Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 294 40
95 % 64 294 49 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 64 294 53
70 % 64 294 64
50 % 82 464 25
40 % 88 585 20
30 % 88 587 34
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 295 37
95 % 64 295 46 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 64 295 50
70 % 64 295 62
50 % 76 458 32
40 % 84 594 19
30 % 84 594 33
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 4 8 8584
95 % 64 302 37 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 64 302 41
70 % 76 472 15
50 % 76 475 24
40 % 76 475 38
30 % 76 475 56
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 296 34
95 % 64 296 42 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 64 296 47
70 % 64 296 59
50 % 76 462 30
40 % 76 462 43
30 % 82 591 37
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 294 39
95 % 64 294 48 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
PDBFlex
90 % 64 294 52
70 % 64 298 56
50 % 64 307 92
40 % 64 307 114
30 % 64 307 126
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 300 27
95 % 66 303 36 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 66 303 40
70 % 66 303 52
50 % 81 470 26
40 % 81 475 37
30 % 81 475 55
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 290 42
95 % 64 295 44 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 64 295 48
70 % 64 295 60
50 % 64 305 93
40 % 76 460 46
30 % 76 460 63
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 266 46
95 % 64 292 51 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.6
PDBFlex
90 % 64 292 55
70 % 64 292 68
50 % 64 292 96
40 % 64 292 118
30 % 64 292 131
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 243 54
95 % 57 249 64 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 57 249 68
70 % 57 249 86
50 % 57 249 117
40 % 57 249 139
30 % 57 249 148
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 65 298 30
95 % 65 298 39 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 65 298 44
70 % 65 298 55
50 % 77 464 28
40 % 77 467 41
30 % 77 467 59
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 295 33
95 % 64 296 41 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.6
PDBFlex
90 % 64 296 46
70 % 64 296 58
50 % 76 448 36
40 % 76 454 47
30 % 76 454 64
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 59 255 50
95 % 64 294 50 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 64 294 54
70 % 64 294 65
50 % 64 294 94
40 % 64 294 116
30 % 64 294 130
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 285 44
95 % 64 285 54 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 64 285 59
70 % 64 285 71
50 % 64 285 100
40 % 64 285 123
30 % 64 285 134
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 248 51
95 % 57 248 65 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 57 248 70
70 % 57 248 88
50 % 59 323 87
40 % 59 323 105
30 % 59 323 119
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 296 32
95 % 64 296 40 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 64 296 45
70 % 64 296 57
50 % 76 458 29
40 % 76 464 42
30 % 76 464 60
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 64 295 36
95 % 64 295 45 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 64 295 49
70 % 64 295 61
50 % 77 459 31
40 % 77 459 44
30 % 77 461 61
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 65 300 28
95 % 71 306 35 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 0.9
PDBFlex
90 % 71 306 39
70 % 71 306 50
50 % 71 306 91
40 % 71 306 113
30 % 83 395 88
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 65 300 29
95 % 65 300 38 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
PDBFlex
90 % 65 300 42
70 % 65 300 53
50 % 76 397 56
40 % 76 403 72
30 % 76 403 87
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 65 295 35
95 % 65 295 43 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 65 299 43
70 % 65 299 54
50 % 79 463 27
40 % 87 607 18
30 % 87 607 32
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 60 199 82
95 % 64 295 47 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 64 295 51
70 % 64 295 63
50 % 76 452 35
