Sequence Similarity Clusters for the Entities in PDB 4JI8

Entity #1 | Chains: A
16S rRNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
RIBOSOMAL PROTEIN S10 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 268 39
95 % 56 269 53 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 56 269 58
70 % 56 269 68
50 % 74 419 26
40 % 74 419 38
30 % 80 525 31
Entity #11 | Chains: K
RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 270 35
95 % 56 270 49
90 % 56 270 54
70 % 56 270 64
50 % 68 413 32
40 % 76 525 19
30 % 76 525 32
Entity #12 | Chains: L
RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 22522
95 % 56 277 40
90 % 56 277 45
70 % 68 420 19
50 % 68 430 24
40 % 68 430 36
30 % 68 430 55
Entity #13 | Chains: M
RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 271 33
95 % 56 271 47 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 56 271 52
70 % 56 271 62
50 % 68 417 31
40 % 68 417 46
30 % 74 523 34
Entity #14 | Chains: N
RIBOSOMAL PROTEIN S14 protein, length: 61 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 269 38
95 % 56 269 54 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
PDBFlex
90 % 56 269 59
70 % 56 277 55
50 % 56 277 91
40 % 56 277 115
30 % 56 277 123
Entity #15 | Chains: O
RIBOSOMAL PROTEIN S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 273 30
95 % 58 278 38 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.6
PDBFlex
90 % 58 278 43
70 % 58 278 53
50 % 73 426 25
40 % 73 431 35
30 % 73 431 54
Entity #16 | Chains: P
RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 265 41
95 % 56 270 51 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 56 270 56
70 % 56 270 66
50 % 56 277 90
40 % 56 277 114
30 % 68 412 63
Entity #17 | Chains: Q
RIBOSOMAL PROTEIN S17 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 48 177 58
95 % 56 264 56 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.6
PDBFlex
90 % 56 268 60
70 % 56 268 69
50 % 56 268 94
40 % 56 268 118
30 % 56 268 128
Entity #18 | Chains: R
RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 49 184 56
95 % 50 235 65 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 50 235 70
70 % 50 235 82
50 % 50 235 111
40 % 50 235 135
30 % 50 235 143
Entity #19 | Chains: S
RIBOSOMAL PROTEIN S19 protein, length: 93 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 273 29
95 % 57 273 42
90 % 57 273 48
70 % 57 273 59
50 % 69 419 28
40 % 69 422 40
30 % 69 422 56
Entity #2 | Chains: B
RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 270 31
95 % 56 271 44 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.5
PDBFlex
90 % 56 271 50
70 % 56 271 60
50 % 68 408 36
40 % 68 413 45
30 % 68 413 62
Entity #20 | Chains: T
RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 55 218 50
95 % 56 269 52 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 56 269 57
70 % 56 269 67
50 % 56 269 93
40 % 56 269 116
30 % 56 269 127
Entity #21 | Chains: U
RIBOSOMAL PROTEIN THX protein, length: 27 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 260 43
95 % 56 260 59 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 56 260 63
70 % 56 260 74
50 % 56 260 98
40 % 56 260 121
30 % 56 260 133
Entity #3 | Chains: C
RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 50 234 48
95 % 50 234 66 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 50 234 71
70 % 50 234 83
50 % 52 308 84
40 % 52 308 103
30 % 52 308 116
Entity #4 | Chains: D
RIBOSOMAL PROTEIN S4 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 263 42
95 % 56 271 45 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.6
PDBFlex
90 % 56 271 51
70 % 56 271 61
50 % 68 414 30
40 % 68 419 41
30 % 68 419 57
Entity #5 | Chains: E
RIBOSOMAL PROTEIN S5 protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 270 34
95 % 56 270 48 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 56 270 53
70 % 56 270 63
50 % 69 416 29
40 % 69 416 42
30 % 69 418 61
Entity #6 | Chains: F
RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 275 27
95 % 63 281 37
90 % 63 281 42
70 % 63 281 51
50 % 63 281 88
40 % 63 281 110
30 % 75 353 93
Entity #7 | Chains: G
RIBOSOMAL PROTEIN S7 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 274 28
95 % 57 275 41 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
PDBFlex
90 % 57 275 46
70 % 57 275 56
50 % 68 354 68
40 % 68 359 85
