Sequence Similarity Clusters for the Entities in PDB 4B3R

Entity #1 | Chains: A
16S RIBOSOMAL RNA rna, length: 1521 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
30S RIBOSOMAL PROTEIN S10 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 303 38
95 % 93 303 50 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 93 303 54
70 % 93 303 65
50 % 118 478 24
40 % 129 602 21
30 % 129 604 35
Entity #11 | Chains: K
30S RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 304 36
95 % 93 304 47 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 93 304 51
70 % 93 304 63
50 % 112 472 32
40 % 125 611 20
30 % 125 611 34
Entity #12 | Chains: L
30S RIBOSOMAL PROTEIN S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 80 274 47
95 % 93 311 38 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 93 311 42
70 % 112 486 15
50 % 112 489 22
40 % 112 489 38
30 % 112 489 57
Entity #13 | Chains: M
30S RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 305 33
95 % 93 305 43 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 93 305 48
70 % 93 305 59
50 % 113 476 30
40 % 113 476 41
30 % 124 608 37
Entity #14 | Chains: N
30S RIBOSOMAL PROTEIN S14 TYPE Z protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 303 37
95 % 93 303 49 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
PDBFlex
90 % 93 303 53
70 % 93 307 56
50 % 93 316 91
40 % 93 316 112
30 % 93 316 123
Entity #15 | Chains: O
30S RIBOSOMAL PROTEIN S15 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 309 27
95 % 96 312 37 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 96 312 41
70 % 96 312 52
50 % 118 484 25
40 % 118 489 37
30 % 118 489 56
Entity #16 | Chains: P
30S RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 299 39
95 % 93 304 45 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 93 304 49
70 % 93 304 61
50 % 93 314 93
40 % 113 474 43
30 % 113 474 61
Entity #17 | Chains: Q
30S RIBOSOMAL PROTEIN S17 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 29 1529
95 % 93 301 52 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.6
PDBFlex
90 % 93 301 56
70 % 93 301 67
50 % 93 301 96
40 % 93 301 117
30 % 93 301 130
Entity #18 | Chains: R
30S RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 246 52
95 % 84 254 66 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 84 254 70
70 % 84 254 83
50 % 84 254 114
40 % 84 254 136
30 % 84 254 146
Entity #19 | Chains: S
30S RIBOSOMAL PROTEIN S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 307 30
95 % 94 307 40 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 94 307 45
70 % 94 307 55
50 % 113 478 28
40 % 113 481 39
30 % 113 481 58
Entity #2 | Chains: B
30S RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 304 32
95 % 93 305 42 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.6
PDBFlex
90 % 93 305 47
70 % 93 305 58
50 % 112 462 35
40 % 112 468 47
30 % 112 468 65
Entity #20 | Chains: T
30S RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 87 261 50
95 % 93 303 51 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 93 303 55
70 % 93 303 66
50 % 93 303 95
40 % 93 303 116
30 % 93 303 127
Entity #21 | Chains: V
30S RIBOSOMAL PROTEIN THX protein, length: 26 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 294 44
95 % 93 294 53 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 93 294 58
70 % 93 294 72
50 % 93 294 99
40 % 93 294 121
30 % 93 294 132
Entity #22 | Chains: W
5'-R(*UP*UP*CP*AP*AP*AP)-3' rna, length: 6 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #23 | Chains: Z
5'-R(*GP*GP*GP*AP*UP*UP*GP*AP*AP*AP*AP*UP*CP*CP*CP-3' rna, length: 16 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #3 | Chains: C
30S RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 254 51
95 % 84 254 65 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 84 254 69
70 % 84 254 82
50 % 87 330 86
40 % 87 330 105
30 % 87 330 117
Entity #4 | Chains: D
30S RIBOSOMAL PROTEIN S4 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 305 31
95 % 93 305 41 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 93 305 46
70 % 93 305 57
50 % 112 472 29
40 % 112 478 40
30 % 112 478 59
Entity #5 | Chains: E
30S RIBOSOMAL PROTEIN S5 protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 304 35
95 % 93 304 46 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 93 304 50
70 % 93 304 62
50 % 113 473 31