40 % 76 453 49
30 % 82 589 35

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 6CFL 42 1k, 2k 30S ribosomal protein S11 274
8 6CAE 42 1k, 2k 30S ribosomal protein S11 274
9 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
10 5FDV 43 1k, 2k 30S ribosomal protein S11 274
11 5J4B 42 1k, 2k 30S ribosomal protein S11 274
12 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
13 6CFK 42 1k, 2k 30S ribosomal protein S11 274
14 5J7L 11 AK, BK 30S ribosomal protein S11 562
15 5W4K 42 1k, 2k 30S ribosomal protein S11 274
16 4LFB 11 K ribosomal protein S11 274
17 1VY4 11 AK, CK 30S ribosomal protein S11 274
18 4WOI 11 AK, DK 30S ribosomal protein S11 562
19 5FDU 42 1k, 2k 30S ribosomal protein S11 274
20 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
21 5JC9 11 AK, BK 30S ribosomal protein S11 562
22 1VY5 11 AK, CK 30S ribosomal protein S11 274
23 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
24 4WQF 44 BK, DK 30S ribosomal protein S11 274
25 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
26 4WPO 44 BK, DK 30S ribosomal protein S11 274
27 5J8A 11 AK, BK 30S ribosomal protein S11 562
28 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
29 4JI1 11 K RIBOSOMAL PROTEIN S11 274
30 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
31 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
32 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
33 5J5B 11 AK, BK 30S ribosomal protein S11 562
34 5HD1 42 1k, 2k 30S ribosomal protein S11 274
35 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
36 4DR6 11 K 30S ribosomal protein S11 274
37 4LF7 11 K ribosomal protein S11 274
38 4LF8 11 K ribosomal protein S11 274
39 5WIS 42 1k, 2k 30S ribosomal protein S11 274
40 4WSD 11 2A, 2I 30S ribosomal protein S11 274
41 4WQU 44 BK, DK 30S ribosomal protein S11 274
42 5WIT 42 1k, 2k 30S ribosomal protein S11 274
43 5E81 11 2A, 2I 30S ribosomal protein S11 274
44 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
45 4U27 11 AK, CK 30S ribosomal protein S11 562
46 6CFJ 42 1k, 2k 30S ribosomal protein S11 274
47 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
48 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
49 5HCR 42 1k, 2k 30S ribosomal protein S11 274
50 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
51 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
52 4DV6 11 K ribosomal protein S11 274
53 4JYA 11 K 30S ribosomal protein S11 274
54 5IBB 11 2A, 2I 30S ribosomal protein S11 274
55 4DR5 11 K 30S ribosomal protein S11 274
56 5J4C 42 1k, 2k 30S ribosomal protein S11 274
57 4KHP 11 K 30S Ribosomal protein S11 274
58 4DR2 11 K 30S ribosomal protein S11 274
59 4WRO 15 2I 30S ribosomal protein S11 274
60 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
61 4LF9 11 K ribosomal protein S11 274
62 4WQY 44 BK, DK 30S ribosomal protein S11 274
63 4DUY 11 K ribosomal protein S11 274
64 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
65 4DV7 11 K ribosomal protein S11 274
66 4WRA 11 2A, 2I 30S ribosomal protein S11 274
67 5IB7 11 2A, 2I 30S ribosomal protein S11 274
68 4U26 11 AK, CK 30S ribosomal protein S11 562
69 4X64 11 K 30S ribosomal protein S11 274
70 5HCP 42 1k, 2k 30S ribosomal protein S11 274
71 5IT8 11 AK, BK 30S ribosomal protein S11 562
72 4V9D 11 AK, BK 30S ribosomal protein S11 562
73 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
74 4V9H 5 AK 30S ribosomal protein S11 274
75 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
76 5J91 11 AK, BK 30S ribosomal protein S11 562
77 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
78 5WNT 11 K RIBOSOMAL PROTEIN S11 274
79 4DR3 11 K 30S ribosomal protein S11 274
80 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
81 4JI3 11 K RIBOSOMAL PROTEIN S11 274
82 4WQR 11 2A, 2I 30S ribosomal protein S11 274
83 4JI6 11 K RIBOSOMAL PROTEIN S11 274
84 4JI8 11 K RIBOSOMAL PROTEIN S11 274
85 2UXC 11 K RIBOSOMAL PROTEIN S11 274
86 5IB8 11 2A, 2I 30S ribosomal protein S11 274
87 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
88 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
