JUT 64 LB uS11 (yeast S14) 4932
438 5JUU 64 LB uS11 (yeast S14) 4932
439 5JTE 11 AK 30S ribosomal protein S11 562
440 5JPQ 29 w uS11 209285
441 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
442 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
443 5IT7 62 O 40S ribosomal protein S14 28985
444 5IT9 15 O Ribosomal protein uS14 28985
445 5IQR 41 p 30S ribosomal protein S11 562
446 5IMQ 18 O 30S ribosomal protein S11 274
447 5IMR 11 O 30S ribosomal protein S11 274
448 3JCN 42 l 30S ribosomal protein S11 562
449 3JCJ 47 q 30S ribosomal protein S11 562
450 3JCD 10 k 30S ribosomal protein S11 562
451 3JCE 10 k 30S ribosomal protein S11 562
452 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
453 3JBU 10 K 30S ribosomal protein S11 8333
454 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
455 3JBN 26 P 40S ribosomal protein uS11 5833
456 3JBO 32 P 40S ribosomal protein uS11 5833
457 3JBP 26 P 40S ribosomal protein uS11 5833
458 5A9Z 44 BO 30S ribosomal protein S11 274
459 5AA0 44 BO 30S ribosomal protein S11 274
460 3JAP 18 O uS11 28985
461 3JAQ 18 O uS11 28985
462 3JAM 16 O uS11 28985
463 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
464 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
465 3JAG 66 OO uS11 9986
466 3JAH 66 OO uS11 9986
467 3JAI 66 OO uS11 9986
468 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
469 3JA1 11 SK 30S ribosomal protein S11 562
470 3J9Z 5 SK 30S ribosomal protein S11 562
471 3J9Y 7 k 30S ribosomal protein S11 562
472 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
473 3J9W 11 AK 30S ribosomal protein uS11 1423
474 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
475 5AJ0 64 BO 40S ribosomal protein S14 9606
476 5AFI 11 k 30S ribosomal protein S11 562
477 4UER 21 K US11 4934
478 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
479 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
480 4V3P 9 SK 40S ribosomal protein S14 4565
481 3J81 16 O uS11 28985
482 3J80 12 O uS11 28985
483 3J7P 64 SO Ribosomal protein uS11 9823
484 3J7R 65 SO Ribosomal protein uS11 9823
485 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
486 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
487 3J7A 16 P 40S ribosomal protein uS11 5833
488 3J77 60 14 40S ribosomal protein S14 4932
489 3J78 60 14 40S ribosomal protein S14 4932
490 3J6X 61 14 40S ribosomal protein S14 4932
491 3J6Y 61 14 40S ribosomal protein S14 4932
492 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
493 4V92 17 BO US11 28985
494 4V7E 16 BO 40S ribosomal protein S11 4565
495 4V7D 45 BK 30S ribosomal protein S11 562
496 4V7C 11 AK 30S ribosomal protein S11 562
497 4V7B 11 AK 30S ribosomal protein S11 562
498 4V6Y 10 AK 30S ribosomal protein S11 562
499 4V6Z 10 AK 30S ribosomal protein S11 562
500 4V70 10 AK 30S ribosomal protein S11 562
501 4V71 10 AK 30S ribosomal protein S11 562
502 4V72 10 AK 30S ribosomal protein S11 562
503 4V73 10 AK 30S ribosomal protein S11 562
504 4V74 10 AK 30S ribosomal protein S11 562
505 4V75 10 AK 30S ribosomal protein S11 562
506 4V76 10 AK 30S ribosomal protein S11 562
507 4V77 10 AK 30S ribosomal protein S11 562
508 4V78 10 AK 30S ribosomal protein S11 562
509 4V79 10 AK 30S ribosomal protein S11 562
510 4V7A 10 AK 30S ribosomal protein S11 562
511 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
512 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
513 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
514 4V6W 5 AO 40S ribosomal protein S14 7227
515 4V6X 5 AO 40S ribosomal protein S14 9606
516 4V6V 2 AK 30S ribosomal protein S11 562
517 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
518 4V6U 14 AM 30S ribosomal protein S11P 2261
519 4V6T 11 AK 30S ribosomal protein S11 562
520 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
521 4V6S 47 BM 30S ribosomal protein S11 562
522 4V6P 14 AN 30S ribosomal protein S11 562
523 4V6Q 14 AN 30S ribosomal protein S11 562
524 4V6R 14 AN 30S ribosomal protein S11 562
525 4V6N 48 BN 30S ribosomal protein S11 562
526 4V6O 14 AN 30S ribosomal protein S11 562
527 3J0O 12 K Ribosomal protein S14 9986
528 3J0L 12 K Ribosomal protein S14 9986
529 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
530 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
531 4V6M 15 AK 30S ribosomal protein S11 562
532 4V6K 47 BO 30S ribosomal protein S11 562
533 4V6L 14 AO 30S ribosomal protein S11 562
534 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
535 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
536 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
537 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
538 4V7I 46 BK 30S ribosomal protein S11 562
539 4V7H 10 AK 40S ribosomal protein S14(A) 5541
540 3IY8 6 K 30S ribosomal protein S11 562
541 4V68 7 AK 30S ribosomal protein S11 274
542 4V69 2 AK 30S ribosomal protein S11 562
543 4V65 5 AC 30S ribosomal protein S11 562
544 4V66 5 AC 30S ribosomal protein S11 562
545 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
546 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
547 4V4V 12 AK 30S ribosomal subunit protein S11 562
548 4V4W 12 AK 30S ribosomal subunit protein S11 562
549 1X18 7 G 30S ribosomal protein S11 274
550 4V4B 11 AK 40S ribosomal protein S14-A 4932
551 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
552 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
553 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
554 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
555 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
556 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
557 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274