40 % 113 473 42
30 % 113 475 60
Entity #6 | Chains: F
30S RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 309 28
95 % 100 315 36 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 0.9
PDBFlex
90 % 100 315 40
70 % 100 315 51
50 % 100 315 90
40 % 100 315 111
30 % 118 408 87
Entity #7 | Chains: G
30S RIBOSOMAL PROTEIN S7 protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 309 29
95 % 94 309 39 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
PDBFlex
90 % 94 309 43
70 % 94 309 53
50 % 112 411 53
40 % 112 417 64
30 % 112 417 79
Entity #8 | Chains: H
30S RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 304 34
95 % 94 304 44 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 94 308 44
70 % 94 308 54
50 % 115 477 27
40 % 128 624 19
30 % 128 624 33
Entity #9 | Chains: I
30S RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 96 235
95 % 93 304 48 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 93 304 52
70 % 93 304 64
50 % 112 466 33
40 % 112 467 48
30 % 123 606 36

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 6CFL 42 1k, 2k 30S ribosomal protein S11 274
8 6CAE 42 1k, 2k 30S ribosomal protein S11 274
9 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
10 5FDV 43 1k, 2k 30S ribosomal protein S11 274
11 5J4B 42 1k, 2k 30S ribosomal protein S11 274
12 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
13 6CFK 42 1k, 2k 30S ribosomal protein S11 274
14 5J7L 11 AK, BK 30S ribosomal protein S11 562
15 5W4K 42 1k, 2k 30S ribosomal protein S11 274
16 4LFB 11 K ribosomal protein S11 274
17 1VY4 11 AK, CK 30S ribosomal protein S11 274
18 4WOI 11 AK, DK 30S ribosomal protein S11 562
19 5FDU 42 1k, 2k 30S ribosomal protein S11 274
20 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
21 5JC9 11 AK, BK 30S ribosomal protein S11 562
22 1VY5 11 AK, CK 30S ribosomal protein S11 274
23 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
24 4WQF 44 BK, DK 30S ribosomal protein S11 274
25 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
26 4WPO 44 BK, DK 30S ribosomal protein S11 274
27 5J8A 11 AK, BK 30S ribosomal protein S11 562
28 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
29 4JI1 11 K RIBOSOMAL PROTEIN S11 274
30 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
31 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
32 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
33 5J5B 11 AK, BK 30S ribosomal protein S11 562
34 5HD1 42 1k, 2k 30S ribosomal protein S11 274
35 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
36 4DR6 11 K 30S ribosomal protein S11 274
37 4LF7 11 K ribosomal protein S11 274
38 4LF8 11 K ribosomal protein S11 274
39 5WIS 42 1k, 2k 30S ribosomal protein S11 274
40 4WSD 11 2A, 2I 30S ribosomal protein S11 274
41 4WQU 44 BK, DK 30S ribosomal protein S11 274
42 5WIT 42 1k, 2k 30S ribosomal protein S11 274
43 5E81 11 2A, 2I 30S ribosomal protein S11 274
44 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
45 6GSJ 11 2A, 2I 30S ribosomal protein S11 274
46 4U27 11 AK, CK 30S ribosomal protein S11 562
47 6CFJ 42 1k, 2k 30S ribosomal protein S11 274
48 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
49 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
50 5HCR 42 1k, 2k 30S ribosomal protein S11 274
51 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
52 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
53 4DV6 11 K ribosomal protein S11 274
54 4JYA 11 K 30S ribosomal protein S11 274
55 5IBB 11 2A, 2I 30S ribosomal protein S11 274
56 4DR5 11 K 30S ribosomal protein S11 274
57 5J4C 42 1k, 2k 30S ribosomal protein S11 274
58 4KHP 11 K 30S Ribosomal protein S11 274
59 4DR2 11 K 30S ribosomal protein S11 274
60 4WRO 15 2I 30S ribosomal protein S11 274
61 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
62 4LF9 11 K ribosomal protein S11 274
63 4WQY 44 BK, DK 30S ribosomal protein S11 274
64 4DUY 11 K ribosomal protein S11 274
65 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
66 4DV7 11 K ribosomal protein S11 274
67 4WRA 11 2A, 2I 30S ribosomal protein S11 274
68 5IB7 11 2A, 2I 30S ribosomal protein S11 274
69 4U26 11 AK, CK 30S ribosomal protein S11 562
70 4X64 11 K 30S ribosomal protein S11 274
71 5HCP 42 1k, 2k 30S ribosomal protein S11 274
72 5IT8 11 AK, BK 30S ribosomal protein S11 562
73 4V9D 11 AK, BK 30S ribosomal protein S11 562
