Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 252 35
95 % 56 253 47
90 % 56 253 52
70 % 56 253 62
50 % 68 348 28
40 % 68 348 38
30 % 73 418 37
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 254 33
95 % 56 254 43
90 % 56 254 48
70 % 56 254 57
50 % 62 342 36
40 % 69 419 22
30 % 69 420 35
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 20045
95 % 56 261 35
90 % 56 261 39
70 % 62 353 23
50 % 62 354 27
40 % 62 354 37
30 % 62 354 56
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 255 30
95 % 56 255 41
90 % 56 255 46
70 % 56 255 55
50 % 62 347 33
40 % 62 347 45
30 % 67 419 42
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 253 34
95 % 56 253 48
90 % 56 253 53
70 % 56 254 60
50 % 56 254 86
40 % 56 254 106
30 % 56 254 118
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 257 27
95 % 58 262 33
90 % 58 262 37
70 % 58 262 48
50 % 67 355 26
40 % 67 356 36
30 % 67 356 55
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 249 36
95 % 56 254 45
90 % 56 254 50
70 % 56 254 59
50 % 56 254 85
40 % 56 255 105
30 % 62 345 62
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 161 56
95 % 56 248 50
90 % 56 252 54
70 % 56 252 63
50 % 56 252 88
40 % 56 252 108
30 % 56 252 120
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 49 168 55
95 % 50 219 62
90 % 50 219 66
70 % 50 219 77
50 % 50 219 107
40 % 50 219 128
30 % 50 219 142
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 257 26
95 % 57 257 37
90 % 57 257 43
70 % 57 257 52
50 % 63 345 31
40 % 63 345 42
30 % 63 345 59
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 254 28
95 % 56 255 38
90 % 56 255 44
70 % 56 255 53
50 % 62 341 35
40 % 62 342 46
30 % 62 342 61
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 55 202 47
95 % 56 253 46
90 % 56 253 51
70 % 56 253 61
50 % 56 253 87
40 % 56 253 107
30 % 56 253 119
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 244 38
95 % 56 244 54
90 % 56 244 57
70 % 56 244 67
50 % 56 244 91
40 % 56 244 113
30 % 56 244 126
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 218 43
95 % 50 218 63
90 % 50 218 67
70 % 50 218 78
50 % 52 269 77
40 % 52 269 97
30 % 52 269 112
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 247 37
95 % 56 255 39
90 % 56 255 45
70 % 56 255 54
50 % 62 342 34
40 % 62 343 44
30 % 62 343 60
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 254 32
95 % 56 254 42
90 % 56 254 47
70 % 56 254 56
50 % 63 346 30
40 % 63 346 41
30 % 63 348 57
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 259 24
95 % 63 265 21
90 % 63 265 24
70 % 63 265 32
50 % 63 265 79
40 % 63 265 100
30 % 69 304 78
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 258 25
95 % 57 259 36
90 % 57 259 41
70 % 57 259 50
50 % 62 304 51
40 % 62 305 63
30 % 62 305 86
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 254 29
95 % 57 254 40
90 % 57 258 42
70 % 57 258 51
50 % 65 348 29
40 % 66 350 39
30 % 72 423 33
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 163 72
95 % 56 254 44
90 % 56 254 49
70 % 56 254 58
50 % 62 342 37
40 % 62 342 47
30 % 67 414 44

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 4LFB 11 K ribosomal protein S11 274
12 1VY4 11 AK, CK 30S ribosomal protein S11 274
13 4WOI 11 AK, DK 30S ribosomal protein S11 562
14 5FDU 42 1k, 2k 30S ribosomal protein S11 274
15 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
16 1VY5 11 AK, CK 30S ribosomal protein S11 274
17 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
18 4WQF 44 BK, DK 30S ribosomal protein S11 274
19 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
20 4WPO 44 BK, DK 30S ribosomal protein S11 274
21 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
22 4JI1 11 K RIBOSOMAL PROTEIN S11 274
23 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
24 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
25 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