89 5EL6 11 2A, 2I 30S ribosomal protein S11 274
90 5EL7 11 2A, 2I 30S ribosomal protein S11 274
91 5VP2 42 1k, 2k 30S ribosomal protein S11 274
92 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
93 4LF4 11 K ribosomal protein S11 274
94 5DFE 45 QK, XK 30S ribosomal protein S11 274
95 5NDK 6 2A, 2I 30S ribosomal protein S11 274
96 4LF6 11 K ribosomal protein S11 274
97 4JI7 11 K RIBOSOMAL PROTEIN S11 274
98 5J88 11 AK, BK 30S ribosomal protein S11 562
99 4U24 11 AK, CK 30S ribosomal protein S11 562
100 4WU1 11 2A, 2I 30S ribosomal protein S11 274
101 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
102 5EL4 11 2A, 2I 30S ribosomal protein S11 274
103 5WNV 11 K 30S ribosomal protein S11 274
104 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
105 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
106 4WR6 11 2A, 2I 30S ribosomal protein S11 274
107 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
108 5HAU 44 1k, 2k 30S ribosomal protein S11 274
109 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
110 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
111 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
112 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
113 4WF1 11 AK, CK 30S ribosomal protein S11 562
114 4U25 11 AK, CK 30S ribosomal protein S11 562
115 4V95 11 AK, CK 30S Ribosomal Protein S11 274
116 4WWW 42 QK, XK 30S ribosomal protein S11 562
117 4V7T 11 AK, CK 30S ribosomal protein S11 562
118 1VY7 11 AK, CK 30S ribosomal protein S11 274
119 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
120 5E7K 11 2A, 2I 30S ribosomal protein S11 274
121 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
122 5EL5 11 2A, 2I 30S ribosomal protein S11 274
123 6FKR 42 1k, 2k 30S ribosomal protein S11 274
124 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
125 4LNT 11 QK, XK 30S ribosomal protein S11 274
126 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
127 4DR1 11 K 30S ribosomal protein S11 274
128 4LFA 11 K ribosomal protein S11 274
129 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
130 4DV4 11 K ribosomal protein S11 274
131 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
132 4YZV 11 QK, XK 30S ribosomal protein S11 274
133 4JI0 11 K ribosomal protein S11 274
134 5IWA 10 K 30S ribosomal protein S11 274
135 4V7U 11 AK, CK 30S ribosomal protein S11 562
136 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
137 4JI2 11 K RIBOSOMAL PROTEIN S11 274
138 4V6C 10 AK, CK 30S ribosomal protein S11 562
139 4JV5 11 K 30S ribosomal protein S11 274
140 4DR7 11 K 30S ribosomal protein S11 274
141 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
142 4GKK 11 K 30S ribosomal protein S11 274
143 4DUZ 11 K ribosomal protein S11 274
144 5NDJ 6 2A, 2I 30S ribosomal protein S11 274
145 4V7V 11 AK, CK 30S ribosomal protein S11 562
146 4X65 11 K 30S ribosomal protein S11 274
147 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
148 4GKJ 11 K 30S ribosomal protein S11 274
149 4DV3 11 K ribosomal protein S11 274
150 4V7S 11 AK, CK 30S ribosomal protein S11 562
151 4DV5 11 K ribosomal protein S11 274
152 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
153 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
154 4LFC 11 K ribosomal protein S11 274
155 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
156 3T1Y 11 K 30S ribosomal protein S11 274
157 4WZO 11 2A, 2I 30S ribosomal protein S11 274
158 4JI4 11 K RIBOSOMAL PROTEIN S11 274
159 1VY6 11 AK, CK 30S ribosomal protein S11 274
160 1XMQ 13 K 30S Ribosomal Protein S11 274
161 5WNP 11 K 30S ribosomal protein S11 274
162 4U20 11 AK, CK 30S ribosomal protein S11 562
163 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
164 4DV0 11 K ribosomal protein S11 274
165 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
166 4U1V 11 AK, CK 30S ribosomal protein S11 562
167 4V6F 41 BN, CN 30S ribosomal protein S11 274
168 4X62 11 K 30S ribosomal protein S11 274
169 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
170 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
171 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