74 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
75 4V9H 5 AK 30S ribosomal protein S11 274
76 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
77 5J91 11 AK, BK 30S ribosomal protein S11 562
78 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
79 5WNT 11 K RIBOSOMAL PROTEIN S11 274
80 4DR3 11 K 30S ribosomal protein S11 274
81 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
82 4JI3 11 K RIBOSOMAL PROTEIN S11 274
83 4WQR 11 2A, 2I 30S ribosomal protein S11 274
84 4JI6 11 K RIBOSOMAL PROTEIN S11 274
85 4JI8 11 K RIBOSOMAL PROTEIN S11 274
86 2UXC 11 K RIBOSOMAL PROTEIN S11 274
87 5IB8 11 2A, 2I 30S ribosomal protein S11 274
88 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
89 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
90 5EL6 11 2A, 2I 30S ribosomal protein S11 274
91 5EL7 11 2A, 2I 30S ribosomal protein S11 274
92 5VP2 42 1k, 2k 30S ribosomal protein S11 274
93 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
94 4LF4 11 K ribosomal protein S11 274
95 5DFE 45 QK, XK 30S ribosomal protein S11 274
96 5NDK 6 2A, 2I 30S ribosomal protein S11 274
97 4LF6 11 K ribosomal protein S11 274
98 4JI7 11 K RIBOSOMAL PROTEIN S11 274
99 5J88 11 AK, BK 30S ribosomal protein S11 562
100 4U24 11 AK, CK 30S ribosomal protein S11 562
101 4WU1 11 2A, 2I 30S ribosomal protein S11 274
102 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
103 5EL4 11 2A, 2I 30S ribosomal protein S11 274
104 5WNV 11 K 30S ribosomal protein S11 274
105 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
106 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
107 4WR6 11 2A, 2I 30S ribosomal protein S11 274
108 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
109 5HAU 44 1k, 2k 30S ribosomal protein S11 274
110 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
111 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
112 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
113 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
114 4WF1 11 AK, CK 30S ribosomal protein S11 562
115 4U25 11 AK, CK 30S ribosomal protein S11 562
116 4V95 11 AK, CK 30S Ribosomal Protein S11 274
117 4WWW 42 QK, XK 30S ribosomal protein S11 562
118 4V7T 11 AK, CK 30S ribosomal protein S11 562
119 1VY7 11 AK, CK 30S ribosomal protein S11 274
120 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
121 5E7K 11 2A, 2I 30S ribosomal protein S11 274
122 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
123 5EL5 11 2A, 2I 30S ribosomal protein S11 274
124 6FKR 42 1k, 2k 30S ribosomal protein S11 274
125 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
126 4LNT 11 QK, XK 30S ribosomal protein S11 274
127 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
128 4DR1 11 K 30S ribosomal protein S11 274
129 4LFA 11 K ribosomal protein S11 274
130 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
131 4DV4 11 K ribosomal protein S11 274
132 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
133 4YZV 11 QK, XK 30S ribosomal protein S11 274
134 4JI0 11 K ribosomal protein S11 274
135 5IWA 10 K 30S ribosomal protein S11 274
136 4V7U 11 AK, CK 30S ribosomal protein S11 562
137 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
138 4JI2 11 K RIBOSOMAL PROTEIN S11 274
139 4V6C 10 AK, CK 30S ribosomal protein S11 562
140 4JV5 11 K 30S ribosomal protein S11 274
141 4DR7 11 K 30S ribosomal protein S11 274
142 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
143 4GKK 11 K 30S ribosomal protein S11 274
144 4DUZ 11 K ribosomal protein S11 274
145 5NDJ 6 2A, 2I 30S ribosomal protein S11 274
146 4V7V 11 AK, CK 30S ribosomal protein S11 562
147 4X65 11 K 30S ribosomal protein S11 274
148 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
149 4GKJ 11 K 30S ribosomal protein S11 274
150 4DV3 11 K ribosomal protein S11 274
151 4V7S 11 AK, CK 30S ribosomal protein S11 562
152 4DV5 11 K ribosomal protein S11 274
153 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
154 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
155 4LFC 11 K ribosomal protein S11 274
156 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
157 3T1Y 11 K 30S ribosomal protein S11 274
158 4WZO 11 2A, 2I 30S ribosomal protein S11 274
159 4JI4 11 K RIBOSOMAL PROTEIN S11 274
160 1VY6 11 AK, CK 30S ribosomal protein S11 274
161 1XMQ 13 K 30S Ribosomal Protein S11 274
162 5WNP 11 K 30S ribosomal protein S11 274