30 % 68 359 95
Entity #8 | Chains: H
RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 57 270 32
95 % 57 270 46 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 57 274 47
70 % 57 274 57
50 % 71 419 27
40 % 72 425 37
30 % 79 538 30
Entity #9 | Chains: I
RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 52 179 68
95 % 56 270 50 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.8
PDBFlex
90 % 56 270 55
70 % 56 270 65
50 % 68 410 35
40 % 68 410 48
30 % 74 520 35

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
8 5FDV 43 1k, 2k 30S ribosomal protein S11 274
9 5J4B 42 1k, 2k 30S ribosomal protein S11 274
10 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
11 5J7L 11 AK, BK 30S ribosomal protein S11 562
12 4LFB 11 K ribosomal protein S11 274
13 1VY4 11 AK, CK 30S ribosomal protein S11 274
14 4WOI 11 AK, DK 30S ribosomal protein S11 562
15 5FDU 42 1k, 2k 30S ribosomal protein S11 274
16 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
17 5JC9 11 AK, BK 30S ribosomal protein S11 562
18 1VY5 11 AK, CK 30S ribosomal protein S11 274
19 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
20 4WQF 44 BK, DK 30S ribosomal protein S11 274
21 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
22 4WPO 44 BK, DK 30S ribosomal protein S11 274
23 5J8A 11 AK, BK 30S ribosomal protein S11 562
24 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
25 4JI1 11 K RIBOSOMAL PROTEIN S11 274
26 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
27 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
28 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
29 5J5B 11 AK, BK 30S ribosomal protein S11 562
30 5HD1 42 1k, 2k 30S ribosomal protein S11 274
31 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
32 4DR6 11 K 30S ribosomal protein S11 274
33 4LF7 11 K ribosomal protein S11 274
34 4LF8 11 K ribosomal protein S11 274
35 4WSD 11 2A, 2I 30S ribosomal protein S11 274
36 4WQU 44 BK, DK 30S ribosomal protein S11 274
37 5E81 11 2A, 2I 30S ribosomal protein S11 274
38 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
39 4U27 11 AK, CK 30S ribosomal protein S11 562
40 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
41 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
42 5HCR 42 1k, 2k 30S ribosomal protein S11 274
43 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
44 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
45 4DV6 11 K ribosomal protein S11 274
46 4JYA 11 K 30S ribosomal protein S11 274
47 5IBB 11 2A, 2I 30S ribosomal protein S11 274
48 4DR5 11 K 30S ribosomal protein S11 274
49 5J4C 42 1k, 2k 30S ribosomal protein S11 274
50 4KHP 11 K 30S Ribosomal protein S11 274
51 4DR2 11 K 30S ribosomal protein S11 274
52 4WRO 15 2I 30S ribosomal protein S11 274
53 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
54 4LF9 11 K ribosomal protein S11 274
55 4WQY 44 BK, DK 30S ribosomal protein S11 274
56 4DUY 11 K ribosomal protein S11 274
57 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
58 4DV7 11 K ribosomal protein S11 274
59 4WRA 11 2A, 2I 30S ribosomal protein S11 274
60 5IB7 11 2A, 2I 30S ribosomal protein S11 274
61 4U26 11 AK, CK 30S ribosomal protein S11 562
62 4X64 11 K 30S ribosomal protein S11 274
63 5HCP 42 1k, 2k 30S ribosomal protein S11 274
64 5IT8 11 AK, BK 30S ribosomal protein S11 562
65 4V9D 11 AK, BK 30S ribosomal protein S11 562
66 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
67 4V9H 5 AK 30S ribosomal protein S11 274
68 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
69 5J91 11 AK, BK 30S ribosomal protein S11 562
70 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
71 4DR3 11 K 30S ribosomal protein S11 274
72 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
73 4JI3 11 K RIBOSOMAL PROTEIN S11 274
74 4WQR 11 2A, 2I 30S ribosomal protein S11 274
75 4JI6 11 K RIBOSOMAL PROTEIN S11 274
76 4JI8 11 K RIBOSOMAL PROTEIN S11 274
77 2UXC 11 K RIBOSOMAL PROTEIN S11 274
78 5IB8 11 2A, 2I 30S ribosomal protein S11 274
79 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
80 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
81 5EL6 11 2A, 2I 30S ribosomal protein S11 274
82 5EL7 11 2A, 2I 30S ribosomal protein S11 274
83 5VP2 42 1k, 2k 30S ribosomal protein S11 274
84 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
