Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 282 38
95 % 60 283 51 Flexibility: Low
Max RMSD: 2.0, Avg RMSD: 1.1
PDBFlex
90 % 60 283 56
70 % 60 283 67
50 % 78 446 27
40 % 78 446 40
30 % 84 560 34
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 284 35
95 % 60 284 47 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 60 284 52
70 % 60 284 62
50 % 72 440 34
40 % 80 572 19
30 % 80 572 33
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 23656
95 % 60 291 37 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 60 291 43
70 % 72 444 18
50 % 72 457 24
40 % 72 457 37
30 % 72 457 57
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 285 32
95 % 60 285 44 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 60 285 49
70 % 60 285 59
50 % 72 444 33
40 % 72 444 45
30 % 78 561 36
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 283 36
95 % 60 283 52 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.9
PDBFlex
90 % 60 283 57
70 % 60 296 50
50 % 60 296 90
40 % 60 296 112
30 % 60 296 124
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 287 29
95 % 62 292 36 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 62 292 41
70 % 62 292 51
50 % 77 453 26
40 % 77 458 36
30 % 77 458 55
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 279 39
95 % 60 284 49
90 % 60 284 54
70 % 60 284 64
50 % 60 294 91
40 % 60 294 114
30 % 72 437 64
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 52 187 58
95 % 60 278 53 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.6
PDBFlex
90 % 60 282 58
70 % 60 282 68
50 % 60 282 96
40 % 60 282 119
30 % 60 282 128
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 52 190 61
95 % 53 241 66 Flexibility: Low
Max RMSD: 3.4, Avg RMSD: 0.8
PDBFlex
90 % 53 241 69
70 % 53 241 84
50 % 53 241 114
40 % 53 241 139
30 % 53 241 146
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 61 287 28
95 % 61 287 39 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 61 287 46
70 % 61 287 55
50 % 73 446 29
40 % 73 449 41
30 % 73 449 59
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 284 30
95 % 60 285 41 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.5
PDBFlex
90 % 60 285 47
70 % 60 285 56
50 % 72 433 36
40 % 72 438 46
30 % 72 438 62
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 59 231 50
95 % 60 283 50 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 60 283 55
70 % 60 283 66
50 % 60 283 95
40 % 60 283 118
30 % 60 283 127
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 59 272 43
95 % 59 272 58 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 59 272 63
70 % 59 272 73
50 % 59 272 99
40 % 59 272 124
30 % 59 272 131
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 53 240 46
95 % 53 240 67 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 53 240 70
70 % 53 240 85
50 % 55 315 86
40 % 55 315 104
30 % 55 315 118
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 277 40
95 % 60 285 42 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 60 285 48
70 % 60 285 57
50 % 72 441 30
40 % 72 446 42
30 % 72 446 60
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 284 34
95 % 60 284 46 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 60 284 51
70 % 60 284 61
50 % 73 441 32
40 % 73 441 44
30 % 73 443 61
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 61 289 26
95 % 67 295 35 Flexibility: Low
Max RMSD: 2.8, Avg RMSD: 0.8
PDBFlex
90 % 67 295 39
70 % 67 295 48
50 % 67 295 88
40 % 67 295 110
30 % 79 378 86
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 61 288 27
95 % 61 289 38 Flexibility: Low
Max RMSD: 2.2, Avg RMSD: 0.8
PDBFlex
90 % 61 289 44
70 % 61 289 53
50 % 72 380 64
40 % 72 385 75
30 % 72 385 90
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 61 284 31
95 % 61 284 43 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 61 288 45
70 % 61 288 54
50 % 75 446 28
40 % 76 452 39
30 % 83 577 32
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 191 64