172 4DV2 11 K ribosomal protein S11 274
173 4DV1 11 K ribosomal protein S11 274
174 5WNU 11 K 30S ribosomal protein S11 274
175 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
176 5F8K 42 1k, 2k 30S ribosomal protein S11 274
177 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
178 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
179 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
180 4JI5 11 K RIBOSOMAL PROTEIN S11 274
181 4K0K 11 K 30S ribosomal protein S11 274
182 4W2E 44 k 30S ribosomal protein S11 274
183 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
184 5BR8 11 K 30S ribosomal protein S11 274
185 4LF5 11 K ribosomal protein S11 274
186 5J4D 45 TA, YC 30S ribosomal protein S11 274
187 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
188 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
189 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
190 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
191 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
192 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
193 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
194 4V7Y 11 AK, CK 30S ribosomal protein S11 274
195 4V9C 11 AK, CK 30S ribosomal protein S11 562
196 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
197 5J30 42 QK, XK 30S ribosomal protein S11 274
198 4DR4 11 K 30S ribosomal protein S11 274
199 4WZD 11 2A, 2I 30S ribosomal protein S11 274
200 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
201 4X66 11 K 30S ribosomal protein S11 274
202 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
203 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
204 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
205 4V85 11 AK 30S ribosomal protein S11 562
206 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
207 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
208 4W4G 11 QK, XK 30S ribosomal protein S11 274
209 4NXM 11 K ribosomal protein S11 274
210 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
211 4YPB 11 QK, XK 30S ribosomal protein S11 274
212 4V7X 11 AK, CK 30S ribosomal protein S11 274
213 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
214 4U1U 11 AK, CK 30S ribosomal protein S11 562
215 4ZER 42 1k, 2k 30S ribosomal protein S11 274
216 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
217 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
218 4V7W 11 AK, CK 30S ribosomal protein S11 274
219 4WT1 11 2A, 2I 30S ribosomal protein S11 274
220 6C5L 11 AK, CK 30S ribosomal protein S11 274
221 4WT8 11 AK, BK 30S ribosomal protein S11 274
222 5DOX 42 1k, 2k 30S ribosomal protein S11 274
223 4NXN 11 K ribosomal protein S11 274
224 1XNR 13 K 16S Ribosomal protein S11 274
225 4LT8 11 QK, XK 30S ribosomal protein S11 274
226 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
227 5WNQ 11 K 30S ribosomal protein S11 274
228 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
229 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
230 4V7L 11 AK, CK 30S ribosomal protein S11 274
231 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
232 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
233 1XNQ 13 K Ribosomal protein S11 274
234 4V8A 41 CK, DK 30S ribosomal protein S11 274
235 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
236 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
237 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
238 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
239 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
240 5J3C 42 QK, XK 30S ribosomal protein S11 274
241 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
242 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
243 4L47 11 QK, XK 30S ribosomal protein S11 274
244 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
245 5V8I 42 1k, 2k 30S ribosomal protein S11 274
246 4ZSN 11 QK, XK 30S ribosomal protein S11 274
247 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
248 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
249 4V7Z 11 AK, CK 30S ribosomal protein S11 274