26 5HD1 42 1k, 2k 30S ribosomal protein S11 274
27 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
28 4DR6 11 K 30S ribosomal protein S11 274
29 4LF7 11 K ribosomal protein S11 274
30 4LF8 11 K ribosomal protein S11 274
31 4WSD 11 2A, 2I 30S ribosomal protein S11 274
32 4WQU 44 BK, DK 30S ribosomal protein S11 274
33 5E81 11 2A, 2I 30S ribosomal protein S11 274
34 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
35 4U27 11 AK, CK 30S ribosomal protein S11 562
36 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
37 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
38 5HCR 42 1k, 2k 30S ribosomal protein S11 274
39 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
40 4DV6 11 K ribosomal protein S11 274
41 4JYA 11 K 30S ribosomal protein S11 274
42 5IBB 11 2A, 2I 30S ribosomal protein S11 274
43 4DR5 11 K 30S ribosomal protein S11 274
44 5J4C 42 1k, 2k 30S ribosomal protein S11 274
45 4KHP 11 K 30S Ribosomal protein S11 274
46 4DR2 11 K 30S ribosomal protein S11 274
47 4WRO 15 2I 30S ribosomal protein S11 274
48 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
49 4LF9 11 K ribosomal protein S11 274
50 4WQY 44 BK, DK 30S ribosomal protein S11 274
51 4DUY 11 K ribosomal protein S11 274
52 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
53 4DV7 11 K ribosomal protein S11 274
54 4WRA 11 2A, 2I 30S ribosomal protein S11 274
55 5IB7 11 2A, 2I 30S ribosomal protein S11 274
56 4U26 11 AK, CK 30S ribosomal protein S11 562
57 4X64 11 K 30S ribosomal protein S11 274
58 5HCP 42 1k, 2k 30S ribosomal protein S11 274
59 4V9D 11 AK, BK 30S ribosomal protein S11 562
60 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
61 4V9H 5 AK 30S ribosomal protein S11 274
62 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
63 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
64 4DR3 11 K 30S ribosomal protein S11 274
65 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
66 4JI3 11 K RIBOSOMAL PROTEIN S11 274
67 4WQR 11 2A, 2I 30S ribosomal protein S11 274
68 4JI6 11 K RIBOSOMAL PROTEIN S11 274
69 4JI8 11 K RIBOSOMAL PROTEIN S11 274
70 2UXC 11 K RIBOSOMAL PROTEIN S11 274
71 5IB8 11 2A, 2I 30S ribosomal protein S11 274
72 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
73 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
74 5EL6 11 2A, 2I 30S ribosomal protein S11 274
75 5EL7 11 2A, 2I 30S ribosomal protein S11 274
76 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
77 4LF4 11 K ribosomal protein S11 274
78 4LF6 11 K ribosomal protein S11 274
79 4JI7 11 K RIBOSOMAL PROTEIN S11 274
80 4U24 11 AK, CK 30S ribosomal protein S11 562
81 4WU1 11 2A, 2I 30S ribosomal protein S11 274
82 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
83 5EL4 11 2A, 2I 30S ribosomal protein S11 274
84 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
85 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
86 4WR6 11 2A, 2I 30S ribosomal protein S11 274
87 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
88 5HAU 44 1k, 2k 30S ribosomal protein S11 274
89 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
90 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
91 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
92 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
93 4WF1 11 AK, CK 30S ribosomal protein S11 562
94 4U25 11 AK, CK 30S ribosomal protein S11 562
95 4V95 11 AK, CK 30S Ribosomal Protein S11 274
96 4WWW 42 QK, XK 30S ribosomal protein S11 562
97 4V7T 11 AK, CK 30S ribosomal protein S11 562
98 1VY7 11 AK, CK 30S ribosomal protein S11 274
99 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
100 5E7K 11 2A, 2I 30S ribosomal protein S11 274
101 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
102 5EL5 11 2A, 2I 30S ribosomal protein S11 274
103 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
104 4LNT 11 QK, XK 30S ribosomal protein S11 274
