Sequence Similarity Clusters for the Entities in PDB 4EIZ

Entity #1 | Chains: A,B
Dihydrofolate reductase protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 56 79 350
95 % 80 107 285 Flexibility: Low
Max RMSD: 3.1, Avg RMSD: 0.9
PDBFlex
90 % 80 107 295
70 % 84 112 329
50 % 87 115 369
40 % 123 211 168
30 % 251 380 108
Entity #2 | Chains: C,D
Nb113 Camel antibody fragment protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 25564
95 % 2 2 22713 Flexibility: Low
Max RMSD: 0.7, Avg RMSD: 0.6
PDBFlex
90 % 2 2 21975
70 % 180 470 8
50 % 252 702 6
40 % 1820 6322 1
30 % 2218 7862 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 5E7B 1 A nanobody nano-L06 9838
4 2P45 2 B ANTIBODY CAB-RN05 9838
5 2X1Q 1 A, B GELSOLIN NANOBODY 9844
6 5U64 1 B VHH-28 9838
7 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
8 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
9 4B41 1 A, B ANTIBODY G7 9844
10 5IMM 1 B Nanobody 9835
11 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
12 5NLU 1 A single domain llama antibody Nb36 9844
13 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
14 5IMK 1 B Nanobody 9835
15 6CWK 1 A Anti-Ricin antibody 30538
16 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
17 4B50 1 A 2H10 LLAMA VHH 9844
18 6DBA 1 A, B nanobody VHH R303 9838
19 2XT1 2 B CAMELID VHH 9 30538
20 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
21 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
22 5J1S 3 C VHH domain BS-2 30538
23 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
24 5J1T 3 C VHH domain BS-2 30538
25 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
26 2X1O 1 A, B GELSOLIN NANOBODY 9844
27 4QGY 1 A, B nanobody n25, VH domain 9844
28 5C2B 1 H scFv 3B4 heavy chain 9606
29 5VNV 1 A Nb.b201 32630
30 5DXW 1 A PD-L1 nanobody 9835
31 4N9O 2 B Nanobody Nb484 Nb484 9844
32 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
33 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
34 1T2J 1 A M12-Variable Heavy domain 9606
35 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
36 6DBF 2 B InlB specific VHH R303 9838
37 6DBG 2 C, D VHH R303 9838
38 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
39 5VM6 1 A single domain camelid nanobody VHH T10 9844
40 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
41 4KML 2 B Nanobody 9844
42 4Z9K 2 B VHH2(F5) antibody 30538
43 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
44 5LMW 1 A Nanobody 9844
45 5NM0 1 A, B, C, D Nb36 9844
46 6H6Y 2 E, F, G, H Nanobody (VHH) Nano-7 30538
47 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
48 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
49 4PPT 1 A Engineered single domain VHH antibody 9844
50 3R0M 1 A, B Llama VHH A12 9844
51 3ZKQ 2 D XA4813 9844
52 4I13 2 B Protein ca1697 (nanobody) 9844
53 5C2U 1 B Nanobody Nanobody 9838
54 1XFP 1 A heavy chain antibody VHH domain 9838
55 4POY 1 A VHH-metal 9844
56 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
57 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
58 5NLW 1 A nanobody Nb36 9844
59 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
60 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
61 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
62 3G9A 2 B Minimizer 9838
63 2P43 2 B ANTIBODY CAB-RN05 9838
64 4KRN 1 A Nanobody/VHH domain EgA1 9844
65 4GFT 2 B Nanobody 9844
66 4TVS 2 a, b VHH Domain BS-1 30538
67 4W6Y 2 B Nanobody NbFedF9 9844
68 6EZW 1 B VHH antibody BCD090-M2 9844
69 1UAC 2 H Ig VH,anti-lysozyme 10090
70 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
71 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
72 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
73 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
74 5O02 2 C Nanobody (VHH) Nano-4 30538
75 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
76 4X7F 2 C, D Nano-25 Nanobody 30538
77 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
78 4LGR 2 B Camelid nanobody (VHH3) 30538
79 5J57 2 B VHH single chain antibody V5E1 30538
80 6BA5 2 B, D, F, H Variable domain Heavy chain, antibody R11 9606
81 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
82 5OMM 2 C Nanobody (VHH) Nano-14 30538
83 5E03 1 A CTLA-4 nanobody 9835
84 5LZ0 1 A, B PorM nanobody 9844
85 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
86 6DBE 1 A, B nanobody VHH R303 9844
87 2XXC 1 B CAMELID VHH 9 30538
88 3QYC 1 A, B VH domain of IgG molecule 9606
89 5VAK 2 B Nb914 Nanobody 9844
90 2XXM 2 B CAMELID VHH 9 30538
91 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
92 6DBD 1 A, B, C, D nanobody VHH R326 9844
93 5JDS 1 B Nanobody 9835
94 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
95 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
96 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