250 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
251 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
252 4V9I 11 AK, CK 30S Ribosomal protein S11 274
253 1XMO 13 K 30S ribosomal protein S11 274
254 3T1H 11 K 30S ribosomal protein S11 274
255 2UXD 11 K RIBOSOMAL PROTEIN S11 274
256 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
257 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
258 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
259 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
260 4V97 11 AK, CK 30S ribosomal protein S11 274
261 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
262 4V7M 11 AK, CK 30S ribosomal protein S11 274
263 4WSM 11 2A, 2I 30S ribosomal protein S11 274
264 4TUD 11 QK, XK 30S ribosomal protein S11 274
265 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
266 5WNR 11 K 30S ribosomal protein S11 274
267 4V6A 11 AK, CK 30S ribosomal protein S11 274
268 4TUE 11 QK, XK 30S ribosomal protein S11 274
269 4TUA 11 QK, XK 30S ribosomal protein S11 274
270 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
271 4V84 11 AK, CK 30S ribosomal protein S11 274
272 5WNS 11 K 30S ribosomal protein S11 274
273 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
274 4YY3 11 K 30S ribosomal protein S11 274
275 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
276 4V9Q 41 BK, DK 30S ribosomal protein S11 274
277 4TUC 11 QK, XK 30S ribosomal protein S11 274
278 4YHH 11 K 30S ribosomal protein S11 274
279 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
280 4TUB 11 QK, XK 30S ribosomal protein S11 274
281 4V9N 14 AK, CK 30S ribosomal protein S11 274
282 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
283 4P70 11 QK, XK 30S ribosomal protein S11 274
284 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
285 4LSK 11 QK, XK 30S ribosomal protein S11 274
286 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
287 4V6D 10 AK, CK 30S ribosomal protein S11 562
288 4P6F 11 QK, XK 30S ribosomal protein S11 274
289 4V67 13 AK, CK 30S ribosomal protein S11 274
290 4V83 11 AK, CK 30S ribosomal protein S11 274
291 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
292 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
293 4V5O 20 AK, BK RPS14E 5911
294 1VVJ 11 QK, XK 30S ribosomal protein S11 274
295 4LFZ 11 QK, XK 30S ribosomal protein S11 274
296 2E5L 12 K 30S ribosomal protein S11 274
297 4V6E 10 AK, CK 30S ribosomal protein S11 562
298 4V52 10 AK, CK 30S ribosomal protein S11 562
299 5CZP 42 QK, XK 30S ribosomal protein S11 274
300 2HHH 11 K 30S ribosomal protein S11 274
301 4V89 11 AK 30S ribosomal protein S11 562
302 4OX9 11 K 30S ribosomal protein S11 274
303 4V54 10 AK, CK 30S ribosomal protein S11 562
304 2UXB 11 K RIBOSOMAL PROTEIN S11 274
305 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
306 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
307 4V9K 10 AK, CK 30S ribosomal protein S11 274
308 4V50 13 AK, CK 30S ribosomal protein S11 562
309 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
310 4V57 10 AK, CK 30S ribosomal protein S11 562
311 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
312 4V63 13 AK, CK 30S ribosomal protein S11 274
313 4L71 11 QK, XK 30S ribosomal protein S11 274
314 4KVB 11 K 30S ribosomal protein S11 274
315 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
316 4V64 10 AK, CK 30S ribosomal protein S11 562
317 4V7P 11 AK, DK 30S ribosomal protein S11 274
318 4V8J 11 AK, CK 30S ribosomal protein S11 274
319 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
320 2ZM6 11 K 30S ribosomal protein S11 274
321 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
322 4V4Q 10 AK, CK 30S ribosomal protein S11 562
323 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
324 5D8B 38 HC, LA 30S ribosomal protein S11 274
325 4LEL 11 QK, XK 30S ribosomal protein S11 274
326 4V53 10 AK, CK 30S ribosomal protein S11 562
327 2F4V 12 K 30S ribosomal protein S11 274
328 4V9L 10 AK, CK 30S ribosomal protein S11 274
329 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
330 4V56 10 AK, CK 30S ribosomal protein S11 562