95 % 60 284 48 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.8
PDBFlex
90 % 60 284 53
70 % 60 284 63
50 % 72 435 35
40 % 72 435 47
30 % 78 561 35

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 5J7L 11 AK, BK 30S ribosomal protein S11 562
12 5W4K 42 1k, 2k 30S ribosomal protein S11 274
13 4LFB 11 K ribosomal protein S11 274
14 1VY4 11 AK, CK 30S ribosomal protein S11 274
15 4WOI 11 AK, DK 30S ribosomal protein S11 562
16 5FDU 42 1k, 2k 30S ribosomal protein S11 274
17 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
18 5JC9 11 AK, BK 30S ribosomal protein S11 562
19 1VY5 11 AK, CK 30S ribosomal protein S11 274
20 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
21 4WQF 44 BK, DK 30S ribosomal protein S11 274
22 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
23 4WPO 44 BK, DK 30S ribosomal protein S11 274
24 5J8A 11 AK, BK 30S ribosomal protein S11 562
25 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
26 4JI1 11 K RIBOSOMAL PROTEIN S11 274
27 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
28 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
29 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
30 5J5B 11 AK, BK 30S ribosomal protein S11 562
31 5HD1 42 1k, 2k 30S ribosomal protein S11 274
32 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
33 4DR6 11 K 30S ribosomal protein S11 274
34 4LF7 11 K ribosomal protein S11 274
35 4LF8 11 K ribosomal protein S11 274
36 5WIS 42 1k, 2k 30S ribosomal protein S11 274
37 4WSD 11 2A, 2I 30S ribosomal protein S11 274
38 4WQU 44 BK, DK 30S ribosomal protein S11 274
39 5WIT 42 1k, 2k 30S ribosomal protein S11 274
40 5E81 11 2A, 2I 30S ribosomal protein S11 274
41 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
42 4U27 11 AK, CK 30S ribosomal protein S11 562
43 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
44 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
45 5HCR 42 1k, 2k 30S ribosomal protein S11 274
46 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
47 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
48 4DV6 11 K ribosomal protein S11 274
49 4JYA 11 K 30S ribosomal protein S11 274
50 5IBB 11 2A, 2I 30S ribosomal protein S11 274
51 4DR5 11 K 30S ribosomal protein S11 274
52 5J4C 42 1k, 2k 30S ribosomal protein S11 274
53 4KHP 11 K 30S Ribosomal protein S11 274
54 4DR2 11 K 30S ribosomal protein S11 274
55 4WRO 15 2I 30S ribosomal protein S11 274
56 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
57 4LF9 11 K ribosomal protein S11 274
58 4WQY 44 BK, DK 30S ribosomal protein S11 274
59 4DUY 11 K ribosomal protein S11 274
60 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
61 4DV7 11 K ribosomal protein S11 274
62 4WRA 11 2A, 2I 30S ribosomal protein S11 274
63 5IB7 11 2A, 2I 30S ribosomal protein S11 274
64 4U26 11 AK, CK 30S ribosomal protein S11 562
65 4X64 11 K 30S ribosomal protein S11 274
66 5HCP 42 1k, 2k 30S ribosomal protein S11 274
67 5IT8 11 AK, BK 30S ribosomal protein S11 562
68 4V9D 11 AK, BK 30S ribosomal protein S11 562
69 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
70 4V9H 5 AK 30S ribosomal protein S11 274
71 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
72 5J91 11 AK, BK 30S ribosomal protein S11 562
73 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
74 5WNT 11 K 30S ribosomal protein S12 274
75 4DR3 11 K 30S ribosomal protein S11 274
76 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
77 4JI3 11 K RIBOSOMAL PROTEIN S11 274
78 4WQR 11 2A, 2I 30S ribosomal protein S11 274
79 4JI6 11 K RIBOSOMAL PROTEIN S11 274
80 4JI8 11 K RIBOSOMAL PROTEIN S11 274
81 2UXC 11 K RIBOSOMAL PROTEIN S11 274
82 5IB8 11 2A, 2I 30S ribosomal protein S11 274
83 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
84 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
85 5EL6 11 2A, 2I 30S ribosomal protein S11 274
86 5EL7 11 2A, 2I 30S ribosomal protein S11 274