85 4LF4 11 K ribosomal protein S11 274
86 5DFE 45 QK, XK 30S ribosomal protein S11 274
87 4LF6 11 K ribosomal protein S11 274
88 4JI7 11 K RIBOSOMAL PROTEIN S11 274
89 5J88 11 AK, BK 30S ribosomal protein S11 562
90 4U24 11 AK, CK 30S ribosomal protein S11 562
91 4WU1 11 2A, 2I 30S ribosomal protein S11 274
92 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
93 5EL4 11 2A, 2I 30S ribosomal protein S11 274
94 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
95 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
96 4WR6 11 2A, 2I 30S ribosomal protein S11 274
97 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
98 5HAU 44 1k, 2k 30S ribosomal protein S11 274
99 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
100 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
101 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
102 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
103 4WF1 11 AK, CK 30S ribosomal protein S11 562
104 4U25 11 AK, CK 30S ribosomal protein S11 562
105 4V95 11 AK, CK 30S Ribosomal Protein S11 274
106 4WWW 42 QK, XK 30S ribosomal protein S11 562
107 4V7T 11 AK, CK 30S ribosomal protein S11 562
108 1VY7 11 AK, CK 30S ribosomal protein S11 274
109 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
110 5E7K 11 2A, 2I 30S ribosomal protein S11 274
111 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
112 5EL5 11 2A, 2I 30S ribosomal protein S11 274
113 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
114 4LNT 11 QK, XK 30S ribosomal protein S11 274
115 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
116 4DR1 11 K 30S ribosomal protein S11 274
117 4LFA 11 K ribosomal protein S11 274
118 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
119 4DV4 11 K ribosomal protein S11 274
120 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
121 4YZV 11 QK, XK 30S ribosomal protein S11 274
122 4JI0 11 K ribosomal protein S11 274
123 5IWA 10 K 30S ribosomal protein S11 274
124 4V7U 11 AK, CK 30S ribosomal protein S11 562
125 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
126 4JI2 11 K RIBOSOMAL PROTEIN S11 274
127 4V6C 10 AK, CK 30S ribosomal protein S11 562
128 4JV5 11 K 30S ribosomal protein S11 274
129 4DR7 11 K 30S ribosomal protein S11 274
130 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
131 4GKK 11 K 30S ribosomal protein S11 274
132 4DUZ 11 K ribosomal protein S11 274
133 4V7V 11 AK, CK 30S ribosomal protein S11 562
134 4X65 11 K 30S ribosomal protein S11 274
135 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
136 4GKJ 11 K 30S ribosomal protein S11 274
137 4DV3 11 K ribosomal protein S11 274
138 4V7S 11 AK, CK 30S ribosomal protein S11 562
139 4DV5 11 K ribosomal protein S11 274
140 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
141 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
142 4LFC 11 K ribosomal protein S11 274
143 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
144 3T1Y 11 K 30S ribosomal protein S11 274
145 4WZO 11 2A, 2I 30S ribosomal protein S11 274
146 4JI4 11 K RIBOSOMAL PROTEIN S11 274
147 1VY6 11 AK, CK 30S ribosomal protein S11 274
148 1XMQ 13 K 30S Ribosomal Protein S11 274
149 4U20 11 AK, CK 30S ribosomal protein S11 562
150 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
151 4DV0 11 K ribosomal protein S11 274
152 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
153 4U1V 11 AK, CK 30S ribosomal protein S11 562
154 4V6F 41 BN, CN 30S ribosomal protein S11 274
155 4X62 11 K 30S ribosomal protein S11 274
156 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
157 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
158 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
159 4DV2 11 K ribosomal protein S11 274
160 4DV1 11 K ribosomal protein S11 274
161 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
162 5F8K 42 1k, 2k 30S ribosomal protein S11 274
163 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
164 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
165 4JI5 11 K RIBOSOMAL PROTEIN S11 274
166 4K0K 11 K 30S ribosomal protein S11 274
167 4W2E 44 k 30S ribosomal protein S11 274
168 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
169 5BR8 11 K 30S ribosomal protein S11 274
170 4LF5 11 K ribosomal protein S11 274
171 5J4D 45 TA, YC 30S ribosomal protein S11 274