105 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
106 4DR1 11 K 30S ribosomal protein S11 274
107 4LFA 11 K ribosomal protein S11 274
108 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
109 4DV4 11 K ribosomal protein S11 274
110 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
111 4YZV 11 QK, XK 30S ribosomal protein S11 274
112 4JI0 11 K ribosomal protein S11 274
113 5IWA 10 K 30S ribosomal protein S11 274
114 4V7U 11 AK, CK 30S ribosomal protein S11 562
115 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
116 4JI2 11 K RIBOSOMAL PROTEIN S11 274
117 4V6C 10 AK, CK 30S ribosomal protein S11 562
118 4JV5 11 K 30S ribosomal protein S11 274
119 4DR7 11 K 30S ribosomal protein S11 274
120 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
121 4GKK 11 K 30S ribosomal protein S11 274
122 4DUZ 11 K ribosomal protein S11 274
123 4V7V 11 AK, CK 30S ribosomal protein S11 562
124 4X65 11 K 30S ribosomal protein S11 274
125 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
126 4GKJ 11 K 30S ribosomal protein S11 274
127 4DV3 11 K ribosomal protein S11 274
128 4V7S 11 AK, CK 30S ribosomal protein S11 562
129 4DV5 11 K ribosomal protein S11 274
130 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
131 4LFC 11 K ribosomal protein S11 274
132 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
133 3T1Y 11 K 30S ribosomal protein S11 274
134 4WZO 11 2A, 2I 30S ribosomal protein S11 274
135 4JI4 11 K RIBOSOMAL PROTEIN S11 274
136 1VY6 11 AK, CK 30S ribosomal protein S11 274
137 1XMQ 13 K 30S Ribosomal Protein S11 274
138 4U20 11 AK, CK 30S ribosomal protein S11 562
139 4DV0 11 K ribosomal protein S11 274
140 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
141 4U1V 11 AK, CK 30S ribosomal protein S11 562
142 4V6F 41 BN, CN 30S ribosomal protein S11 274
143 4X62 11 K 30S ribosomal protein S11 274
144 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
145 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
146 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
147 4DV2 11 K ribosomal protein S11 274
148 4DV1 11 K ribosomal protein S11 274
149 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
150 5F8K 42 1k, 2k 30S ribosomal protein S11 274
151 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
152 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
153 4JI5 11 K RIBOSOMAL PROTEIN S11 274
154 4K0K 11 K 30S ribosomal protein S11 274
155 4W2E 44 k 30S ribosomal protein S11 274
156 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
157 5BR8 11 K 30S ribosomal protein S11 274
158 4LF5 11 K ribosomal protein S11 274
159 5J4D 45 TA, YC 30S ribosomal protein S11 274
160 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
161 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
162 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
163 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
164 4V7Y 11 AK, CK 30S ribosomal protein S11 274
165 4V9C 11 AK, CK 30S ribosomal protein S11 562
166 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
167 4DR4 11 K 30S ribosomal protein S11 274
168 4WZD 11 2A, 2I 30S ribosomal protein S11 274
169 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
170 4X66 11 K 30S ribosomal protein S11 274
171 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
172 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
173 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
174 4V85 11 AK 30S ribosomal protein S11 562
175 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
176 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
177 4W4G 11 QK, XK 30S ribosomal protein S11 274
178 4NXM 11 K ribosomal protein S11 274
179 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
180 4YPB 11 QK, XK 30S ribosomal protein S11 274
181 4V7X 11 AK, CK 30S ribosomal protein S11 274
182 4U1U 11 AK, CK 30S ribosomal protein S11 562
