Sequence Similarity Clusters for the Entities in PDB 4B3R

Entity #1 | Chains: A
16S RIBOSOMAL RNA rna, length: 1521 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
30S RIBOSOMAL PROTEIN S10 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 305 38
95 % 93 305 52 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 93 305 56
70 % 93 305 66
50 % 118 490 23
40 % 129 618 22
30 % 129 620 35
Entity #11 | Chains: K
30S RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 306 36
95 % 93 306 49 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 93 306 53
70 % 93 306 64
50 % 112 484 31
40 % 125 623 21
30 % 125 623 34
Entity #12 | Chains: L
30S RIBOSOMAL PROTEIN S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 80 276 47
95 % 93 313 39 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 93 313 44
70 % 112 498 15
50 % 112 501 21
40 % 112 501 35
30 % 112 501 57
Entity #13 | Chains: M
30S RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 307 33
95 % 93 307 45 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 93 307 50
70 % 93 307 61
50 % 113 488 30
40 % 113 488 41
30 % 124 624 38
Entity #14 | Chains: N
30S RIBOSOMAL PROTEIN S14 TYPE Z protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 305 37
95 % 93 305 51 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
PDBFlex
90 % 93 305 55
70 % 93 312 56
50 % 93 323 92
40 % 93 323 109
30 % 93 323 122
Entity #15 | Chains: O
30S RIBOSOMAL PROTEIN S15 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 311 26
95 % 96 314 38 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 96 314 43
70 % 96 314 55
50 % 118 496 24
40 % 118 501 34
30 % 118 501 56
Entity #16 | Chains: P
30S RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 301 40
95 % 93 306 47 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 93 306 51
70 % 93 306 62
50 % 93 318 96
40 % 113 481 45
30 % 113 481 63
Entity #17 | Chains: Q
30S RIBOSOMAL PROTEIN S17 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 29 1561
95 % 93 303 54 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 0.7
PDBFlex
90 % 93 303 58
70 % 93 303 69
50 % 93 303 99
40 % 93 303 117
30 % 93 303 128
Entity #18 | Chains: R
30S RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 248 52
95 % 84 256 65 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 84 256 72
70 % 84 256 87
50 % 84 256 116
40 % 84 256 139
30 % 84 256 150
Entity #19 | Chains: S
30S RIBOSOMAL PROTEIN S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 309 29
95 % 94 309 41 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 94 309 47
70 % 113 484 16
50 % 113 490 28
40 % 113 493 37
30 % 113 493 58
Entity #2 | Chains: B
30S RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 306 32
95 % 93 307 44 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.6
PDBFlex
90 % 93 307 49
70 % 93 307 60
50 % 112 470 34
40 % 112 476 46
30 % 112 476 64
Entity #20 | Chains: T
30S RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 87 263 50
95 % 93 305 53 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 93 305 57
70 % 93 305 67
50 % 93 305 98
40 % 93 305 116
30 % 93 305 127
Entity #21 | Chains: V
30S RIBOSOMAL PROTEIN THX protein, length: 26 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 295 44
95 % 93 295 55 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 93 295 60
70 % 93 295 71
50 % 93 295 100
40 % 93 295 121
30 % 93 295 133
Entity #22 | Chains: W
5'-R(*UP*UP*CP*AP*AP*AP)-3' rna, length: 6 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #23 | Chains: Z
5'-R(*GP*GP*GP*AP*UP*UP*GP*AP*AP*AP*AP*UP*CP*CP*CP-3' rna, length: 16 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #3 | Chains: C
30S RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 256 51
95 % 84 256 64 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 84 256 71
70 % 84 256 85
50 % 87 332 89
40 % 87 332 107
30 % 87 332 119
Entity #4 | Chains: D
30S RIBOSOMAL PROTEIN S4 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 307 31
95 % 93 307 43 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 93 307 48
70 % 93 307 59
50 % 112 484 29
40 % 112 490 39
30 % 112 490 59
Entity #5 | Chains: E
30S RIBOSOMAL PROTEIN S5 protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 306 35
95 % 93 306 48 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 93 306 52
70 % 93 306 63
50 % 113 480 32
40 % 113 480 44
30 % 113 482 60
Entity #6 | Chains: F
30S RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 311 27
95 % 100 317 36 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 0.9
PDBFlex
90 % 100 317 41
70 % 100 317 54
50 % 100 317 95
40 % 100 317 113