163 6CAP 11 K 30S ribosomal protein S11 274
164 4U20 11 AK, CK 30S ribosomal protein S11 562
165 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
166 4DV0 11 K ribosomal protein S11 274
167 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
168 4U1V 11 AK, CK 30S ribosomal protein S11 562
169 4V6F 41 BN, CN 30S ribosomal protein S11 274
170 4X62 11 K 30S ribosomal protein S11 274
171 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
172 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
173 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
174 4DV2 11 K ribosomal protein S11 274
175 4DV1 11 K ribosomal protein S11 274
176 5WNU 11 K 30S ribosomal protein S11 274
177 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
178 5F8K 42 1k, 2k 30S ribosomal protein S11 274
179 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
180 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
181 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
182 4JI5 11 K RIBOSOMAL PROTEIN S11 274
183 6CAQ 11 K 30S ribosomal protein S11 274
184 4K0K 11 K 30S ribosomal protein S11 274
185 4W2E 44 k 30S ribosomal protein S11 274
186 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
187 5BR8 11 K 30S ribosomal protein S11 274
188 4LF5 11 K ribosomal protein S11 274
189 5J4D 45 TA, YC 30S ribosomal protein S11 274
190 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
191 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
192 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
193 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
194 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
195 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
196 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
197 4V7Y 11 AK, CK 30S ribosomal protein S11 274
198 6GSK 11 2A, 2I 30S ribosomal protein S11 274
199 4V9C 11 AK, CK 30S ribosomal protein S11 562
200 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
201 5J30 42 QK, XK 30S ribosomal protein S11 274
202 4DR4 11 K 30S ribosomal protein S11 274
203 4WZD 11 2A, 2I 30S ribosomal protein S11 274
204 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
205 4X66 11 K 30S ribosomal protein S11 274
206 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
207 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
208 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
209 4V85 11 AK 30S ribosomal protein S11 562
210 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
211 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
212 4W4G 11 QK, XK 30S ribosomal protein S11 274
213 4NXM 11 K ribosomal protein S11 274
214 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
215 4YPB 11 QK, XK 30S ribosomal protein S11 274
216 4V7X 11 AK, CK 30S ribosomal protein S11 274
217 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
218 4U1U 11 AK, CK 30S ribosomal protein S11 562
219 4ZER 42 1k, 2k 30S ribosomal protein S11 274
220 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
221 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
222 4V7W 11 AK, CK 30S ribosomal protein S11 274
223 4WT1 11 2A, 2I 30S ribosomal protein S11 274
224 6C5L 11 AK, CK 30S ribosomal protein S11 274
225 4WT8 11 AK, BK 30S ribosomal protein S11 274
226 5DOX 42 1k, 2k 30S ribosomal protein S11 274
227 4NXN 11 K ribosomal protein S11 274
228 1XNR 13 K 16S Ribosomal protein S11 274
229 4LT8 11 QK, XK 30S ribosomal protein S11 274
230 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
231 5WNQ 11 K 30S ribosomal protein S11 274
232 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
233 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
234 4V7L 11 AK, CK 30S ribosomal protein S11 274
235 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
236 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
237 1XNQ 13 K Ribosomal protein S11 274
238 4V8A 41 CK, DK 30S ribosomal protein S11 274
239 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
240 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
241 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
242 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
243 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
244 5J3C 42 QK, XK 30S ribosomal protein S11 274
245 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