87 5VP2 42 1k, 2k 30S ribosomal protein S11 274
88 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
89 4LF4 11 K ribosomal protein S11 274
90 5DFE 45 QK, XK 30S ribosomal protein S11 274
91 5NDK 6 2A, 2I 30S ribosomal protein S11 274
92 4LF6 11 K ribosomal protein S11 274
93 4JI7 11 K RIBOSOMAL PROTEIN S11 274
94 5J88 11 AK, BK 30S ribosomal protein S11 562
95 4U24 11 AK, CK 30S ribosomal protein S11 562
96 4WU1 11 2A, 2I 30S ribosomal protein S11 274
97 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
98 5EL4 11 2A, 2I 30S ribosomal protein S11 274
99 5WNV 11 K 30S ribosomal protein S11 274
100 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
101 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
102 4WR6 11 2A, 2I 30S ribosomal protein S11 274
103 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
104 5HAU 44 1k, 2k 30S ribosomal protein S11 274
105 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
106 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
107 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
108 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
109 4WF1 11 AK, CK 30S ribosomal protein S11 562
110 4U25 11 AK, CK 30S ribosomal protein S11 562
111 4V95 11 AK, CK 30S Ribosomal Protein S11 274
112 4WWW 42 QK, XK 30S ribosomal protein S11 562
113 4V7T 11 AK, CK 30S ribosomal protein S11 562
114 1VY7 11 AK, CK 30S ribosomal protein S11 274
115 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
116 5E7K 11 2A, 2I 30S ribosomal protein S11 274
117 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
118 5EL5 11 2A, 2I 30S ribosomal protein S11 274
119 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
120 4LNT 11 QK, XK 30S ribosomal protein S11 274
121 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
122 4DR1 11 K 30S ribosomal protein S11 274
123 4LFA 11 K ribosomal protein S11 274
124 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
125 4DV4 11 K ribosomal protein S11 274
126 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
127 4YZV 11 QK, XK 30S ribosomal protein S11 274
128 4JI0 11 K ribosomal protein S11 274
129 5IWA 10 K 30S ribosomal protein S11 274
130 4V7U 11 AK, CK 30S ribosomal protein S11 562
131 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
132 4JI2 11 K RIBOSOMAL PROTEIN S11 274
133 4V6C 10 AK, CK 30S ribosomal protein S11 562
134 4JV5 11 K 30S ribosomal protein S11 274
135 4DR7 11 K 30S ribosomal protein S11 274
136 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
137 4GKK 11 K 30S ribosomal protein S11 274
138 4DUZ 11 K ribosomal protein S11 274
139 4V7V 11 AK, CK 30S ribosomal protein S11 562
140 4X65 11 K 30S ribosomal protein S11 274
141 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
142 4GKJ 11 K 30S ribosomal protein S11 274
143 4DV3 11 K ribosomal protein S11 274
144 4V7S 11 AK, CK 30S ribosomal protein S11 562
145 4DV5 11 K ribosomal protein S11 274
146 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
147 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
148 4LFC 11 K ribosomal protein S11 274
149 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
150 3T1Y 11 K 30S ribosomal protein S11 274
151 4WZO 11 2A, 2I 30S ribosomal protein S11 274
152 4JI4 11 K RIBOSOMAL PROTEIN S11 274
153 1VY6 11 AK, CK 30S ribosomal protein S11 274
154 1XMQ 13 K 30S Ribosomal Protein S11 274
155 5WNP 11 K 30S ribosomal protein S12 274
156 4U20 11 AK, CK 30S ribosomal protein S11 562
157 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
158 4DV0 11 K ribosomal protein S11 274
159 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
160 4U1V 11 AK, CK 30S ribosomal protein S11 562
161 4V6F 41 BN, CN 30S ribosomal protein S11 274
162 4X62 11 K 30S ribosomal protein S11 274
163 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
164 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
165 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