30 % 118 420 84
Entity #7 | Chains: G
30S RIBOSOMAL PROTEIN S7 protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 311 28
95 % 94 311 40 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
PDBFlex
90 % 94 311 45
70 % 94 311 57
50 % 112 423 56
40 % 112 429 62
30 % 112 429 77
Entity #8 | Chains: H
30S RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 306 34
95 % 94 306 46 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 94 310 46
70 % 94 310 58
50 % 115 489 27
40 % 128 640 19
30 % 128 640 33
Entity #9 | Chains: I
30S RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 96 237
95 % 93 306 50 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 93 306 54
70 % 93 306 65
50 % 112 475 33
40 % 112 475 47
30 % 123 622 37

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 6CFL 42 1k, 2k 30S ribosomal protein S11 274
8 6CAE 42 1k, 2k 30S ribosomal protein S11 274
9 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
10 5FDV 43 1k, 2k 30S ribosomal protein S11 274
11 5J4B 42 1k, 2k 30S ribosomal protein S11 274
12 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
13 6CFK 42 1k, 2k 30S ribosomal protein S11 274
14 5J7L 11 AK, BK 30S ribosomal protein S11 562
15 5W4K 42 1k, 2k 30S ribosomal protein S11 274
16 4LFB 11 K ribosomal protein S11 274
17 1VY4 11 AK, CK 30S ribosomal protein S11 274
18 4WOI 11 AK, DK 30S ribosomal protein S11 562
19 5FDU 42 1k, 2k 30S ribosomal protein S11 274
20 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
21 5JC9 11 AK, BK 30S ribosomal protein S11 562
22 1VY5 11 AK, CK 30S ribosomal protein S11 274
23 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
24 4WQF 44 BK, DK 30S ribosomal protein S11 274
25 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
26 4WPO 44 BK, DK 30S ribosomal protein S11 274
27 5J8A 11 AK, BK 30S ribosomal protein S11 562
28 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
29 4JI1 11 K RIBOSOMAL PROTEIN S11 274
30 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
31 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
32 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
33 5J5B 11 AK, BK 30S ribosomal protein S11 562
34 5HD1 42 1k, 2k 30S ribosomal protein S11 274
35 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
36 4DR6 11 K 30S ribosomal protein S11 274
37 4LF7 11 K ribosomal protein S11 274
38 4LF8 11 K ribosomal protein S11 274
39 5WIS 42 1k, 2k 30S ribosomal protein S11 274
40 4WSD 11 2A, 2I 30S ribosomal protein S11 274
41 4WQU 44 BK, DK 30S ribosomal protein S11 274
42 5WIT 42 1k, 2k 30S ribosomal protein S11 274
43 5E81 11 2A, 2I 30S ribosomal protein S11 274
44 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
45 6GSJ 11 2A, 2I 30S ribosomal protein S11 274
46 4U27 11 AK, CK 30S ribosomal protein S11 562
47 6CFJ 42 1k, 2k 30S ribosomal protein S11 274
48 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
49 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
50 5HCR 42 1k, 2k 30S ribosomal protein S11 274
51 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
52 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
53 4DV6 11 K ribosomal protein S11 274
54 4JYA 11 K 30S ribosomal protein S11 274
55 5IBB 11 2A, 2I 30S ribosomal protein S11 274
56 4DR5 11 K 30S ribosomal protein S11 274
57 5J4C 42 1k, 2k 30S ribosomal protein S11 274
58 4KHP 11 K 30S Ribosomal protein S11 274
59 4DR2 11 K 30S ribosomal protein S11 274
60 4WRO 15 2I 30S ribosomal protein S11 274
61 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
62 4LF9 11 K ribosomal protein S11 274
63 4WQY 44 BK, DK 30S ribosomal protein S11 274
64 4DUY 11 K ribosomal protein S11 274
65 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
66 4DV7 11 K ribosomal protein S11 274
67 4WRA 11 2A, 2I 30S ribosomal protein S11 274
68 5IB7 11 2A, 2I 30S ribosomal protein S11 274
69 4U26 11 AK, CK 30S ribosomal protein S11 562
70 4X64 11 K 30S ribosomal protein S11 274
71 5HCP 42 1k, 2k 30S ribosomal protein S11 274
72 5IT8 11 AK, BK 30S ribosomal protein S11 562
73 4V9D 11 AK, BK 30S ribosomal protein S11 562
74 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
75 4V9H 5 AK 30S ribosomal protein S11 274
76 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
77 5J91 11 AK, BK 30S ribosomal protein S11 562
78 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
79 5WNT 11 K RIBOSOMAL PROTEIN S11 274
80 4DR3 11 K 30S ribosomal protein S11 274
81 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
82 4JI3 11 K RIBOSOMAL PROTEIN S11 274
83 4WQR 11 2A, 2I 30S ribosomal protein S11 274
84 4JI6 11 K RIBOSOMAL PROTEIN S11 274
85 4JI8 11 K RIBOSOMAL PROTEIN S11 274