246 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
247 4L47 11 QK, XK 30S ribosomal protein S11 274
248 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
249 5V8I 42 1k, 2k 30S ribosomal protein S11 274
250 4ZSN 11 QK, XK 30S ribosomal protein S11 274
251 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
252 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
253 4V7Z 11 AK, CK 30S ribosomal protein S11 274
254 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
255 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
256 4V9I 11 AK, CK 30S Ribosomal protein S11 274
257 1XMO 13 K 30S ribosomal protein S11 274
258 3T1H 11 K 30S ribosomal protein S11 274
259 2UXD 11 K RIBOSOMAL PROTEIN S11 274
260 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
261 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
262 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
263 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
264 4V97 11 AK, CK 30S ribosomal protein S11 274
265 6CAR 11 K 30S ribosomal protein S11 274
266 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
267 4V7M 11 AK, CK 30S ribosomal protein S11 274
268 4WSM 11 2A, 2I 30S ribosomal protein S11 274
269 4TUD 11 QK, XK 30S ribosomal protein S11 274
270 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
271 5WNR 11 K 30S ribosomal protein S11 274
272 6CAO 11 K 30S ribosomal protein S11 274
273 4V6A 11 AK, CK 30S ribosomal protein S11 274
274 4TUE 11 QK, XK 30S ribosomal protein S11 274
275 4TUA 11 QK, XK 30S ribosomal protein S11 274
276 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
277 4V84 11 AK, CK 30S ribosomal protein S11 274
278 5WNS 11 K 30S ribosomal protein S11 274
279 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
280 4YY3 11 K 30S ribosomal protein S11 274
281 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
282 4V9Q 41 BK, DK 30S ribosomal protein S11 274
283 4TUC 11 QK, XK 30S ribosomal protein S11 274
284 4YHH 11 K 30S ribosomal protein S11 274
285 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
286 4TUB 11 QK, XK 30S ribosomal protein S11 274
287 4V9N 14 AK, CK 30S ribosomal protein S11 274
288 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
289 4P70 11 QK, XK 30S ribosomal protein S11 274
290 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
291 4LSK 11 QK, XK 30S ribosomal protein S11 274
292 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
293 4V6D 10 AK, CK 30S ribosomal protein S11 562
294 4P6F 11 QK, XK 30S ribosomal protein S11 274
295 4V67 13 AK, CK 30S ribosomal protein S11 274
296 4V83 11 AK, CK 30S ribosomal protein S11 274
297 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
298 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
299 4V5O 20 AK, BK RPS14E 5911
300 1VVJ 11 QK, XK 30S ribosomal protein S11 274
301 4LFZ 11 QK, XK 30S ribosomal protein S11 274
302 2E5L 12 K 30S ribosomal protein S11 274
303 4V6E 10 AK, CK 30S ribosomal protein S11 562
304 6CAS 11 K 30S ribosomal protein S11 274
305 4V52 10 AK, CK 30S ribosomal protein S11 562
306 5CZP 42 QK, XK 30S ribosomal protein S11 274
307 2HHH 11 K 30S ribosomal protein S11 274
308 4V89 11 AK 30S ribosomal protein S11 562
309 4OX9 11 K 30S ribosomal protein S11 274
310 4V54 10 AK, CK 30S ribosomal protein S11 562
311 2UXB 11 K RIBOSOMAL PROTEIN S11 274
312 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
313 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
314 4V9K 10 AK, CK 30S ribosomal protein S11 274
315 4V50 13 AK, CK 30S ribosomal protein S11 562
316 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
317 4V57 10 AK, CK 30S ribosomal protein S11 562
318 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
319 4V63 13 AK, CK 30S ribosomal protein S11 274
320 4L71 11 QK, XK 30S ribosomal protein S11 274
321 4KVB 11 K 30S ribosomal protein S11 274
322 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
323 4V64 10 AK, CK 30S ribosomal protein S11 562
324 4V7P 11 AK, DK 30S ribosomal protein S11 274
325 4V8J 11 AK, CK 30S ribosomal protein S11 274
326 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
327 2ZM6 11 K 30S ribosomal protein S11 274
328 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
329 4V4Q 10 AK, CK 30S ribosomal protein S11 562
330 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
331 5D8B 38 HC, LA 30S ribosomal protein S11 274