166 4DV2 11 K ribosomal protein S11 274
167 4DV1 11 K ribosomal protein S11 274
168 5WNU 11 K 30S ribosomal protein S12 274
169 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
170 5F8K 42 1k, 2k 30S ribosomal protein S11 274
171 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
172 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
173 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
174 4JI5 11 K RIBOSOMAL PROTEIN S11 274
175 4K0K 11 K 30S ribosomal protein S11 274
176 4W2E 44 k 30S ribosomal protein S11 274
177 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
178 5BR8 11 K 30S ribosomal protein S11 274
179 4LF5 11 K ribosomal protein S11 274
180 5J4D 45 TA, YC 30S ribosomal protein S11 274
181 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
182 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
183 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
184 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
185 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
186 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
187 4V7Y 11 AK, CK 30S ribosomal protein S11 274
188 4V9C 11 AK, CK 30S ribosomal protein S11 562
189 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
190 5J30 42 QK, XK 30S ribosomal protein S11 274
191 4DR4 11 K 30S ribosomal protein S11 274
192 4WZD 11 2A, 2I 30S ribosomal protein S11 274
193 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
194 4X66 11 K 30S ribosomal protein S11 274
195 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
196 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
197 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
198 4V85 11 AK 30S ribosomal protein S11 562
199 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
200 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
201 4W4G 11 QK, XK 30S ribosomal protein S11 274
202 4NXM 11 K ribosomal protein S11 274
203 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
204 4YPB 11 QK, XK 30S ribosomal protein S11 274
205 4V7X 11 AK, CK 30S ribosomal protein S11 274
206 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
207 4U1U 11 AK, CK 30S ribosomal protein S11 562
208 4ZER 42 1k, 2k 30S ribosomal protein S11 274
209 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
210 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
211 4V7W 11 AK, CK 30S ribosomal protein S11 274
212 4WT1 11 2A, 2I 30S ribosomal protein S11 274
213 6C5L 11 AK, CK 30S ribosomal protein S11 274
214 4WT8 11 AK, BK 30S ribosomal protein S11 274
215 5DOX 42 1k, 2k 30S ribosomal protein S11 274
216 4NXN 11 K ribosomal protein S11 274
217 1XNR 13 K 16S Ribosomal protein S11 274
218 4LT8 11 QK, XK 30S ribosomal protein S11 274
219 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
220 5WNQ 11 K 30S ribosomal protein S11 274
221 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
222 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
223 4V7L 11 AK, CK 30S ribosomal protein S11 274
224 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
225 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
226 1XNQ 13 K Ribosomal protein S11 274
227 4V8A 41 CK, DK 30S ribosomal protein S11 274
228 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
229 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
230 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
231 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
232 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
233 5J3C 42 QK, XK 30S ribosomal protein S11 274
234 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
235 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
236 4L47 11 QK, XK 30S ribosomal protein S11 274
237 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
238 4ZSN 11 QK, XK 30S ribosomal protein S11 274
239 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
240 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