172 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
173 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
174 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
175 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
176 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
177 4V7Y 11 AK, CK 30S ribosomal protein S11 274
178 4V9C 11 AK, CK 30S ribosomal protein S11 562
179 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
180 5J30 42 QK, XK 30S ribosomal protein S11 274
181 4DR4 11 K 30S ribosomal protein S11 274
182 4WZD 11 2A, 2I 30S ribosomal protein S11 274
183 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
184 4X66 11 K 30S ribosomal protein S11 274
185 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
186 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
187 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
188 4V85 11 AK 30S ribosomal protein S11 562
189 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
190 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
191 4W4G 11 QK, XK 30S ribosomal protein S11 274
192 4NXM 11 K ribosomal protein S11 274
193 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
194 4YPB 11 QK, XK 30S ribosomal protein S11 274
195 4V7X 11 AK, CK 30S ribosomal protein S11 274
196 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
197 4U1U 11 AK, CK 30S ribosomal protein S11 562
198 4ZER 42 1k, 2k 30S ribosomal protein S11 274
199 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
200 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
201 4V7W 11 AK, CK 30S ribosomal protein S11 274
202 4WT1 11 2A, 2I 30S ribosomal protein S11 274
203 4WT8 11 AK, BK 30S ribosomal protein S11 274
204 5DOX 42 1k, 2k 30S ribosomal protein S11 274
205 4NXN 11 K ribosomal protein S11 274
206 1XNR 13 K 16S Ribosomal protein S11 274
207 4LT8 11 QK, XK 30S ribosomal protein S11 274
208 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
209 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
210 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
211 4V7L 11 AK, CK 30S ribosomal protein S11 274
212 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
213 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
214 1XNQ 13 K Ribosomal protein S11 274
215 4V8A 41 CK, DK 30S ribosomal protein S11 274
216 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
217 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
218 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
219 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
220 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
221 5J3C 42 QK, XK 30S ribosomal protein S11 274
222 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
223 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
224 4L47 11 QK, XK 30S ribosomal protein S11 274
225 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
226 4ZSN 11 QK, XK 30S ribosomal protein S11 274
227 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
228 4V7Z 11 AK, CK 30S ribosomal protein S11 274
229 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
230 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
231 4V9I 11 AK, CK 30S Ribosomal protein S11 274
232 1XMO 13 K 30S ribosomal protein S11 274
233 3T1H 11 K 30S ribosomal protein S11 274
234 2UXD 11 K RIBOSOMAL PROTEIN S11 274
235 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
236 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
237 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
238 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
239 4V97 11 AK, CK 30S ribosomal protein S11 274
240 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
241 4V7M 11 AK, CK 30S ribosomal protein S11 274
242 4WSM 11 2A, 2I 30S ribosomal protein S11 274
243 4TUD 11 QK, XK 30S ribosomal protein S11 274
244 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
245 4V6A 11 AK, CK 30S ribosomal protein S11 274
246 4TUE 11 QK, XK 30S ribosomal protein S11 274
247 4TUA 11 QK, XK 30S ribosomal protein S11 274
248 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
249 4V84 11 AK, CK 30S ribosomal protein S11 274
250 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
251 4YY3 11 K 30S ribosomal protein S11 274
252 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
253 4V9Q 41 BK, DK 30S ribosomal protein S11 274