97 5L21 2 B VHH-C2 30538
98 5FWO 1 A NANOBODY 9844
99 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
100 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
101 3B9V 1 A, B, C, D heavy chain variable domain 9606
102 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
103 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
104 5N88 1 A, H VH59 antibody 9606
105 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
106 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
107 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
108 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
109 4POU 2 B VHH Antibody 9844
110 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
111 6J5D 2 H antibody heavy chain 10090
112 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
113 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
114 6H70 2 C, D Nanobody (VHH) Nano-62 30538
115 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
116 2P42 2 B, D ANTIBODY CAB-RN05 9838
117 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
118 4QLR 1 A, B Llama nanobody n02 VH domain 9844
119 5J56 2 B VHH single chain antibody V1C7 30538
120 6J5F 2 H antibody heavy chain 10090
121 4NBX 2 B A20.1 VHH 9844
122 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
123 4HEP 2 G vHH17 domain 9844
124 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
125 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
126 5IML 2 B Nanobody 9835
127 3A6C 2 H IG VH, anti-lysozyme 10090
128 2DQD 2 H Ig VH,anti-lysozyme 10090
129 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
130 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
131 3A67 2 H IG VH, anti-lysozyme 10090
132 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
133 1J1X 2 H Ig VH,anti-lysozyme 10090
134 5M2J 2 D Anti-(ED-B) scFV 9606
135 2DQC 2 H Ig VH,anti-lysozyme 10090
136 1J1O 2 H Ig VH,anti-lysozyme 10090
137 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
138 4M62 2 H, I GEP2 FV heavy chain 9606
139 5IVO 1 A BC2-nanobody 30538
140 1J1P 2 H Ig VH,anti-lysozyme 10090
141 4NBZ 2 B, D A26.8 VHH 9844
142 5AYU 2 H Ig VH,anti-lysozyme 10090
143 3A6B 2 H IG VH, anti-lysozyme 10090
144 2DQJ 2 H Ig VH,anti-lysozyme 10090
145 5F21 2 B nanobody MU375 9844
146 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
147 2P44 2 B ANTIBODY CAB-RN05 9838
148 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
149 5TP3 1 A, B F-VHH-4 9844
150 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
151 4LHJ 2 B Camelid antibody 30538
152 4BEL 2 D, E XA4813 9844
153 5M7Q 1 A, B Nanobody NbD2 9838
154 5H8D 1 A VHH nanobody 9844
155 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
156 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
157 3DUR 2 B, D Ig-like protein 10090
158 2XV6 2 B, D CAMELID VHH 9 30538
159 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
160 5VM0 1 A, B Camelid Nanobody VHH T9 9844
161 4ZG1 1 A, B, C, D, E, F NB17 9844
162 6BAN 2 B, D, F, H Variable domain R11 Heavy chain 9606
163 4I1N 2 B Protein ca1697 (nanobody) 9844
164 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
165 6F0D 1 A, B VHH antibody BCD090-M2 9844
166 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
167 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
168 4W6X 2 B Nanobody NbFedF7 9844
169 5JA9 2 A, B Nanobody 6 9844
170 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
171 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
172 1OP9 1 A HL6 camel VHH fragment 9838
173 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
174 4LRN 1 H GEP 1 heavy chain 9606
175 4S11 1 A GELSOLIN NANOBODY 9844
176 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
177 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
178 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
179 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
180 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
181 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
182 4Y7M 1 A, B Hi113 protein 9844
183 5JMO 2 C, D camelid VHH fragment 9838
184 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
185 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
186 4B5E 1 A, B PS2-8 9844
187 2DQE 2 H Ig VH,anti-lysozyme 10090
188 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
189 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
190 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
191 4X7C 2 C, D Nano-85 Nanobody VHH 30538
192 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
193 3EBA 1 A CAbHul6 9838
194 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
195 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
196 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
197 5VM4 1 A, B, C, D, E, F, G, H, I, J, K, L Single domain camelid nanobody VHH T10 9844