183 4ZER 42 1k, 2k 30S ribosomal protein S11 274
184 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
185 4V7W 11 AK, CK 30S ribosomal protein S11 274
186 4WT1 11 2A, 2I 30S ribosomal protein S11 274
187 4WT8 11 AK, BK 30S ribosomal protein S11 274
188 5DOX 42 1k, 2k 30S ribosomal protein S11 274
189 4NXN 11 K ribosomal protein S11 274
190 1XNR 13 K 16S Ribosomal protein S11 274
191 4LT8 11 QK, XK 30S ribosomal protein S11 274
192 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
193 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
194 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
195 4V7L 11 AK, CK 30S ribosomal protein S11 274
196 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
197 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
198 1XNQ 13 K Ribosomal protein S11 274
199 4V8A 41 CK, DK 30S ribosomal protein S11 274
200 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
201 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
202 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
203 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
204 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
205 4L47 11 QK, XK 30S ribosomal protein S11 274
206 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
207 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
208 4V7Z 11 AK, CK 30S ribosomal protein S11 274
209 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
210 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
211 4V9I 11 AK, CK 30S Ribosomal protein S11 274
212 1XMO 13 K 30S ribosomal protein S11 274
213 3T1H 11 K 30S ribosomal protein S11 274
214 2UXD 11 K RIBOSOMAL PROTEIN S11 274
215 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
216 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
217 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
218 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
219 4V97 11 AK, CK 30S ribosomal protein S11 274
220 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
221 4V7M 11 AK, CK 30S ribosomal protein S11 274
222 4WSM 11 2A, 2I 30S ribosomal protein S11 274
223 4TUD 11 QK, XK 30S ribosomal protein S11 274
224 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
225 4V6A 11 AK, CK 30S ribosomal protein S11 274
226 4TUE 11 QK, XK 30S ribosomal protein S11 274
227 4TUA 11 QK, XK 30S ribosomal protein S11 274
228 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
229 4V84 11 AK, CK 30S ribosomal protein S11 274
230 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
231 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
232 4V9Q 41 BK, DK 30S ribosomal protein S11 274
233 4TUC 11 QK, XK 30S ribosomal protein S11 274
234 4YHH 11 K 30S ribosomal protein S11 274
235 4TUB 11 QK, XK 30S ribosomal protein S11 274
236 4V9N 14 AK, CK 30S ribosomal protein S11 274
237 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
238 4P70 11 QK, XK 30S ribosomal protein S11 274
239 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
240 4LSK 11 QK, XK 30S ribosomal protein S11 274
241 4V6D 10 AK, CK 30S ribosomal protein S11 562
242 4P6F 11 QK, XK 30S ribosomal protein S11 274
243 4V67 13 AK, CK 30S ribosomal protein S11 274
244 4V83 11 AK, CK 30S ribosomal protein S11 274
245 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
246 4V5O 20 AK, BK RPS14E 5911
247 1VVJ 11 QK, XK 30S ribosomal protein S11 274
248 4LFZ 11 QK, XK 30S ribosomal protein S11 274
249 2E5L 12 K 30S ribosomal protein S11 274
250 4V6E 10 AK, CK 30S ribosomal protein S11 562
251 4V52 10 AK, CK 30S ribosomal protein S11 562
252 2HHH 11 K 30S ribosomal protein S11 274
253 4V89 11 AK 30S ribosomal protein S11 562
254 4OX9 11 K 30S ribosomal protein S11 274
255 4V54 10 AK, CK 30S ribosomal protein S11 562
256 2UXB 11 K RIBOSOMAL PROTEIN S11 274
257 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