241 4V7Z 11 AK, CK 30S ribosomal protein S11 274
242 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
243 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
244 4V9I 11 AK, CK 30S Ribosomal protein S11 274
245 1XMO 13 K 30S ribosomal protein S11 274
246 3T1H 11 K 30S ribosomal protein S11 274
247 2UXD 11 K RIBOSOMAL PROTEIN S11 274
248 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
249 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
250 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
251 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
252 4V97 11 AK, CK 30S ribosomal protein S11 274
253 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
254 4V7M 11 AK, CK 30S ribosomal protein S11 274
255 4WSM 11 2A, 2I 30S ribosomal protein S11 274
256 4TUD 11 QK, XK 30S ribosomal protein S11 274
257 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
258 5WNR 11 K 30S ribosomal protein S11 274
259 4V6A 11 AK, CK 30S ribosomal protein S11 274
260 4TUE 11 QK, XK 30S ribosomal protein S11 274
261 4TUA 11 QK, XK 30S ribosomal protein S11 274
262 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
263 4V84 11 AK, CK 30S ribosomal protein S11 274
264 5WNS 11 K 30S ribosomal protein S11 274
265 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
266 4YY3 11 K 30S ribosomal protein S11 274
267 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
268 4V9Q 41 BK, DK 30S ribosomal protein S11 274
269 4TUC 11 QK, XK 30S ribosomal protein S11 274
270 4YHH 11 K 30S ribosomal protein S11 274
271 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
272 4TUB 11 QK, XK 30S ribosomal protein S11 274
273 4V9N 14 AK, CK 30S ribosomal protein S11 274
274 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
275 4P70 11 QK, XK 30S ribosomal protein S11 274
276 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
277 4LSK 11 QK, XK 30S ribosomal protein S11 274
278 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
279 4V6D 10 AK, CK 30S ribosomal protein S11 562
280 4P6F 11 QK, XK 30S ribosomal protein S11 274
281 4V67 13 AK, CK 30S ribosomal protein S11 274
282 4V83 11 AK, CK 30S ribosomal protein S11 274
283 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
284 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
285 4V5O 20 AK, BK RPS14E 5911
286 1VVJ 11 QK, XK 30S ribosomal protein S11 274
287 4LFZ 11 QK, XK 30S ribosomal protein S11 274
288 2E5L 12 K 30S ribosomal protein S11 274
289 4V6E 10 AK, CK 30S ribosomal protein S11 562
290 4V52 10 AK, CK 30S ribosomal protein S11 562
291 5CZP 42 QK, XK 30S ribosomal protein S11 274
292 2HHH 11 K 30S ribosomal protein S11 274
293 4V89 11 AK 30S ribosomal protein S11 562
294 4OX9 11 K 30S ribosomal protein S11 274
295 4V54 10 AK, CK 30S ribosomal protein S11 562
296 2UXB 11 K RIBOSOMAL PROTEIN S11 274
297 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
298 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
299 4V9K 10 AK, CK 30S ribosomal protein S11 274
300 4V50 13 AK, CK 30S ribosomal protein S11 562
301 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
302 4V57 10 AK, CK 30S ribosomal protein S11 562
303 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
304 4V63 13 AK, CK 30S ribosomal protein S11 274
305 4L71 11 QK, XK 30S ribosomal protein S11 274
306 4KVB 11 K 30S ribosomal protein S11 274
307 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
308 4V64 10 AK, CK 30S ribosomal protein S11 562
309 4V7P 11 AK, DK 30S ribosomal protein S11 274
310 4V8J 11 AK, CK 30S ribosomal protein S11 274
311 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
312 2ZM6 11 K 30S ribosomal protein S11 274
313 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
314 4V4Q 10 AK, CK 30S ribosomal protein S11 562
315 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
316 5D8B 38 HC, LA 30S ribosomal protein S11 274
317 4LEL 11 QK, XK 30S ribosomal protein S11 274