254 4TUC 11 QK, XK 30S ribosomal protein S11 274
255 4YHH 11 K 30S ribosomal protein S11 274
256 4TUB 11 QK, XK 30S ribosomal protein S11 274
257 4V9N 14 AK, CK 30S ribosomal protein S11 274
258 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
259 4P70 11 QK, XK 30S ribosomal protein S11 274
260 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
261 4LSK 11 QK, XK 30S ribosomal protein S11 274
262 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
263 4V6D 10 AK, CK 30S ribosomal protein S11 562
264 4P6F 11 QK, XK 30S ribosomal protein S11 274
265 4V67 13 AK, CK 30S ribosomal protein S11 274
266 4V83 11 AK, CK 30S ribosomal protein S11 274
267 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
268 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
269 4V5O 20 AK, BK RPS14E 5911
270 1VVJ 11 QK, XK 30S ribosomal protein S11 274
271 4LFZ 11 QK, XK 30S ribosomal protein S11 274
272 2E5L 12 K 30S ribosomal protein S11 274
273 4V6E 10 AK, CK 30S ribosomal protein S11 562
274 4V52 10 AK, CK 30S ribosomal protein S11 562
275 5CZP 42 QK, XK 30S ribosomal protein S11 274
276 2HHH 11 K 30S ribosomal protein S11 274
277 4V89 11 AK 30S ribosomal protein S11 562
278 4OX9 11 K 30S ribosomal protein S11 274
279 4V54 10 AK, CK 30S ribosomal protein S11 562
280 2UXB 11 K RIBOSOMAL PROTEIN S11 274
281 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
282 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
283 4V9K 10 AK, CK 30S ribosomal protein S11 274
284 4V50 13 AK, CK 30S ribosomal protein S11 562
285 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
286 4V57 10 AK, CK 30S ribosomal protein S11 562
287 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
288 4V63 13 AK, CK 30S ribosomal protein S11 274
289 4L71 11 QK, XK 30S ribosomal protein S11 274
290 4KVB 11 K 30S ribosomal protein S11 274
291 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
292 4V64 10 AK, CK 30S ribosomal protein S11 562
293 4V7P 11 AK, DK 30S ribosomal protein S11 274
294 4V8J 11 AK, CK 30S ribosomal protein S11 274
295 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
296 2ZM6 11 K 30S ribosomal protein S11 274
297 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
298 4V4Q 10 AK, CK 30S ribosomal protein S11 562
299 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
300 5D8B 38 HC, LA 30S ribosomal protein S11 274
301 4LEL 11 QK, XK 30S ribosomal protein S11 274
302 4V53 10 AK, CK 30S ribosomal protein S11 562
303 2F4V 12 K 30S ribosomal protein S11 274
304 4V9L 10 AK, CK 30S ribosomal protein S11 274
305 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
306 4V56 10 AK, CK 30S ribosomal protein S11 562
307 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
308 4V9J 10 AK, CK 30S ribosomal protein S11 274
309 4V55 10 AK, CK 30S ribosomal protein S11 562
310 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
311 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
312 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
313 4V9M 10 AK, CK 30S ribosomal protein S11 274
314 4W29 10 AK, CK 30S ribosomal protein S11 274
315 4V5Y 10 AK, CK 30S ribosomal protein S11 562
316 4V4Y 13 AN 30S ribosomal protein S11 274
317 4V4J 44 l 30S ribosomal protein S11 274
318 4V4X 13 AN 30S ribosomal protein S11 274
319 4V4Z 14 AN 30S ribosomal protein S11 274
320 4V4I 44 l 30S ribosomal protein S11 274
321 4V4P 46 BN 30S ribosomal protein S11 274
322 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
323 4V4R 14 AK 30S ribosomal protein S11 274
324 4V4S 14 AK 30S ribosomal protein S11 274
325 4V4T 14 AK 30S ribosomal protein S11 274
326 4KZZ 15 O 40S Ribosomal Protein S14 9986
327 4KZX 15 O 40S ribosomal protein S14 9986
328 4KZY 15 O 40S Ribosomal Protein S14 9986
329 4V49 13 AK 30S ribosomal protein S11 562
330 4V4A 11 AK 30S ribosomal protein S11 562
331 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
332 5OA3 19 O 40S ribosomal protein S14 9606
333 5O61 45 BK 30S ribosomal protein S11 1772
334 5O5J 11 K 30S ribosomal protein S11 1772
335 5O2R 45 k 30S ribosomal protein S11 562
336 5NWY 45 A 30S ribosomal protein S11 562
337 5NP6 14 N 30S ribosomal protein S11 562
338 5NO2 9 K 30S ribosomal protein S11 562
339 5NO3 10 K 30S ribosomal protein S11 562
340 5NO4 10 K 30S ribosomal protein S11 562