198 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
199 4I0C 2 C, D cAbHuL5 antibody 9838
200 6H1F 1 A gelsolin nanobody, Nb11 9844
201 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
202 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
203 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
204 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
205 5BOP 1 A, C Nanobody 9844
206 4DKA 1 A, B single domain antibody VHH 9844
207 5O05 1 C, D Nanobody (VHH) Nano-42 30538
208 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
209 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
210 3DUU 2 B, D Ig-like protein 10090
211 3K74 2 B Nanobody 9844
212 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
213 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
214 6A3W 1 A, D, G, J utomilumab VH 9606
215 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
216 1SJV 1 A r9 llama VHH single domain antibody 9844
217 6CK8 1 A, B, C Llama antibody SD38 9844
218 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
219 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
220 6GZP 1 A Nanobody 9844
221 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
222 6H6Z 2 C, D Nanobody (VHH) Nano-62 30538
223 1UA6 2 H Ig VH,anti-lysozyme 10090
224 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
225 4W68 1 A, B Single domain antibody 9844
226 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
227 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
228 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
229 3EAK 1 A, B NbBCII10-FGLA 9838
230 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
231 4ORZ 3 C single domain antibody sdAb19 9844
232 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
233 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
234 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
235 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
236 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
237 5C1M 2 B Nanobody 39 9844
238 5F7K 2 C, D Nanobody Nb-ER19 9844
239 5LMJ 1 A, B, C, D nanobody 9844
240 5E1H 2 B F8(JOB10) VHH antibody 30538
241 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
242 4OCM 3 C, F Nb1 9844
243 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
244 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
245 4X7E 2 C, D Nano-85 Nanobody 30538
246 5F1O 2 B nanobody MU551 9844
247 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
248 5O03 2 C, D Nanobody (VHH) Nano-32 9844
249 2DQI 2 H Ig VH,anti-lysozyme 10090
250 4Y8D 2 C, D nanobody 9844
251 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
252 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
253 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
254 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
255 4C58 2 B nanobody 9844
256 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
257 3DV6 2 B Ig-like protein 10090
258 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
259 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
260 5VXM 2 B Single-domain antibody 20ipaD 30538
261 4XVJ 2 H antibody heavy chain variable domain 9606
262 4IDL 1 A Single Domain Antibody VHH A9 9844
263 1JV5 2 B Ig chain heavy chain precursor V region 9606
264 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
265 3K7U 1 A Antibody 9844
266 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
267 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
268 4NBY 2 B, C A20.1 VHH 9844
269 4X7D 2 C, D Nano-85 Nanobody VHH 9844
270 5VAN 2 B Nb914 Nanobody 9844
271 5F7N 2 C, D Nanobody Nb-ER19 30538
272 5OCL 1 A, C, F, H anti-llama nanobody 30538
273 5OCL 2 B, D, E, G anti-vglut nanobody 9844
274 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
275 2A9M 2 H, I fluorescein-scfv heavy chain 9606
276 5E5M 2 B, D, F, H CTLA-4 nanobody 9835
277 1SJX 1 A immunoglobulin VH domain 9844
278 3ZKS 2 D XA4813 9844
279 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
280 6H72 2 C, D Nanobody (VHH) Nano-94 30538
281 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
282 5MY6 2 B Nanobody 2Rs15d 9838
283 3DUS 2 B, D Ig-like protein 10090
284 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
285 6F5G 2 B VHH minibody anti-Cter PCSK9 VHH from immunization of Llama from E. coli expression 9844
286 5M2I 2 G, H, I, J, K, L VHH1 9844
287 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
288 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
289 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
290 3K1K 2 C, D Enhancer 9838
291 4U7S 1 A, B sdAb A3 9844
292 4U3X 1 A, C Human VH domain antibody 9606
293 4W81 1 A Single Domain Antibody 9844
294 5GRV 1 L homo-specific diabody heavy chain 9606
295 5JMR 1 A, B camelid VHH fragment 9838
296 4W70 1 A Single Domain Antibody 9844