318 4V53 10 AK, CK 30S ribosomal protein S11 562
319 2F4V 12 K 30S ribosomal protein S11 274
320 4V9L 10 AK, CK 30S ribosomal protein S11 274
321 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
322 4V56 10 AK, CK 30S ribosomal protein S11 562
323 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
324 4V9J 10 AK, CK 30S ribosomal protein S11 274
325 4V55 10 AK, CK 30S ribosomal protein S11 562
326 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
327 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
328 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
329 4V9M 10 AK, CK 30S ribosomal protein S11 274
330 4W29 10 AK, CK 30S ribosomal protein S11 274
331 4V5Y 10 AK, CK 30S ribosomal protein S11 562
332 4V4Y 13 AN 30S ribosomal protein S11 274
333 4V4J 44 l 30S ribosomal protein S11 274
334 4V4X 13 AN 30S ribosomal protein S11 274
335 4V4Z 14 AN 30S ribosomal protein S11 274
336 4V4I 44 l 30S ribosomal protein S11 274
337 4V4P 46 BN 30S ribosomal protein S11 274
338 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
339 4V4R 14 AK 30S ribosomal protein S11 274
340 4V4S 14 AK 30S ribosomal protein S11 274
341 4V4T 14 AK 30S ribosomal protein S11 274
342 4KZZ 15 O 40S Ribosomal Protein S14 9986
343 4KZX 15 O 40S ribosomal protein S14 9986
344 4KZY 15 O 40S Ribosomal Protein S14 9986
345 4V49 13 AK 30S ribosomal protein S11 562
346 4V4A 11 AK 30S ribosomal protein S11 562
347 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
348 6C4I 44 k 30S ribosomal protein S11 562
349 6BU8 41 K 30S ribosomal protein S11 562
350 6ENU 11 k 30S ribosomal protein S11 562
351 6ENJ 41 k 30S ribosomal protein S11 562
352 6ENF 11 k 30S ribosomal protein S11 562
353 6EML 22 Z 40S ribosomal protein S14-A 4932
354 6B4V 45 TA, XC 30S ribosomal protein S11 274
355 6EK0 75 SO 40S ribosomal protein S14 9606
356 6AZ1 15 O ribosomal protein S11 5661
357 6AWB 16 N 30S ribosomal protein S11 562
358 6AWC 16 N 30S ribosomal protein S11 562
359 6AWD 15 N 30S ribosomal protein S11 562
360 5OT7 17 J 30S ribosomal protein S11 274
361 5OQL 42 t 40S ribosomal protein S14-like protein 209285
362 5OPT 14 V 40S ribosomal protein S14, putative 5693
363 5WLC 40 NG rpS14_uS11 4932
364 5XYU 10 K 30S ribosomal protein S11 1772
365 5XYI 16 O Ribosomal protein S14 5722
366 5XXU 16 O Ribosomal protein uS11 5811
367 5OA3 19 O 40S ribosomal protein S14 9606
368 5O61 45 BK 30S ribosomal protein S11 1772
369 5O5J 11 K 30S ribosomal protein S11 1772
370 5O2R 45 k 30S ribosomal protein S11 562
371 5NWY 45 A 30S ribosomal protein S11 562
372 5NP6 14 N 30S ribosomal protein S11 562
373 5NO2 9 K 30S ribosomal protein S11 562
374 5NO3 10 K 30S ribosomal protein S11 562
375 5NO4 10 K 30S ribosomal protein S11 562
376 5NJT 11 K 30S ribosomal protein S11 1423
377 5V93 42 k 30S ribosomal protein S11 1773
378 5NGM 11 Ak 30S ribosomal protein S11 1280
379 5NG8 11 Ak, Bk 30S ribosomal protein S11 1280
380 5ND8 11 k 30S ribosomal protein S11 1280
381 5ND9 11 k 30S ribosomal protein S11 1280
382 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
383 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
384 5UYK 41 K 30S ribosomal protein S11 562
385 5UYL 41 K 30S ribosomal protein S11 562
386 5UYM 41 K 30S ribosomal protein S11 562
387 5UYN 41 K 30S ribosomal protein S11 562
388 5UYP 41 K 30S ribosomal protein S11 562
389 5UYQ 41 K 30S ribosomal protein S11 562
390 5UZ4 10 K 30S ribosomal protein S11 562
391 5MYJ 11 AK 30S ribosomal protein S11 1358
392 5MY1 10 K 30S ribosomal protein S11 562
393 5WYJ 45 SP 40S ribosomal protein S14-A 4932
394 5WYK 41 SP 40S ribosomal protein S14-A 4932
395 5U9F 49 K 30S ribosomal protein S11 562
396 5U9G 49 K 30S ribosomal protein S11 562
397 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
398 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
399 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
400 5MGP 42 k 30S ribosomal protein S11 562