332 4LEL 11 QK, XK 30S ribosomal protein S11 274
333 4V53 10 AK, CK 30S ribosomal protein S11 562
334 2F4V 12 K 30S ribosomal protein S11 274
335 4V9L 10 AK, CK 30S ribosomal protein S11 274
336 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
337 4V56 10 AK, CK 30S ribosomal protein S11 562
338 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
339 4V9J 10 AK, CK 30S ribosomal protein S11 274
340 4V55 10 AK, CK 30S ribosomal protein S11 562
341 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
342 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
343 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
344 4V9M 10 AK, CK 30S ribosomal protein S11 274
345 4W29 10 AK, CK 30S ribosomal protein S11 274
346 4V5Y 10 AK, CK 30S ribosomal protein S11 562
347 4V4Y 13 AN 30S ribosomal protein S11 274
348 4V4J 44 l 30S ribosomal protein S11 274
349 4V4X 13 AN 30S ribosomal protein S11 274
350 4V4Z 14 AN 30S ribosomal protein S11 274
351 4V4I 44 l 30S ribosomal protein S11 274
352 4V4P 46 BN 30S ribosomal protein S11 274
353 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
354 4V4R 14 AK 30S ribosomal protein S11 274
355 4V4S 14 AK 30S ribosomal protein S11 274
356 4V4T 14 AK 30S ribosomal protein S11 274
357 4KZZ 15 O 40S Ribosomal Protein S14 9986
358 4KZX 15 O 40S ribosomal protein S14 9986
359 4KZY 15 O 40S Ribosomal Protein S14 9986
360 4V49 13 AK 30S ribosomal protein S11 562
361 4V4A 11 AK 30S ribosomal protein S11 562
362 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
363 6GXN 44 k 30S ribosomal protein S11 562
364 6GXO 44 k 30S ribosomal protein S11 562
365 6GXP 43 k 30S ribosomal protein S11 562
366 6GWT 44 k 30S ribosomal protein S11 562
367 6GSL 11 2A, 2I 30S ribosomal protein S11 274
368 6GQV 62 AE 40S ribosomal protein S14-B 4932
369 6GQ1 62 AE 40S ribosomal protein S14-B 4932
370 6GQB 62 AE 40S ribosomal protein S14-B 4932
371 6DNC 48 XA 30S ribosomal protein S11 562
372 6D9J 64 PP uS11 9986
373 6D90 65 PP uS11 9986
374 5ZLU 17 P 30S ribosomal protein S11 274
375 6G5H 12 O 40S ribosomal protein S14 9606
376 6G5I 16 O 40S ribosomal protein S14 9606
377 6G4S 27 O 40S ribosomal protein S14 9606
378 6G4W 23 O 40S ribosomal protein S14 9606
379 6G51 13 O 40S ribosomal protein S14 9606
380 6G53 13 O 40S ribosomal protein S14 9606
381 6G18 23 O 40S ribosomal protein S14 9606
382 6FXC 11 Ak, Bk 30S ribosomal protein S11 1280
383 6C4I 44 k 30S ribosomal protein S11 562
384 6FEC 38 j 40S ribosomal protein S14 9606
385 6FAI 25 O 40S ribosomal protein S14-A 4932
386 6BU8 41 K 30S ribosomal protein S11 562
387 6BOH 45 UA, ZC 30S ribosomal protein S11 274
388 6BOK 44 SA, VC 30S ribosomal protein S11 274
389 6ERI 44 BK 30S ribosomal protein S11, chloroplastic 3562
390 6ENU 11 k 30S ribosomal protein S11 562
391 6ENJ 41 k 30S ribosomal protein S11 562
392 6ENF 11 k 30S ribosomal protein S11 562
393 6EML 22 Z 40S ribosomal protein S14-A 4932
394 6B4V 45 TA, XC 30S ribosomal protein S11 274
395 6EK0 75 SO 40S ribosomal protein S14 9606
396 6AZ1 15 O ribosomal protein S11 5661
397 6AWB 16 N 30S ribosomal protein S11 562
398 6AWC 16 N 30S ribosomal protein S11 562
399 6AWD 15 N 30S ribosomal protein S11 562
400 5OT7 17 J 30S ribosomal protein S11 274
401 5OQL 42 t 40S ribosomal protein S14-like protein 209285
402 5OPT 14 V 40S ribosomal protein S14, putative 5693
403 5WLC 40 NG rpS14_uS11 4932
404 5WFK 44 k 30S ribosomal protein S11 562
405 5WFS 44 k 30S ribosomal protein S11 562
406 5WF0 44 k 30S ribosomal protein S11 562
407 5XYU 10 K 30S ribosomal protein S11 1772
408 5XYI 16 O Ribosomal protein S14 5722
409 5WE4 44 k 30S ribosomal protein S11 562
410 5WE6 44 k 30S ribosomal protein S11 562
411 5WDT 44 k 30S ribosomal protein S11 562
412 5XXU 16 O Ribosomal protein uS11 5811
413 5OA3 19 O 40S ribosomal protein S14 9606
414 5O61 45 BK 30S ribosomal protein S11 1772
415 5O5J 11 K 30S ribosomal protein S11 1772
416 5O2R 45 k 30S ribosomal protein S11 562
417 5NWY 45 A 30S ribosomal protein S11 562
418 5NP6 14 N 30S ribosomal protein S11 562
419 5NO2 9 K 30S ribosomal protein S11 562
420 5NO3 10 K 30S ribosomal protein S11 562
421 5NO4 10 K 30S ribosomal protein S11 562
422 5NJT 11 K 30S ribosomal protein S11 1423
423 5V93 42 k 30S ribosomal protein S11 1773
424 5NGM 11 Ak 30S ribosomal protein S11 1280