341 5NJT 11 K 30S ribosomal protein S11 1423
342 5ND8 11 k 30S ribosomal protein S11 1280
343 5ND9 11 k 30S ribosomal protein S11 1280
344 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
345 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
346 5UYK 41 K 30S ribosomal protein S11 562
347 5UYL 41 K 30S ribosomal protein S11 562
348 5UYM 41 K 30S ribosomal protein S11 562
349 5UYN 41 K 30S ribosomal protein S11 562
350 5UYP 41 K 30S ribosomal protein S11 562
351 5UYQ 41 K 30S ribosomal protein S11 562
352 5UZ4 10 K 30S ribosomal protein S11 562
353 5MY1 10 K 30S ribosomal protein S11 562
354 5WYJ 45 SP 40S ribosomal protein S14-A 4932
355 5WYK 41 SP 40S ribosomal protein S14-A 4932
356 5U9F 49 K 30S ribosomal protein S11 562
357 5U9G 49 K 30S ribosomal protein S11 562
358 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
359 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
360 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
361 5MGP 42 k 30S ribosomal protein S11 562
362 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
363 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
364 5MDV 48 p 30S ribosomal protein S11 562
365 5MDW 48 p 30S ribosomal protein S11 562
366 5MDY 48 p 30S ribosomal protein S11 562
367 5MDZ 46 p 30S ribosomal protein S11 562
368 5H5U 49 r 30S ribosomal protein S11 562
369 5MC6 27 Z 40S ribosomal protein S14-A 4932
370 5M1J 22 O2 40S ribosomal protein S14-A 4932
371 5LZA 11 k 30S ribosomal protein S11 562
372 5LZB 11 k 30S ribosomal protein S11 562
373 5LZC 11 k 30S ribosomal protein S11 562
374 5LZD 11 k 30S ribosomal protein S11 562
375 5LZE 11 k 30S ribosomal protein S11 562
376 5LZF 11 k 30S ribosomal protein S11 562
377 5TCU 10 S2 30S ribosomal protein S11 1280
378 5T7V 3 S2 30S ribosomal protein S11 1280
379 5T2A 63 AH uS11 5661
380 5T2C 80 AO 40S ribosomal protein S14 9606
381 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
382 5LMO 11 K 30S ribosomal protein S11 274
383 5LMP 11 K 30S ribosomal protein S11 274
384 5LMQ 11 K 30S ribosomal protein S11 274
385 5LMR 11 K 30S ribosomal protein S11 274
386 5LMS 11 K 30S ribosomal protein S11 274
387 5LMT 11 K 30S ribosomal protein S11 274
388 5LMU 11 K 30S ribosomal protein S11 274
389 5LMV 11 K 30S ribosomal protein S11 274
390 5LL6 12 Z 40S ribosomal protein S14-A 4932
391 5LKS 74 SO 40S ribosomal protein S14 9606
392 5LI0 11 k 30S ribosomal protein S11 1280
393 5KPS 42 16 30S ribosomal protein S11 562
394 5KPV 41 15 30S ribosomal protein S11 562
395 5KPW 41 15 30S ribosomal protein S11 562
396 5KPX 41 15 30S ribosomal protein S11 562
397 5KCR 43 1k 30S ribosomal protein S11 562
398 5KCS 45 1k 30S ribosomal protein S11 562
399 5L3P 42 k 30S ribosomal protein S11 562
400 5K0Y 32 j ribosomal protein uS11 9986
401 5JU8 11 AK 30S ribosomal protein S11 562
402 5JUO 64 LB uS11 (yeast S14) 4932
403 5JUP 64 LB uS11 (yeast S14) 4932
404 5JUS 64 LB uS11 (yeast S14) 4932
405 5JUT 64 LB uS11 (yeast S14) 4932
406 5JUU 64 LB uS11 (yeast S14) 4932
407 5JTE 11 AK 30S ribosomal protein S11 562
408 5JPQ 29 w uS11 209285
409 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
410 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
411 5IT7 62 O 40S ribosomal protein S14 28985
412 5IT9 15 O Ribosomal protein uS14 28985
413 5IQR 41 p 30S ribosomal protein S11 562
414 5IMQ 18 O 30S ribosomal protein S11 274
415 5IMR 11 O 30S ribosomal protein S11 274
416 3JCN 42 l 30S ribosomal protein S11 562
417 3JCJ 47 q 30S ribosomal protein S11 562
418 3JCD 10 k 30S ribosomal protein S11 562
419 3JCE 10 k 30S ribosomal protein S11 562
420 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
421 3JBU 10 K 30S ribosomal protein S11 8333
422 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 8333
423 3JBN 26 P 40S ribosomal protein uS11 5833
424 3JBO 32 P 40S ribosomal protein uS11 5833
425 3JBP 26 P 40S ribosomal protein uS11 5833
426 5A9Z 44 BO 30S ribosomal protein S11 274
427 5AA0 44 BO 30S ribosomal protein S11 274
428 3JAP 18 O uS11 28985
429 3JAQ 18 O uS11 28985
430 3JAM 16 O uS11 28985
431 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
432 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
433 3JAG 66 OO uS11 9986
434 3JAH 66 OO uS11 9986
435 3JAI 66 OO uS11 9986
436 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