331 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
332 4V9J 10 AK, CK 30S ribosomal protein S11 274
333 4V55 10 AK, CK 30S ribosomal protein S11 562
334 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
335 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
336 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
337 4V9M 10 AK, CK 30S ribosomal protein S11 274
338 4W29 10 AK, CK 30S ribosomal protein S11 274
339 4V5Y 10 AK, CK 30S ribosomal protein S11 562
340 4V4Y 13 AN 30S ribosomal protein S11 274
341 4V4J 44 l 30S ribosomal protein S11 274
342 4V4X 13 AN 30S ribosomal protein S11 274
343 4V4Z 14 AN 30S ribosomal protein S11 274
344 4V4I 44 l 30S ribosomal protein S11 274
345 4V4P 46 BN 30S ribosomal protein S11 274
346 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
347 4V4R 14 AK 30S ribosomal protein S11 274
348 4V4S 14 AK 30S ribosomal protein S11 274
349 4V4T 14 AK 30S ribosomal protein S11 274
350 4KZZ 15 O 40S Ribosomal Protein S14 9986
351 4KZX 15 O 40S ribosomal protein S14 9986
352 4KZY 15 O 40S Ribosomal Protein S14 9986
353 4V49 13 AK 30S ribosomal protein S11 562
354 4V4A 11 AK 30S ribosomal protein S11 562
355 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
356 6D9J 64 PP uS11 9986
357 6D90 65 PP uS11 9986
358 6G5H 12 O 40S ribosomal protein S14 9606
359 6G5I 16 O 40S ribosomal protein S14 9606
360 6G4S 27 O 40S ribosomal protein S14 9606
361 6G4W 23 O 40S ribosomal protein S14 9606
362 6G51 13 O 40S ribosomal protein S14 9606
363 6G53 13 O 40S ribosomal protein S14 9606
364 6G18 23 O 40S ribosomal protein S14 9606
365 6FXC 11 Ak, Bk 30S ribosomal protein S11 1280
366 6C4I 44 k 30S ribosomal protein S11 562
367 6FEC 38 j 40S ribosomal protein S14 9606
368 6FAI 25 O 40S ribosomal protein S14-A 4932
369 6BU8 41 K 30S ribosomal protein S11 562
370 6BOH 45 UA, ZC 30S ribosomal protein S11 274
371 6BOK 44 SA, VC 30S ribosomal protein S11 274
372 6ERI 44 BK 30S ribosomal protein S11, chloroplastic 3562
373 6ENU 11 k 30S ribosomal protein S11 562
374 6ENJ 41 k 30S ribosomal protein S11 562
375 6ENF 11 k 30S ribosomal protein S11 562
376 6EML 22 Z 40S ribosomal protein S14-A 4932
377 6B4V 45 TA, XC 30S ribosomal protein S11 274
378 6EK0 75 SO 40S ribosomal protein S14 9606
379 6AZ1 15 O ribosomal protein S11 5661
380 6AWB 16 N 30S ribosomal protein S11 562
381 6AWC 16 N 30S ribosomal protein S11 562
382 6AWD 15 N 30S ribosomal protein S11 562
383 5OT7 17 J 30S ribosomal protein S11 274
384 5OQL 42 t 40S ribosomal protein S14-like protein 209285
385 5OPT 14 V 40S ribosomal protein S14, putative 5693
386 5WLC 40 NG rpS14_uS11 4932
387 5WFK 44 k 30S ribosomal protein S11 562
388 5WFS 44 k 30S ribosomal protein S11 562
389 5WF0 44 k 30S ribosomal protein S11 562
390 5XYU 10 K 30S ribosomal protein S11 1772
391 5XYI 16 O Ribosomal protein S14 5722
392 5WE4 44 k 30S ribosomal protein S11 562
393 5WE6 44 k 30S ribosomal protein S11 562
394 5WDT 44 k 30S ribosomal protein S11 562
395 5XXU 16 O Ribosomal protein uS11 5811
396 5OA3 19 O 40S ribosomal protein S14 9606
397 5O61 45 BK 30S ribosomal protein S11 1772
398 5O5J 11 K 30S ribosomal protein S11 1772
399 5O2R 45 k 30S ribosomal protein S11 562
400 5NWY 45 A 30S ribosomal protein S11 562
401 5NP6 14 N 30S ribosomal protein S11 562
402 5NO2 9 K 30S ribosomal protein S11 562
403 5NO3 10 K 30S ribosomal protein S11 562
404 5NO4 10 K 30S ribosomal protein S11 562
405 5NJT 11 K 30S ribosomal protein S11 1423
406 5V93 42 k 30S ribosomal protein S11 1773
407 5NGM 11 Ak 30S ribosomal protein S11 1280
408 5ND8 11 k 30S ribosomal protein S11 1280
409 5ND9 11 k 30S ribosomal protein S11 1280
410 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
411 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
412 5UYK 41 K 30S ribosomal protein S11 562
413 5UYL 41 K 30S ribosomal protein S11 562
414 5UYM 41 K 30S ribosomal protein S11 562
415 5UYN 41 K 30S ribosomal protein S11 562
416 5UYP 41 K 30S ribosomal protein S11 562
417 5UYQ 41 K 30S ribosomal protein S11 562
418 5UZ4 10 K 30S ribosomal protein S11 562