425 5ND8 11 k 30S ribosomal protein S11 1280
426 5ND9 11 k 30S ribosomal protein S11 1280
427 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
428 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
429 5UYK 41 K 30S ribosomal protein S11 562
430 5UYL 41 K 30S ribosomal protein S11 562
431 5UYM 41 K 30S ribosomal protein S11 562
432 5UYN 41 K 30S ribosomal protein S11 562
433 5UYP 41 K 30S ribosomal protein S11 562
434 5UYQ 41 K 30S ribosomal protein S11 562
435 5UZ4 10 K 30S ribosomal protein S11 562
436 5UQ7 42 k 30S ribosomal protein S11 274
437 5UQ8 42 k 30S ribosomal protein S11 274
438 5MYJ 11 AK 30S ribosomal protein S11 1358
439 5MY1 10 K 30S ribosomal protein S11 562
440 5WYJ 45 SP 40S ribosomal protein S14-A 4932
441 5WYK 41 SP 40S ribosomal protein S14-A 4932
442 5U9F 49 K 30S ribosomal protein S11 562
443 5U9G 49 K 30S ribosomal protein S11 562
444 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
445 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
446 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
447 5MGP 42 k 30S ribosomal protein S11 562
448 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
449 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
450 5MDV 48 p 30S ribosomal protein S11 562
451 5MDW 48 p 30S ribosomal protein S11 562
452 5MDY 48 p 30S ribosomal protein S11 562
453 5MDZ 46 p 30S ribosomal protein S11 562
454 5H5U 49 r 30S ribosomal protein S11 562
455 5MC6 27 Z 40S ribosomal protein S14-A 4932
456 5M1J 22 O2 40S ribosomal protein S14-A 4932
457 5LZA 11 k 30S ribosomal protein S11 562
458 5LZB 11 k 30S ribosomal protein S11 562
459 5LZC 11 k 30S ribosomal protein S11 562
460 5LZD 11 k 30S ribosomal protein S11 562
461 5LZE 11 k 30S ribosomal protein S11 562
462 5LZF 11 k 30S ribosomal protein S11 562
463 5TCU 10 S2 30S ribosomal protein S11 1280
464 5T7V 3 S2 30S ribosomal protein S11 1280
465 5T2A 63 AH uS11 5661
466 5T2C 80 AO 40S ribosomal protein S14 9606
467 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
468 5LMO 11 K 30S ribosomal protein S11 274
469 5LMP 11 K 30S ribosomal protein S11 274
470 5LMQ 11 K 30S ribosomal protein S11 274
471 5LMR 11 K 30S ribosomal protein S11 274
472 5LMS 11 K 30S ribosomal protein S11 274
473 5LMT 11 K 30S ribosomal protein S11 274
474 5LMU 11 K 30S ribosomal protein S11 274
475 5LMV 11 K 30S ribosomal protein S11 274
476 5LL6 12 Z 40S ribosomal protein S14-A 4932
477 5LKS 74 SO 40S ribosomal protein S14 9606
478 5LI0 11 k 30S ribosomal protein S11 1280
479 5KPS 42 16 30S ribosomal protein S11 562
480 5KPV 41 15 30S ribosomal protein S11 562
481 5KPW 41 15 30S ribosomal protein S11 562
482 5KPX 41 15 30S ribosomal protein S11 562
483 5KCR 43 1k 30S ribosomal protein S11 562
484 5KCS 45 1k 30S ribosomal protein S11 562
485 5L3P 42 k 30S ribosomal protein S11 562
486 5K0Y 32 j ribosomal protein uS11 9986
487 5JU8 11 AK 30S ribosomal protein S11 562
488 5JUO 64 LB uS11 (yeast S14) 4932
489 5JUP 64 LB uS11 (yeast S14) 4932
490 5JUS 64 LB uS11 (yeast S14) 4932
491 5JUT 64 LB uS11 (yeast S14) 4932
492 5JUU 64 LB uS11 (yeast S14) 4932
493 5JTE 11 AK 30S ribosomal protein S11 562
494 5JPQ 29 w uS11 209285
495 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
496 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
497 5IT7 62 O 40S ribosomal protein S14 28985
498 5IT9 15 O Ribosomal protein uS14 28985
499 5IQR 41 p 30S ribosomal protein S11 562
500 5IMQ 18 O 30S ribosomal protein S11 274
501 5IMR 11 O 30S ribosomal protein S11 274
502 3JCN 42 l 30S ribosomal protein S11 562
503 3JCJ 47 q 30S ribosomal protein S11 562
504 3JCD 10 k 30S ribosomal protein S11 562
505 3JCE 10 k 30S ribosomal protein S11 562
506 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
507 3JBU 10 K 30S ribosomal protein S11 562
508 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 562
509 3JBN 26 P 40S ribosomal protein uS11 5833
510 3JBO 32 P 40S ribosomal protein uS11 5833
511 3JBP 26 P 40S ribosomal protein uS11 5833
512 5A9Z 44 BO 30S ribosomal protein S11 274
513 5AA0 44 BO 30S ribosomal protein S11 274
514 3JAP 18 O uS11 28985
515 3JAQ 18 O uS11 28985
516 3JAM 16 O uS11 28985
517 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
518 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
519 3JAG 66 OO uS11 9986
520 3JAH 66 OO uS11 9986
521 3JAI 66 OO uS11 9986