297 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
298 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
299 4BFB 2 D, E XA4813 9844
300 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
301 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
302 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
303 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
304 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
305 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
306 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
307 4LHQ 2 B, D Camelid nanobody 30538
308 3DV4 2 B Ig-like protein 10090
309 6H71 2 C, D Nanobody (VHH) Nano-94 30538
310 3ZKX 2 B XA4813 9844
311 3ZKX 3 C XA4815 9844
312 5F1K 2 C, D nanobody MU1053 9844
313 6A78 3 H, I Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv 10090
314 3ZLQ 2 C, D XA4813 9844
315 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
316 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
317 4NC0 2 B A26.8 VHH 9844
318 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
319 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
320 5GS1 2 B, N, P, R heavy chain 9606
321 5F7Y 3 C, D Nanobody Nb-ER19 9844
322 2DQG 2 H Ig VH,anti-lysozyme 10090
323 5IMO 1 B Nanobody 9835
324 5U65 1 A, B VHH-5 9838
325 4TYU 1 A, B Single Domain Antibody 9844
326 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
327 2DQH 2 H Ig VH,anti-lysozyme 10090
328 4AQ1 2 B, D NBKB6 VHH 9844
329 6FV0 2 F nanobody 9844
330 4EIG 2 B CA1698 camel antibody fragment 9844
331 3EHB 3 C FV fragment Chain H 10090
332 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
333 3HB3 3 C ANTIBODY FV FRAGMENT 10090
334 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
335 2X89 1 A, B, C ANTIBODY 9838
336 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
337 5O04 2 E, F Nanobody (VHH) Nano-26 30538
338 5O04 3 C, D Nanobody (VHH) Nano-85 30538
339 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
340 3P9W 2 B, D, F, H human VEGF 9606
341 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
342 5F8R 2 C, D Nanobody Nb-ER19 9844
343 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
344 4OCL 3 C, F Nb1 9844
345 4RAV 2 A, C single-chain Fv, VH 9606
346 5XJ4 2 H durvalumab-VH 9606
347 5LWY 2 H V REGION HEAVY CHAIN 10090
348 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
349 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
350 4IOS 2 D, E, F, G Llama nanobody 11 9844
351 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
352 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
353 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
354 4C57 2 C, D NANOBODY 9844
355 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
356 4OCN 3 C, F Nb1 9844
357 4GRW 3 E, G Nanobody 124C4 9844
358 4GRW 4 F, J Nanobody 37D5 9844
359 4GRW 5 H, I Nanobody 22E11 9844
360 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
361 4NC2 2 B B39 VHH 9844
362 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
363 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
364 6IVZ 2 H Heavy chain of monoclonal antibody 5A 9606
365 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
366 6EY0 2 E, G, H llama nanobody nb01 9844
367 6EY0 3 F llama nanobody nb01 9844
368 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
369 5F9A 2 C Nanobody Nb-ER19 9844
370 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
371 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
372 5CBA 1 A, C 3b4 heavy chain 9606
373 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
374 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
375 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
376 2OTW 2 B, D Fv heavy chain variable domain VH 10090
377 3STB 1 A, B single domain antibody VHH 9844
378 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
379 4W6W 2 B NbFedF6 9844
380 5JA8 2 B, D, F, H Nanobody 2 9844
381 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
382 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
383 1P4B 2 H Antibody Variable heavy chain 10090
384 5U4M 2 B V1C7 VHH antibody 30538
385 5O0W 2 E, F, G, H Nb474 30538
386 4Y5V 1 A, D, G diabody 305 VH domain 9606
387 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
388 6MTJ 2 D 35O22 scFv heavy chain portion 9606
389 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
390 3V0A 3 C Llama antibody F12 9844
391 6FYU 3 C, F, I Single domain antibody SD36 9844
392 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
393 3K80 1 A, B Antibody 9844
394 5VAQ 2 B Nb914 Nanobody 9844
395 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
396 5F8Q 2 C, D Nanobody Nb-ER19 9844
397 4U05 1 A, B Single Domain Antibody 9844
398 5F9D 2 C Nanobody Nb-ER19 9844
399 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