86 2UXC 11 K RIBOSOMAL PROTEIN S11 274
87 5IB8 11 2A, 2I 30S ribosomal protein S11 274
88 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
89 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
90 5EL6 11 2A, 2I 30S ribosomal protein S11 274
91 5EL7 11 2A, 2I 30S ribosomal protein S11 274
92 5VP2 42 1k, 2k 30S ribosomal protein S11 274
93 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
94 4LF4 11 K ribosomal protein S11 274
95 5DFE 45 QK, XK 30S ribosomal protein S11 274
96 5NDK 6 2A, 2I 30S ribosomal protein S11 274
97 4LF6 11 K ribosomal protein S11 274
98 4JI7 11 K RIBOSOMAL PROTEIN S11 274
99 5J88 11 AK, BK 30S ribosomal protein S11 562
100 4U24 11 AK, CK 30S ribosomal protein S11 562
101 4WU1 11 2A, 2I 30S ribosomal protein S11 274
102 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
103 5EL4 11 2A, 2I 30S ribosomal protein S11 274
104 5WNV 11 K 30S ribosomal protein S11 274
105 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
106 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
107 4WR6 11 2A, 2I 30S ribosomal protein S11 274
108 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
109 5HAU 44 1k, 2k 30S ribosomal protein S11 274
110 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
111 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
112 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
113 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
114 4WF1 11 AK, CK 30S ribosomal protein S11 562
115 4U25 11 AK, CK 30S ribosomal protein S11 562
116 4V95 11 AK, CK 30S Ribosomal Protein S11 274
117 4WWW 42 QK, XK 30S ribosomal protein S11 562
118 4V7T 11 AK, CK 30S ribosomal protein S11 562
119 1VY7 11 AK, CK 30S ribosomal protein S11 274
120 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
121 5E7K 11 2A, 2I 30S ribosomal protein S11 274
122 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
123 5EL5 11 2A, 2I 30S ribosomal protein S11 274
124 6FKR 42 1k, 2k 30S ribosomal protein S11 274
125 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
126 4LNT 11 QK, XK 30S ribosomal protein S11 274
127 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
128 4DR1 11 K 30S ribosomal protein S11 274
129 4LFA 11 K ribosomal protein S11 274
130 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
131 4DV4 11 K ribosomal protein S11 274
132 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
133 4YZV 11 QK, XK 30S ribosomal protein S11 274
134 4JI0 11 K ribosomal protein S11 274
135 5IWA 10 K 30S ribosomal protein S11 274
136 4V7U 11 AK, CK 30S ribosomal protein S11 562
137 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
138 4JI2 11 K RIBOSOMAL PROTEIN S11 274
139 4V6C 10 AK, CK 30S ribosomal protein S11 562
140 4JV5 11 K 30S ribosomal protein S11 274
141 4DR7 11 K 30S ribosomal protein S11 274
142 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
143 4GKK 11 K 30S ribosomal protein S11 274
144 4DUZ 11 K ribosomal protein S11 274
145 5NDJ 6 2A, 2I 30S ribosomal protein S11 274
146 4V7V 11 AK, CK 30S ribosomal protein S11 562
147 4X65 11 K 30S ribosomal protein S11 274
148 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
149 4GKJ 11 K 30S ribosomal protein S11 274
150 4DV3 11 K ribosomal protein S11 274
151 4V7S 11 AK, CK 30S ribosomal protein S11 562
152 4DV5 11 K ribosomal protein S11 274
153 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
154 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
155 4LFC 11 K ribosomal protein S11 274
156 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
157 3T1Y 11 K 30S ribosomal protein S11 274
158 4WZO 11 2A, 2I 30S ribosomal protein S11 274
159 4JI4 11 K RIBOSOMAL PROTEIN S11 274
160 1VY6 11 AK, CK 30S ribosomal protein S11 274
161 1XMQ 13 K 30S Ribosomal Protein S11 274
162 5WNP 11 K 30S ribosomal protein S11 274
163 6CAP 11 K 30S ribosomal protein S11 274
164 4U20 11 AK, CK 30S ribosomal protein S11 562
165 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
166 4DV0 11 K ribosomal protein S11 274
167 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
168 4U1V 11 AK, CK 30S ribosomal protein S11 562
169 4V6F 41 BN, CN 30S ribosomal protein S11 274
170 4X62 11 K 30S ribosomal protein S11 274
171 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
172 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
173 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
174 4DV2 11 K ribosomal protein S11 274
175 4DV1 11 K ribosomal protein S11 274
176 5WNU 11 K 30S ribosomal protein S11 274
177 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
178 5F8K 42 1k, 2k 30S ribosomal protein S11 274