258 4V9K 10 AK, CK 30S ribosomal protein S11 274
259 4V50 13 AK, CK 30S ribosomal protein S11 562
260 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
261 4V57 10 AK, CK 30S ribosomal protein S11 562
262 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
263 4V63 13 AK, CK 30S ribosomal protein S11 274
264 4L71 11 QK, XK 30S ribosomal protein S11 274
265 4KVB 11 K 30S ribosomal protein S11 274
266 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
267 4V64 10 AK, CK 30S ribosomal protein S11 562
268 4V7P 11 AK, DK 30S ribosomal protein S11 274
269 4V8J 11 AK, CK 30S ribosomal protein S11 274
270 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
271 2ZM6 11 K 30S ribosomal protein S11 274
272 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
273 4V4Q 10 AK, CK 30S ribosomal protein S11 562
274 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
275 5D8B 38 HC, LA 30S ribosomal protein S11 274
276 4LEL 11 QK, XK 30S ribosomal protein S11 274
277 4V53 10 AK, CK 30S ribosomal protein S11 562
278 2F4V 12 K 30S ribosomal protein S11 274
279 4V9L 10 AK, CK 30S ribosomal protein S11 274
280 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
281 4V56 10 AK, CK 30S ribosomal protein S11 562
282 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
283 4V9J 10 AK, CK 30S ribosomal protein S11 274
284 4V55 10 AK, CK 30S ribosomal protein S11 562
285 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
286 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
287 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
288 4V9M 10 AK, CK 30S ribosomal protein S11 274
289 4W29 10 AK, CK 30S ribosomal protein S11 274
290 4V5Y 10 AK, CK 30S ribosomal protein S11 562
291 4V4Y 13 AN 30S ribosomal protein S11 274
292 4V4J 44 l 30S ribosomal protein S11 274
293 4V4X 13 AN 30S ribosomal protein S11 274
294 4V4Z 14 AN 30S ribosomal protein S11 274
295 4V4I 44 l 30S ribosomal protein S11 274
296 4V4P 46 BN 30S ribosomal protein S11 274
297 4V4R 14 AK 30S ribosomal protein S11 274
298 4V4S 14 AK 30S ribosomal protein S11 274
299 4V4T 14 AK 30S ribosomal protein S11 274
300 4KZZ 15 O 40S Ribosomal Protein S14 9986
301 4KZX 15 O 40S ribosomal protein S14 9986
302 4KZY 15 O 40S Ribosomal Protein S14 9986
303 4V49 13 AK 30S ribosomal protein S11 562
304 4V4A 11 AK 30S ribosomal protein S11 562
305 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
306 5IT7 62 O 40S ribosomal protein S14 28985
307 5IT9 15 O Ribosomal protein uS14 28985
308 5IQR 41 p 30S ribosomal protein S11 562
309 5IMQ 18 O 30S ribosomal protein S11 274
310 5IMR 11 O 30S ribosomal protein S11 274
311 3JCN 42 l 30S ribosomal protein S11 562
312 3JCJ 47 q 30S ribosomal protein S11 562
313 3JCD 10 k 30S ribosomal protein S11 562
314 3JCE 10 k 30S ribosomal protein S11 562
315 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
316 3JBU 10 K 30S ribosomal protein S11 8333
317 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
318 3JBN 26 P 40S ribosomal protein uS11 5833
319 3JBO 32 P 40S ribosomal protein uS11 5833
320 3JBP 26 P 40S ribosomal protein uS11 5833
321 5A9Z 44 BO 30S ribosomal protein S11 274
322 5AA0 44 BO 30S ribosomal protein S11 274
323 3JAP 18 O uS11 28985
324 3JAQ 18 O uS11 28985
325 3JAM 16 O uS11 28985
326 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
327 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
328 3JAG 66 OO uS11 9986
329 3JAH 66 OO uS11 9986
330 3JAI 66 OO uS11 9986
331 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
332 3JA1 11 SK 30S ribosomal protein S11 562
333 3J9Z 5 SK 30S ribosomal protein S11 562
334 3J9Y 7 k 30S ribosomal protein S11 562
335 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
336 3J9W 11 AK 30S ribosomal protein uS11 1423
337 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
338 5AJ0 64 BO 40S ribosomal protein S14 9606
339 5AFI 11 k 30S ribosomal protein S11 562