400 4LGP 2 B, D VHH1 camelid nanobody 30538
401 2P48 2 B ANTIBODY CAB-RN05 9838
402 5U4L 2 B V1C7 VHH antibody G29R variant 30538
403 5VXK 1 B single-domain antibody JMK-H2 30538
404 5F7M 2 C, D Nanobody Nb-ER19 9844
405 5NBL 3 E, F nAct-Nanobody N-actin and Arp4 specific nanobody with a C-terminal double Strep-Tag. 30538
406 6H15 2 C, D VHH L-P2-B10 9844
407 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
408 5F7W 2 C, D Nanobody Nb-ER19 9844
409 4YQX 1 H, N JES6-1 VH domain 10116
410 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
411 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
412 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
413 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
414 4NC1 2 C, D A20.1 VHH 9844
415 4NC1 3 E, F A26.8 VHH 9844
416 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
417 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
418 2DQF 2 B, E Ig VH,anti-lysozyme 10090
419 5E7F 1 A, B, C nanobody L06 9838
420 2P46 2 B, D ANTIBODY CAB-RN05 9838
421 6MTN 2 D 35O22 scFv heavy chain portion 9606
422 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
423 6MU7 2 D 35O22 scFv heavy chain portion 9606
424 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
425 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
426 5LHP 2 B Camelid-Derived Antibody Fragment 30538
427 6J7W 1 A, B UniAb Heavy chain Antibody 9606
428 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
429 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
430 5SV4 1 A, B Single Domain Antibody A3C8 9844
431 4LGS 2 B Camelid nanobody (VHH4) 30538
432 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
433 5Y80 2 B NANOBODY 9844
434 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
435 5CBE 1 A, C E10 heavy chain 9606
436 2P47 2 B ANTIBODY CAB-RN05 9838
437 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
438 3WXW 2 H V region heavy chain 10090
439 3K3Q 1 A llama Aa1 VHH domain 9844
440 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
441 1AR1 3 C ANTIBODY FV FRAGMENT 10090
442 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
443 5VNW 2 C, D Nb.b201 32630
444 1BVK 2 B, E HULYS11 FV 9606
445 6FE4 2 F, G, H, I, J Nb113 30538
446 6GS4 2 H nanobody 9839
447 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
448 6MU6 2 D 35O22 scFv heavy chain portion 9606
449 6A79 3 H, I Heavy chain of the anti-human Robo1 antibody B5209B scFv 10090
450 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
451 6CWG 2 B, D VHH antibody 30538
452 5HVF 2 B VHH-i83 30538
453 1P4I 2 H antibody variable heavy chain 10090
454 4PGJ 1 A, C Human heavy chain domain antibody 9606
455 4KDT 1 A, B Nanobody24 9835
456 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
457 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
458 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
459 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
460 6FYT 3 I Single domain antibody SD38 9844
461 5MJE 2 B Nanobody 8 9844
462 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
463 3OGO 2 E, F, G, H GFP-nanobody 9838
464 4C59 2 B NANOBODY 9844
465 5VXL 2 B single-domain antibody JPS-G3 30538
466 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
467 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
468 4DK6 1 A, B single domain antibody VHH 9844
469 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
470 5F7L 2 B, D Nanobody Nb-ER14 9844
471 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
472 5HVG 2 B, D VHH-a204 30538
473 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
474 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
475 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
476 5HVH 2 B VHH-a204 30538
477 5HVH 3 C VHH-i83 30538
478 4XT1 3 C nanobody 7 30538
479 5LXG 2 H V REGION HEAVY CHAIN 10090
480 5HM1 1 A, B, C lama VHH antibody 2E7 9844
481 5NBM 3 E, F nAct-Nanobody N-actin and Arp4 binding nanobody with a C-terminal double Strep-Tag. 30538
482 5FUC 3 E, V VHH6 9838
483 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
484 3H3P 1 H, I Fv 4E10 heavy chain 9606
485 5O2U 2 B, D VHH 59H10 9844
486 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
487 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
488 5OMN 2 C Nanobody (VHH) Nano-27 30538
489 4KRP 2 B Nanobody/VHH domain 9G8 9844
490 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
491 6FUZ 2 N nanobody 9844
492 4FHB 2 D Nb179 9844
493 4DK3 1 A, B single domain antibody VHH 9844
494 4KRL 1 B Nanobody/VHH domain 7D12 9844
495 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
496 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
497 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
498 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