419 5UQ7 42 k 30S ribosomal protein S11 274
420 5UQ8 42 k 30S ribosomal protein S11 274
421 5MYJ 11 AK 30S ribosomal protein S11 1358
422 5MY1 10 K 30S ribosomal protein S11 562
423 5WYJ 45 SP 40S ribosomal protein S14-A 4932
424 5WYK 41 SP 40S ribosomal protein S14-A 4932
425 5U9F 49 K 30S ribosomal protein S11 562
426 5U9G 49 K 30S ribosomal protein S11 562
427 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
428 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
429 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
430 5MGP 42 k 30S ribosomal protein S11 562
431 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
432 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
433 5MDV 48 p 30S ribosomal protein S11 562
434 5MDW 48 p 30S ribosomal protein S11 562
435 5MDY 48 p 30S ribosomal protein S11 562
436 5MDZ 46 p 30S ribosomal protein S11 562
437 5H5U 49 r 30S ribosomal protein S11 562
438 5MC6 27 Z 40S ribosomal protein S14-A 4932
439 5M1J 22 O2 40S ribosomal protein S14-A 4932
440 5LZA 11 k 30S ribosomal protein S11 562
441 5LZB 11 k 30S ribosomal protein S11 562
442 5LZC 11 k 30S ribosomal protein S11 562
443 5LZD 11 k 30S ribosomal protein S11 562
444 5LZE 11 k 30S ribosomal protein S11 562
445 5LZF 11 k 30S ribosomal protein S11 562
446 5TCU 10 S2 30S ribosomal protein S11 1280
447 5T7V 3 S2 30S ribosomal protein S11 1280
448 5T2A 63 AH uS11 5661
449 5T2C 80 AO 40S ribosomal protein S14 9606
450 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
451 5LMO 11 K 30S ribosomal protein S11 274
452 5LMP 11 K 30S ribosomal protein S11 274
453 5LMQ 11 K 30S ribosomal protein S11 274
454 5LMR 11 K 30S ribosomal protein S11 274
455 5LMS 11 K 30S ribosomal protein S11 274
456 5LMT 11 K 30S ribosomal protein S11 274
457 5LMU 11 K 30S ribosomal protein S11 274
458 5LMV 11 K 30S ribosomal protein S11 274
459 5LL6 12 Z 40S ribosomal protein S14-A 4932
460 5LKS 74 SO 40S ribosomal protein S14 9606
461 5LI0 11 k 30S ribosomal protein S11 1280
462 5KPS 42 16 30S ribosomal protein S11 562
463 5KPV 41 15 30S ribosomal protein S11 562
464 5KPW 41 15 30S ribosomal protein S11 562
465 5KPX 41 15 30S ribosomal protein S11 562
466 5KCR 43 1k 30S ribosomal protein S11 562
467 5KCS 45 1k 30S ribosomal protein S11 562
468 5L3P 42 k 30S ribosomal protein S11 562
469 5K0Y 32 j ribosomal protein uS11 9986
470 5JU8 11 AK 30S ribosomal protein S11 562
471 5JUO 64 LB uS11 (yeast S14) 4932
472 5JUP 64 LB uS11 (yeast S14) 4932
473 5JUS 64 LB uS11 (yeast S14) 4932
474 5JUT 64 LB uS11 (yeast S14) 4932
475 5JUU 64 LB uS11 (yeast S14) 4932
476 5JTE 11 AK 30S ribosomal protein S11 562
477 5JPQ 29 w uS11 209285
478 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
479 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
480 5IT7 62 O 40S ribosomal protein S14 28985
481 5IT9 15 O Ribosomal protein uS14 28985
482 5IQR 41 p 30S ribosomal protein S11 562
483 5IMQ 18 O 30S ribosomal protein S11 274
484 5IMR 11 O 30S ribosomal protein S11 274
485 3JCN 42 l 30S ribosomal protein S11 562
486 3JCJ 47 q 30S ribosomal protein S11 562
487 3JCD 10 k 30S ribosomal protein S11 562
488 3JCE 10 k 30S ribosomal protein S11 562
489 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
490 3JBU 10 K 30S ribosomal protein S11 562
491 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 562
492 3JBN 26 P 40S ribosomal protein uS11 5833
493 3JBO 32 P 40S ribosomal protein uS11 5833
494 3JBP 26 P 40S ribosomal protein uS11 5833
495 5A9Z 44 BO 30S ribosomal protein S11 274
496 5AA0 44 BO 30S ribosomal protein S11 274
497 3JAP 18 O uS11 28985
498 3JAQ 18 O uS11 28985
499 3JAM 16 O uS11 28985
500 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
501 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
502 3JAG 66 OO uS11 9986
503 3JAH 66 OO uS11 9986
504 3JAI 66 OO uS11 9986
505 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
506 3JA1 11 SK 30S ribosomal protein S11 562
507 3J9Z 5 SK 30S ribosomal protein S11 562
508 3J9Y 7 k 30S ribosomal protein S11 562
509 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