340 4UER 21 K US11 4934
341 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
342 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
343 4V3P 9 SK 40S ribosomal protein S14 4565
344 3J81 16 O uS11 28985
345 3J80 12 O uS11 28985
346 3J7P 64 SO Ribosomal protein uS11 9823
347 3J7R 65 SO Ribosomal protein uS11 9823
348 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
349 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
350 3J7A 16 P 40S ribosomal protein uS11 5833
351 3J77 60 14 40S ribosomal protein S14 4932
352 3J78 60 14 40S ribosomal protein S14 4932
353 3J6X 61 14 40S ribosomal protein S14 4932
354 3J6Y 61 14 40S ribosomal protein S14 4932
355 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
356 4V92 17 BO US11 28985
357 4V7E 16 BO 40S ribosomal protein S11 4565
358 4V7D 45 BK 30S ribosomal protein S11 562
359 4V7C 11 AK 30S ribosomal protein S11 562
360 4V7B 11 AK 30S ribosomal protein S11 562
361 4V6Y 10 AK 30S ribosomal protein S11 562
362 4V6Z 10 AK 30S ribosomal protein S11 562
363 4V70 10 AK 30S ribosomal protein S11 562
364 4V71 10 AK 30S ribosomal protein S11 562
365 4V72 10 AK 30S ribosomal protein S11 562
366 4V73 10 AK 30S ribosomal protein S11 562
367 4V74 10 AK 30S ribosomal protein S11 562
368 4V75 10 AK 30S ribosomal protein S11 562
369 4V76 10 AK 30S ribosomal protein S11 562
370 4V77 10 AK 30S ribosomal protein S11 562
371 4V78 10 AK 30S ribosomal protein S11 562
372 4V79 10 AK 30S ribosomal protein S11 562
373 4V7A 10 AK 30S ribosomal protein S11 562
374 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
375 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
376 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
377 4V6W 5 AO 40S ribosomal protein S14 7227
378 4V6X 5 AO 40S ribosomal protein S14 9606
379 4V6V 2 AK 30S ribosomal protein S11 562
380 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
381 4V6U 14 AM 30S ribosomal protein S11P 2261
382 4V6T 11 AK 30S ribosomal protein S11 562
383 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
384 4V6S 47 BM 30S ribosomal protein S11 562
385 4V6P 14 AN 30S ribosomal protein S11 562
386 4V6Q 14 AN 30S ribosomal protein S11 562
387 4V6R 14 AN 30S ribosomal protein S11 562
388 4V6N 48 BN 30S ribosomal protein S11 562
389 4V6O 14 AN 30S ribosomal protein S11 562
390 3J0O 12 K Ribosomal protein S14 9986
391 3J0L 12 K Ribosomal protein S14 9986
392 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
393 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
394 4V6M 15 AK 30S ribosomal protein S11 562
395 4V6K 47 BO 30S ribosomal protein S11 562
396 4V6L 14 AO 30S ribosomal protein S11 562
397 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
398 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
399 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
400 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
401 4V7I 46 BK 30S ribosomal protein S11 562
402 4V7H 10 AK 40S ribosomal protein S14(A) 5541
403 3IY8 6 K 30S ribosomal protein S11 562
404 4V68 7 AK 30S ribosomal protein S11 274
405 4V69 2 AK 30S ribosomal protein S11 562
406 4V65 5 AC 30S ribosomal protein S11 562
407 4V66 5 AC 30S ribosomal protein S11 562
408 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
409 4V4V 12 AK 30S ribosomal subunit protein S11 562
410 4V4W 12 AK 30S ribosomal subunit protein S11 562
411 1X18 7 G 30S ribosomal protein S11 274
412 4V4B 11 AK 40S ribosomal protein S14-A 4932
413 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
414 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
415 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
416 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
417 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
418 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
419 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274