437 3JA1 11 SK 30S ribosomal protein S11 562
438 3J9Z 5 SK 30S ribosomal protein S11 562
439 3J9Y 7 k 30S ribosomal protein S11 562
440 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
441 3J9W 11 AK 30S ribosomal protein uS11 1423
442 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
443 5AJ0 64 BO 40S ribosomal protein S14 9606
444 5AFI 11 k 30S ribosomal protein S11 562
445 4UER 21 K US11 4934
446 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
447 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
448 4V3P 9 SK 40S ribosomal protein S14 4565
449 3J81 16 O uS11 28985
450 3J80 12 O uS11 28985
451 3J7P 64 SO Ribosomal protein uS11 9823
452 3J7R 65 SO Ribosomal protein uS11 9823
453 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
454 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
455 3J7A 16 P 40S ribosomal protein uS11 5833
456 3J77 60 14 40S ribosomal protein S14 4932
457 3J78 60 14 40S ribosomal protein S14 4932
458 3J6X 61 14 40S ribosomal protein S14 4932
459 3J6Y 61 14 40S ribosomal protein S14 4932
460 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
461 4V92 17 BO US11 28985
462 4V7E 16 BO 40S ribosomal protein S11 4565
463 4V7D 45 BK 30S ribosomal protein S11 562
464 4V7C 11 AK 30S ribosomal protein S11 562
465 4V7B 11 AK 30S ribosomal protein S11 562
466 4V6Y 10 AK 30S ribosomal protein S11 562
467 4V6Z 10 AK 30S ribosomal protein S11 562
468 4V70 10 AK 30S ribosomal protein S11 562
469 4V71 10 AK 30S ribosomal protein S11 562
470 4V72 10 AK 30S ribosomal protein S11 562
471 4V73 10 AK 30S ribosomal protein S11 562
472 4V74 10 AK 30S ribosomal protein S11 562
473 4V75 10 AK 30S ribosomal protein S11 562
474 4V76 10 AK 30S ribosomal protein S11 562
475 4V77 10 AK 30S ribosomal protein S11 562
476 4V78 10 AK 30S ribosomal protein S11 562
477 4V79 10 AK 30S ribosomal protein S11 562
478 4V7A 10 AK 30S ribosomal protein S11 562
479 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
480 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
481 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
482 4V6W 5 AO 40S ribosomal protein S14 7227
483 4V6X 5 AO 40S ribosomal protein S14 9606
484 4V6V 2 AK 30S ribosomal protein S11 562
485 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
486 4V6U 14 AM 30S ribosomal protein S11P 2261
487 4V6T 11 AK 30S ribosomal protein S11 562
488 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
489 4V6S 47 BM 30S ribosomal protein S11 562
490 4V6P 14 AN 30S ribosomal protein S11 562
491 4V6Q 14 AN 30S ribosomal protein S11 562
492 4V6R 14 AN 30S ribosomal protein S11 562
493 4V6N 48 BN 30S ribosomal protein S11 562
494 4V6O 14 AN 30S ribosomal protein S11 562
495 3J0O 12 K Ribosomal protein S14 9986
496 3J0L 12 K Ribosomal protein S14 9986
497 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
498 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
499 4V6M 15 AK 30S ribosomal protein S11 562
500 4V6K 47 BO 30S ribosomal protein S11 562
501 4V6L 14 AO 30S ribosomal protein S11 562
502 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
503 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
504 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
505 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
506 4V7I 46 BK 30S ribosomal protein S11 562
507 4V7H 10 AK 40S ribosomal protein S14(A) 5541
508 3IY8 6 K 30S ribosomal protein S11 562
509 4V68 7 AK 30S ribosomal protein S11 274
510 4V69 2 AK 30S ribosomal protein S11 562
511 4V65 5 AC 30S ribosomal protein S11 562
512 4V66 5 AC 30S ribosomal protein S11 562
513 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
514 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
515 4V4V 12 AK 30S ribosomal subunit protein S11 562
516 4V4W 12 AK 30S ribosomal subunit protein S11 562
517 1X18 7 G 30S ribosomal protein S11 274
518 4V4B 11 AK 40S ribosomal protein S14-A 4932
519 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
520 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
521 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
522 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
523 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
524 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
525 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274