499 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
500 6H16 2 B VHH L-P2-D07 9844
501 6MXT 2 N nanobody Nb71 9844
502 4LDE 2 B Camelid Antibody Fragment 9844
503 4Y5Y 1 A, D diabody 330 VH domain 9606
504 6IBL 2 C, D Camelid antibody fragment Nb80 9844
505 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
506 1BVL 1 A, C HULYS11 FV 10090
507 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
508 3RJQ 2 B Llama VHH A12 9844
509 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
510 6CF2 1 A Anti-Rev Antibody, heavy chain Fab single-chain variable fragment 9986
511 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
512 3LHP 1 H, I Fv 4E10 heavy chain 9606
513 5Y7Z 2 C, D NANOBODY 9844
514 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
515 6CK9 2 D 35O22 scFv heavy chain portion 9606
516 6EQI 2 B Nb696 9844
517 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
518 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
519 4KFZ 2 C, D Anti-LMO2 VH 9606
520 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
521 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
522 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
523 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
524 4YGA 2 B, D, F, H VHH-1B7 30538
525 6MU8 2 D 35O22 scFv heavy chain portion 9606
526 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
527 2A9N 2 H, I fluorescein-scfv heavy chain 9606
528 5GS0 3 D, F heavy chain (anti-TLR3) 10090
529 5GS0 4 H, X heavy chain (anti-Lid) 10090
530 5YY5 2 H Heavy chain 9606
531 5YY5 4 C Heavy chain 9606
532 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
533 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
534 5GRJ 1 H avelumab H chain 9606
535 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
536 6MUG 2 D 35O22 scFv heavy chain portion 9606
537 6IW2 2 B, E, H, K, N, Q Heavy chain of monoclonal antibody 5A 9606
538 6N4Y 2 E, F, G, H Nanobody 43 Nanobody 43 9844
539 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
540 4KRO 2 B Nanobody/VHH domain EgA1 9844
541 3WXV 2 H V region heavy chain 10090
542 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
543 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
544 5TJW 2 K NP-specific inhibitory VHH 30538
545 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
546 6H7M 3 C, D Camelid antibody fragment Nb6B9 562
547 6J5G 2 H antibody heavy chain 10090
548 4LDL 2 B Camelid Antibody Fragment 9844
549 6GS7 2 H nanobody 9839
550 6MUF 2 D 35O22 scFv heavy chain portion 9606
551 4LDO 2 B Camelid Antibody Fragment 9844
552 5XJ3 1 A, D, G, J ipilimumab-VH 9606
553 3SN6 5 N Camelid antibody VHH fragment 9844
554 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
555 4M8Q 1 A, H GEP1 Fv heavy chain 9606
556 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
557 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
558 5O8F 2 K, O Nanobody Nb25 9844
559 5O8F 3 L, M, N Nanobody Nb25 9844
560 5NQW 2 C, D 026 9844
561 5C3L 4 D Nanobody Nb15 Nanobody 9838
562 5J3H 2 C mAb 83-7 Fab heavy chain 10090
563 5U8R 2 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
564 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
565 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
566 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
567 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
568 6H7J 3 C, D Camelid antibody fragment Nb80 9844
569 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
570 6B73 2 C, D Nanobody 9844
571 4PIR 2 F, G, H, I, J VHH15 9844
572 5XWD 2 H VH chain of 059-152 9606
573 6C5W 2 C, E nanobody 32644
574 4QKX 2 B R9 protein 9844
575 5JQH 2 C, D Nanobody60, Nb60 9844
576 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
577 4PD4 10 J Igh protein 10090
578 6C9W 2 B Nanobody9047 Full 9844
579 6GS1 2 H Nanobody 00 9844
580 5DA0 2 B Nanobody 9844
581 6GCI 2 B Nanobody Nanobody selected against the BKA-inhibited ADP/ATP carrier 9844
582 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
583 5U8Q 3 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
584 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
585 4ODX 2 A, H GEP7 Fv heavy chain 9606
586 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
587 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
588 1RVF 6 H FAB 17-IA 10090
589 6DO1 2 C, D, E, F Nanobody Nb.AT110i1 32630
590 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
591 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
592 4MQS 2 B Nanobody 9-8 9844
593 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
594 5WB2 3 D nanobody B1 32630
595 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
596 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
597 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
598 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