179 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
180 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
181 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
182 4JI5 11 K RIBOSOMAL PROTEIN S11 274
183 6CAQ 11 K 30S ribosomal protein S11 274
184 4K0K 11 K 30S ribosomal protein S11 274
185 4W2E 44 k 30S ribosomal protein S11 274
186 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
187 5BR8 11 K 30S ribosomal protein S11 274
188 4LF5 11 K ribosomal protein S11 274
189 5J4D 45 TA, YC 30S ribosomal protein S11 274
190 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
191 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
192 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
193 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
194 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
195 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
196 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
197 4V7Y 11 AK, CK 30S ribosomal protein S11 274
198 6GSK 11 2A, 2I 30S ribosomal protein S11 274
199 4V9C 11 AK, CK 30S ribosomal protein S11 562
200 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
201 5J30 42 QK, XK 30S ribosomal protein S11 274
202 4DR4 11 K 30S ribosomal protein S11 274
203 4WZD 11 2A, 2I 30S ribosomal protein S11 274
204 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
205 4X66 11 K 30S ribosomal protein S11 274
206 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
207 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
208 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
209 4V85 11 AK 30S ribosomal protein S11 562
210 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
211 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
212 4W4G 11 QK, XK 30S ribosomal protein S11 274
213 4NXM 11 K ribosomal protein S11 274
214 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
215 4YPB 11 QK, XK 30S ribosomal protein S11 274
216 4V7X 11 AK, CK 30S ribosomal protein S11 274
217 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
218 4U1U 11 AK, CK 30S ribosomal protein S11 562
219 4ZER 42 1k, 2k 30S ribosomal protein S11 274
220 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
221 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
222 4V7W 11 AK, CK 30S ribosomal protein S11 274
223 4WT1 11 2A, 2I 30S ribosomal protein S11 274
224 6C5L 11 AK, CK 30S ribosomal protein S11 274
225 4WT8 11 AK, BK 30S ribosomal protein S11 274
226 5DOX 42 1k, 2k 30S ribosomal protein S11 274
227 4NXN 11 K ribosomal protein S11 274
228 1XNR 13 K 16S Ribosomal protein S11 274
229 4LT8 11 QK, XK 30S ribosomal protein S11 274
230 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
231 5WNQ 11 K 30S ribosomal protein S11 274
232 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
233 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
234 4V7L 11 AK, CK 30S ribosomal protein S11 274
235 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
236 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
237 1XNQ 13 K Ribosomal protein S11 274
238 4V8A 41 CK, DK 30S ribosomal protein S11 274
239 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
240 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
241 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
242 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
243 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
244 5J3C 42 QK, XK 30S ribosomal protein S11 274
245 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
246 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
247 4L47 11 QK, XK 30S ribosomal protein S11 274
248 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
249 5V8I 42 1k, 2k 30S ribosomal protein S11 274
250 4ZSN 11 QK, XK 30S ribosomal protein S11 274
251 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
252 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
253 4V7Z 11 AK, CK 30S ribosomal protein S11 274
254 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
255 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
256 4V9I 11 AK, CK 30S Ribosomal protein S11 274
257 1XMO 13 K 30S ribosomal protein S11 274
258 3T1H 11 K 30S ribosomal protein S11 274
259 2UXD 11 K RIBOSOMAL PROTEIN S11 274
260 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
261 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
262 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
263 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
264 4V97 11 AK, CK 30S ribosomal protein S11 274
265 6CAR 11 K 30S ribosomal protein S11 274
266 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