510 3J9W 11 AK 30S ribosomal protein uS11 1423
511 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
512 5AJ0 64 BO 40S ribosomal protein S14 9606
513 5AFI 11 k 30S ribosomal protein S11 562
514 4UER 21 K US11 4934
515 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
516 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
517 4V3P 9 SK 40S ribosomal protein S14 4565
518 3J81 16 O uS11 28985
519 3J80 12 O uS11 28985
520 3J7P 64 SO Ribosomal protein uS11 9823
521 3J7R 65 SO Ribosomal protein uS11 9823
522 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
523 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
524 3J7A 16 P 40S ribosomal protein uS11 5833
525 3J77 60 14 40S ribosomal protein S14 4932
526 3J78 60 14 40S ribosomal protein S14 4932
527 3J6X 61 14 40S ribosomal protein S14 4932
528 3J6Y 61 14 40S ribosomal protein S14 4932
529 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
530 4V92 17 BO US11 28985
531 4V7E 16 BO 40S ribosomal protein S11 4565
532 4V7D 45 BK 30S ribosomal protein S11 562
533 4V7C 11 AK 30S ribosomal protein S11 562
534 4V7B 11 AK 30S ribosomal protein S11 562
535 4V6Y 10 AK 30S ribosomal protein S11 562
536 4V6Z 10 AK 30S ribosomal protein S11 562
537 4V70 10 AK 30S ribosomal protein S11 562
538 4V71 10 AK 30S ribosomal protein S11 562
539 4V72 10 AK 30S ribosomal protein S11 562
540 4V73 10 AK 30S ribosomal protein S11 562
541 4V74 10 AK 30S ribosomal protein S11 562
542 4V75 10 AK 30S ribosomal protein S11 562
543 4V76 10 AK 30S ribosomal protein S11 562
544 4V77 10 AK 30S ribosomal protein S11 562
545 4V78 10 AK 30S ribosomal protein S11 562
546 4V79 10 AK 30S ribosomal protein S11 562
547 4V7A 10 AK 30S ribosomal protein S11 562
548 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
549 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
550 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
551 4V6W 5 AO 40S ribosomal protein S14 7227
552 4V6X 5 AO 40S ribosomal protein S14 9606
553 4V6V 2 AK 30S ribosomal protein S11 562
554 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
555 4V6U 14 AM 30S ribosomal protein S11P 2261
556 4V6T 11 AK 30S ribosomal protein S11 562
557 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
558 4V6S 47 BM 30S ribosomal protein S11 562
559 4V6P 14 AN 30S ribosomal protein S11 562
560 4V6Q 14 AN 30S ribosomal protein S11 562
561 4V6R 14 AN 30S ribosomal protein S11 562
562 4V6N 48 BN 30S ribosomal protein S11 562
563 4V6O 14 AN 30S ribosomal protein S11 562
564 3J0O 12 K Ribosomal protein S14 9986
565 3J0L 12 K Ribosomal protein S14 9986
566 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
567 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
568 4V6M 15 AK 30S ribosomal protein S11 562
569 4V6K 47 BO 30S ribosomal protein S11 562
570 4V6L 14 AO 30S ribosomal protein S11 562
571 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
572 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
573 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
574 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
575 4V7I 46 BK 30S ribosomal protein S11 562
576 4V7H 10 AK 40S ribosomal protein S14(A) 5541
577 3IY8 6 K 30S ribosomal protein S11 562
578 4V68 7 AK 30S ribosomal protein S11 274
579 4V69 2 AK 30S ribosomal protein S11 562
580 4V65 5 AC 30S ribosomal protein S11 562
581 4V66 5 AC 30S ribosomal protein S11 562
582 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
583 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
584 4V4V 12 AK 30S ribosomal subunit protein S11 562
585 4V4W 12 AK 30S ribosomal subunit protein S11 562
586 1X18 7 G 30S ribosomal protein S11 274
587 4V4B 11 AK 40S ribosomal protein S14-A 4932
588 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
589 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
590 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
591 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
592 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
593 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
594 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274