522 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
523 3JA1 11 SK 30S ribosomal protein S11 562
524 3J9Z 5 SK 30S ribosomal protein S11 562
525 3J9Y 7 k 30S ribosomal protein S11 562
526 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
527 3J9W 11 AK 30S ribosomal protein uS11 1423
528 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
529 5AJ0 64 BO 40S ribosomal protein S14 9606
530 5AFI 11 k 30S ribosomal protein S11 562
531 4UER 21 K US11 4934
532 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
533 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
534 4V3P 9 SK 40S ribosomal protein S14 4565
535 3J81 16 O uS11 28985
536 3J80 12 O uS11 28985
537 3J7P 64 SO Ribosomal protein uS11 9823
538 3J7R 65 SO Ribosomal protein uS11 9823
539 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
540 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
541 3J7A 16 P 40S ribosomal protein uS11 5833
542 3J77 60 14 40S ribosomal protein S14 4932
543 3J78 60 14 40S ribosomal protein S14 4932
544 3J6X 61 14 40S ribosomal protein S14 4932
545 3J6Y 61 14 40S ribosomal protein S14 4932
546 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
547 4V92 17 BO US11 28985
548 4V7E 16 BO 40S ribosomal protein S11 4565
549 4V7D 45 BK 30S ribosomal protein S11 562
550 4V7C 11 AK 30S ribosomal protein S11 562
551 4V7B 11 AK 30S ribosomal protein S11 562
552 4V6Y 10 AK 30S ribosomal protein S11 562
553 4V6Z 10 AK 30S ribosomal protein S11 562
554 4V70 10 AK 30S ribosomal protein S11 562
555 4V71 10 AK 30S ribosomal protein S11 562
556 4V72 10 AK 30S ribosomal protein S11 562
557 4V73 10 AK 30S ribosomal protein S11 562
558 4V74 10 AK 30S ribosomal protein S11 562
559 4V75 10 AK 30S ribosomal protein S11 562
560 4V76 10 AK 30S ribosomal protein S11 562
561 4V77 10 AK 30S ribosomal protein S11 562
562 4V78 10 AK 30S ribosomal protein S11 562
563 4V79 10 AK 30S ribosomal protein S11 562
564 4V7A 10 AK 30S ribosomal protein S11 562
565 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
566 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
567 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
568 4V6W 5 AO 40S ribosomal protein S14 7227
569 4V6X 5 AO 40S ribosomal protein S14 9606
570 4V6V 2 AK 30S ribosomal protein S11 562
571 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
572 4V6U 14 AM 30S ribosomal protein S11P 2261
573 4V6T 11 AK 30S ribosomal protein S11 562
574 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
575 4V6S 47 BM 30S ribosomal protein S11 562
576 4V6P 14 AN 30S ribosomal protein S11 562
577 4V6Q 14 AN 30S ribosomal protein S11 562
578 4V6R 14 AN 30S ribosomal protein S11 562
579 4V6N 48 BN 30S ribosomal protein S11 562
580 4V6O 14 AN 30S ribosomal protein S11 562
581 3J0O 12 K Ribosomal protein S14 9986
582 3J0L 12 K Ribosomal protein S14 9986
583 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
584 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
585 4V6M 15 AK 30S ribosomal protein S11 562
586 4V6K 47 BO 30S ribosomal protein S11 562
587 4V6L 14 AO 30S ribosomal protein S11 562
588 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
589 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
590 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
591 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
592 4V7I 46 BK 30S ribosomal protein S11 562
593 4V7H 10 AK 40S ribosomal protein S14(A) 5541
594 3IY8 6 K 30S ribosomal protein S11 562
595 4V68 7 AK 30S ribosomal protein S11 274
596 4V69 2 AK 30S ribosomal protein S11 562
597 4V65 5 AC 30S ribosomal protein S11 562
598 4V66 5 AC 30S ribosomal protein S11 562
599 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
600 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
601 4V4V 12 AK 30S ribosomal subunit protein S11 562
602 4V4W 12 AK 30S ribosomal subunit protein S11 562
603 1X18 7 G 30S ribosomal protein S11 274
604 4V4B 11 AK 40S ribosomal protein S14-A 4932
605 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
606 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
607 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
608 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
609 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
610 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
611 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274