401 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
402 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
403 5MDV 48 p 30S ribosomal protein S11 562
404 5MDW 48 p 30S ribosomal protein S11 562
405 5MDY 48 p 30S ribosomal protein S11 562
406 5MDZ 46 p 30S ribosomal protein S11 562
407 5H5U 49 r 30S ribosomal protein S11 562
408 5MC6 27 Z 40S ribosomal protein S14-A 4932
409 5M1J 22 O2 40S ribosomal protein S14-A 4932
410 5LZS 65 OO uS11,Uncharacterized protein 9986
411 5LZT 66 OO uS11 9986
412 5LZU 65 OO uS11 9986
413 5LZV 66 OO uS11 9986
414 5LZW 66 OO uS11 9986
415 5LZX 66 OO uS11 9986
416 5LZY 64 OO uS11 9986
417 5LZZ 66 OO uS11 9986
418 5LZA 11 k 30S ribosomal protein S11 562
419 5LZB 11 k 30S ribosomal protein S11 562
420 5LZC 11 k 30S ribosomal protein S11 562
421 5LZD 11 k 30S ribosomal protein S11 562
422 5LZE 11 k 30S ribosomal protein S11 562
423 5LZF 11 k 30S ribosomal protein S11 562
424 5TCU 10 S2 30S ribosomal protein S11 1280
425 5T7V 3 S2 30S ribosomal protein S11 1280
426 5T2A 63 AH uS11 5661
427 5T2C 80 AO 40S ribosomal protein S14 9606
428 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
429 5LMO 11 K 30S ribosomal protein S11 274
430 5LMP 11 K 30S ribosomal protein S11 274
431 5LMQ 11 K 30S ribosomal protein S11 274
432 5LMR 11 K 30S ribosomal protein S11 274
433 5LMS 11 K 30S ribosomal protein S11 274
434 5LMT 11 K 30S ribosomal protein S11 274
435 5LMU 11 K 30S ribosomal protein S11 274
436 5LMV 11 K 30S ribosomal protein S11 274
437 5LL6 12 Z 40S ribosomal protein S14-A 4932
438 5LKS 74 SO 40S ribosomal protein S14 9606
439 5LI0 11 k 30S ribosomal protein S11 1280
440 5KPS 42 16 30S ribosomal protein S11 562
441 5KPV 41 15 30S ribosomal protein S11 562
442 5KPW 41 15 30S ribosomal protein S11 562
443 5KPX 41 15 30S ribosomal protein S11 562
444 5KCR 43 1k 30S ribosomal protein S11 562
445 5KCS 45 1k 30S ribosomal protein S11 562
446 5L3P 42 k 30S ribosomal protein S11 562
447 5K0Y 32 j ribosomal protein uS11 9986
448 5JU8 11 AK 30S ribosomal protein S11 562
449 5JUO 64 LB uS11 (yeast S14) 4932
450 5JUP 64 LB uS11 (yeast S14) 4932
451 5JUS 64 LB uS11 (yeast S14) 4932
452 5JUT 64 LB uS11 (yeast S14) 4932
453 5JUU 64 LB uS11 (yeast S14) 4932
454 5JTE 11 AK 30S ribosomal protein S11 562
455 5JPQ 29 w uS11 209285
456 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
457 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
458 5IT7 62 O 40S ribosomal protein S14 28985
459 5IT9 15 O Ribosomal protein uS14 28985
460 5IQR 41 p 30S ribosomal protein S11 562
461 5IMQ 18 O 30S ribosomal protein S11 274
462 5IMR 11 O 30S ribosomal protein S11 274
463 3JCN 42 l 30S ribosomal protein S11 562
464 3JCJ 47 q 30S ribosomal protein S11 562
465 3JCD 10 k 30S ribosomal protein S11 562
466 3JCE 10 k 30S ribosomal protein S11 562
467 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
468 3JBU 10 K 30S ribosomal protein S11 8333
469 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
470 3JBN 26 P 40S ribosomal protein uS11 5833
471 3JBO 32 P 40S ribosomal protein uS11 5833
472 3JBP 26 P 40S ribosomal protein uS11 5833
473 5A9Z 44 BO 30S ribosomal protein S11 274
474 5AA0 44 BO 30S ribosomal protein S11 274
475 3JAP 18 O uS11 28985
476 3JAQ 18 O uS11 28985
477 3JAM 16 O uS11 28985
478 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
479 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
480 3JAG 66 OO uS11 9986
481 3JAH 66 OO uS11 9986
482 3JAI 66 OO uS11 9986
483 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
484 3JA1 11 SK 30S ribosomal protein S11 562
485 3J9Z 5 SK 30S ribosomal protein S11 562
486 3J9Y 7 k 30S ribosomal protein S11 562
487 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
488 3J9W 11 AK 30S ribosomal protein uS11 1423
489 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
490 5AJ0 64 BO 40S ribosomal protein S14 9606
491 5AFI 11 k 30S ribosomal protein S11 562