599 4MQT 2 B Nanobody 9-8 9844
600 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
601 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
602 6CNV 3 C SD84h 32630
603 6IW0 2 H Heavy chain of monoclonal antibody 5A 9606
604 6N50 2 E Nanobody 43 9844
605 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
606 4NKO 2 B, D, F Engineered scFv heavy chain 10090
607 5EUL 4 V AYC08 30538
608 5GXB 2 B nanobody 30538
609 5NBD 2 C Nanobody 9844
610 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
611 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
612 5H8O 1 A VHH nanobody 9844
613 4KSD 2 B R2 protein 9844
614 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
615 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
616 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
617 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
618 5WDU 2 D, O, W bnAb NIH45-46 scFv heavy chain 9606
619 5TD8 5 E nanobody 30538
620 6NN3 2 H Fab monoclonal antibody 860-55D, heavy chain 9606
621 6NIY 2 N Nanobody35 9844
622 6IYN 1 A Nb26 30538
623 6NB3 3 D, H LCA60 heavy chain 9606
624 6NB4 2 H LCA60 heavy chain 9606
625 6NB6 2 H, I S230 heavy chain 9606
626 6NB7 2 D, G, H S230 heavy chain 9606
627 6N51 2 C, D Nanobody 43 9844
628 6I53 4 G Megabody38 9844
629 6MID 3 H monoclonal antibody ZIKV-195 heavy chain Fab variable domain 9606
630 6AJ7 2 H VH of Fab 15C5 10090
631 6AJ9 2 D VH of Fab 11G1 10090
632 6AJ9 4 H VH of Fab 15C5 10090
633 6AD0 2 H VH of Fab 2G8 10090
634 6E3Y 2 N Nanobody 35 9844
635 6A96 1 K, L, O Nb25 9844
636 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
637 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
638 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
639 6CUE 3 3, H, h vFP7.04 Heavy chain 10090
640 6CUE 5 5, M, m PGT122 heavy Chain 9606
641 6CUE 7 7, Q, q VRC03 Heavy chain 9606
642 6CUF 3 5, M, m PGT122 Heavy chain 9606
643 6CUF 6 8, Q, q VRC03 heavy chain 9606
644 6CDI 4 5, M, m PGT122 Heavy Chain 9606
645 6BSP 1 A U4 Heavy chain 10090
646 6B3J 6 N Nanobody 35 9844
647 6EHG 3 C hC3Nb1 9844
648 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
649 5XS7 2 H Heavy chain of Fab 1D5 10090
650 5W3L 5 E C5 antibody variable heavy domain 10090
651 5W3M 1 E C5 antibody variable heavy domain 10090
652 5W3O 1 D C5 antibody variable heavy domain 10090
653 5W3E 1 E C5 antibody variable heavy domain 10090
654 5VAI 6 N nanobody 35 9844
655 5UZ7 4 N NANOBODY 35 9844
656 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
657 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
658 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
659 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
660 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
661 5H30 3 G, I, K IgG C10 heavy chain 9606
662 5KWL 4 7 VHH 10E 9838
663 5KTZ 4 7 VHH 12B 9838
664 5KU0 4 7 VHH 17B 9838
665 5KU2 4 7 VHH 7A 9838
666 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
667 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
668 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
669 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
670 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
671 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
672 3JCX 2 H Fab E heavy chain 10116
673 5FOJ 1 A NANOBODY 9838
674 3JBC 5 7 nanobody VHH PVSP29F 9838
675 3JBD 5 7 nanobody VHH PVSP6A 9838
676 3JBE 5 7 nanobody VHH PVSS8A 9838
677 3JBF 5 7 nanobody VHH PVSP19B 9838
678 3JBG 5 7 nanobody VHH PVSS21E 9838
679 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
680 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
681 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
682 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
683 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
684 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
685 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
686 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
687 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
688 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
689 3J6U 3 H Fab 5J7 heavy chain variable region 9606
690 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
691 3IY1 2 B Fab B, heavy chain 10116
692 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
693 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
694 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
695 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
696 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
697 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
698 3IY0 2 H Fab 14, heavy domain 10090
699 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
700 1G9E 1 A H14 9844
701 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
702 1VHP 1 A VH-P8 9606