492 4UER 21 K US11 4934
493 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
494 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
495 4V3P 9 SK 40S ribosomal protein S14 4565
496 3J81 16 O uS11 28985
497 3J80 12 O uS11 28985
498 3J7P 64 SO Ribosomal protein uS11 9823
499 3J7R 65 SO Ribosomal protein uS11 9823
500 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
501 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
502 3J7A 16 P 40S ribosomal protein uS11 5833
503 3J77 60 14 40S ribosomal protein S14 4932
504 3J78 60 14 40S ribosomal protein S14 4932
505 3J6X 61 14 40S ribosomal protein S14 4932
506 3J6Y 61 14 40S ribosomal protein S14 4932
507 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
508 4V92 17 BO US11 28985
509 4V7E 16 BO 40S ribosomal protein S11 4565
510 4V7D 45 BK 30S ribosomal protein S11 562
511 4V7C 11 AK 30S ribosomal protein S11 562
512 4V7B 11 AK 30S ribosomal protein S11 562
513 4V6Y 10 AK 30S ribosomal protein S11 562
514 4V6Z 10 AK 30S ribosomal protein S11 562
515 4V70 10 AK 30S ribosomal protein S11 562
516 4V71 10 AK 30S ribosomal protein S11 562
517 4V72 10 AK 30S ribosomal protein S11 562
518 4V73 10 AK 30S ribosomal protein S11 562
519 4V74 10 AK 30S ribosomal protein S11 562
520 4V75 10 AK 30S ribosomal protein S11 562
521 4V76 10 AK 30S ribosomal protein S11 562
522 4V77 10 AK 30S ribosomal protein S11 562
523 4V78 10 AK 30S ribosomal protein S11 562
524 4V79 10 AK 30S ribosomal protein S11 562
525 4V7A 10 AK 30S ribosomal protein S11 562
526 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
527 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
528 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
529 4V6W 5 AO 40S ribosomal protein S14 7227
530 4V6X 5 AO 40S ribosomal protein S14 9606
531 4V6V 2 AK 30S ribosomal protein S11 562
532 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
533 4V6U 14 AM 30S ribosomal protein S11P 2261
534 4V6T 11 AK 30S ribosomal protein S11 562
535 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
536 4V6S 47 BM 30S ribosomal protein S11 562
537 4V6P 14 AN 30S ribosomal protein S11 562
538 4V6Q 14 AN 30S ribosomal protein S11 562
539 4V6R 14 AN 30S ribosomal protein S11 562
540 4V6N 48 BN 30S ribosomal protein S11 562
541 4V6O 14 AN 30S ribosomal protein S11 562
542 3J0O 12 K Ribosomal protein S14 9986
543 3J0L 12 K Ribosomal protein S14 9986
544 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
545 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
546 4V6M 15 AK 30S ribosomal protein S11 562
547 4V6K 47 BO 30S ribosomal protein S11 562
548 4V6L 14 AO 30S ribosomal protein S11 562
549 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
550 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
551 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
552 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
553 4V7I 46 BK 30S ribosomal protein S11 562
554 4V7H 10 AK 40S ribosomal protein S14(A) 5541
555 3IY8 6 K 30S ribosomal protein S11 562
556 4V68 7 AK 30S ribosomal protein S11 274
557 4V69 2 AK 30S ribosomal protein S11 562
558 4V65 5 AC 30S ribosomal protein S11 562
559 4V66 5 AC 30S ribosomal protein S11 562
560 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
561 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
562 4V4V 12 AK 30S ribosomal subunit protein S11 562
563 4V4W 12 AK 30S ribosomal subunit protein S11 562
564 1X18 7 G 30S ribosomal protein S11 274
565 4V4B 11 AK 40S ribosomal protein S14-A 4932
566 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
567 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
568 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
569 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
570 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
571 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
572 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274