267 4V7M 11 AK, CK 30S ribosomal protein S11 274
268 4WSM 11 2A, 2I 30S ribosomal protein S11 274
269 4TUD 11 QK, XK 30S ribosomal protein S11 274
270 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
271 5WNR 11 K 30S ribosomal protein S11 274
272 6CAO 11 K 30S ribosomal protein S11 274
273 4V6A 11 AK, CK 30S ribosomal protein S11 274
274 4TUE 11 QK, XK 30S ribosomal protein S11 274
275 4TUA 11 QK, XK 30S ribosomal protein S11 274
276 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
277 4V84 11 AK, CK 30S ribosomal protein S11 274
278 5WNS 11 K 30S ribosomal protein S11 274
279 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
280 4YY3 11 K 30S ribosomal protein S11 274
281 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
282 4V9Q 41 BK, DK 30S ribosomal protein S11 274
283 4TUC 11 QK, XK 30S ribosomal protein S11 274
284 4YHH 11 K 30S ribosomal protein S11 274
285 5VPO 12 QK, XK 30S ribosomal protein S11 274
286 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
287 4TUB 11 QK, XK 30S ribosomal protein S11 274
288 4V9N 14 AK, CK 30S ribosomal protein S11 274
289 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
290 4P70 11 QK, XK 30S ribosomal protein S11 274
291 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
292 4LSK 11 QK, XK 30S ribosomal protein S11 274
293 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
294 4V6D 10 AK, CK 30S ribosomal protein S11 562
295 4P6F 11 QK, XK 30S ribosomal protein S11 274
296 4V67 13 AK, CK 30S ribosomal protein S11 274
297 4V83 11 AK, CK 30S ribosomal protein S11 274
298 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
299 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
300 4V5O 20 AK, BK RPS14E 5911
301 1VVJ 11 QK, XK 30S ribosomal protein S11 274
302 4LFZ 11 QK, XK 30S ribosomal protein S11 274
303 2E5L 12 K 30S ribosomal protein S11 274
304 4V6E 10 AK, CK 30S ribosomal protein S11 562
305 6CAS 11 K 30S ribosomal protein S11 274
306 4V52 10 AK, CK 30S ribosomal protein S11 562
307 5CZP 42 QK, XK 30S ribosomal protein S11 274
308 2HHH 11 K 30S ribosomal protein S11 274
309 4V89 11 AK 30S ribosomal protein S11 562
310 4OX9 11 K 30S ribosomal protein S11 274
311 4V54 10 AK, CK 30S ribosomal protein S11 562
312 2UXB 11 K RIBOSOMAL PROTEIN S11 274
313 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
314 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
315 4V9K 10 AK, CK 30S ribosomal protein S11 274
316 4V50 13 AK, CK 30S ribosomal protein S11 562
317 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
318 4V57 10 AK, CK 30S ribosomal protein S11 562
319 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
320 4V63 13 AK, CK 30S ribosomal protein S11 274
321 4L71 11 QK, XK 30S ribosomal protein S11 274
322 4KVB 11 K 30S ribosomal protein S11 274
323 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
324 4V64 10 AK, CK 30S ribosomal protein S11 562
325 4V7P 11 AK, DK 30S ribosomal protein S11 274
326 4V8J 11 AK, CK 30S ribosomal protein S11 274
327 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
328 2ZM6 11 K 30S ribosomal protein S11 274
329 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
330 4V4Q 10 AK, CK 30S ribosomal protein S11 562
331 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
332 5D8B 38 HC, LA 30S ribosomal protein S11 274
333 4LEL 11 QK, XK 30S ribosomal protein S11 274
334 4V53 10 AK, CK 30S ribosomal protein S11 562
335 2F4V 12 K 30S ribosomal protein S11 274
336 4V9L 10 AK, CK 30S ribosomal protein S11 274
337 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
338 4V56 10 AK, CK 30S ribosomal protein S11 562
339 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
340 4V9J 10 AK, CK 30S ribosomal protein S11 274
341 4V55 10 AK, CK 30S ribosomal protein S11 562
342 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
343 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
344 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
345 4V9M 10 AK, CK 30S ribosomal protein S11 274
346 4W29 10 AK, CK 30S ribosomal protein S11 274
347 4V5Y 10 AK, CK 30S ribosomal protein S11 562
348 4V4Y 13 AN 30S ribosomal protein S11 274
349 4V4J 44 l 30S ribosomal protein S11 274
350 4V4X 13 AN 30S ribosomal protein S11 274
351 4V4Z 14 AN 30S ribosomal protein S11 274
352 4V4I 44 l 30S ribosomal protein S11 274
353 4V4P 46 BN 30S ribosomal protein S11 274
354 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
355 4V4R 14 AK 30S ribosomal protein S11 274
356 4V4S 14 AK 30S ribosomal protein S11 274
357 4V4T 14 AK 30S ribosomal protein S11 274
358 4KZZ 15 O 40S Ribosomal Protein S14 9986
359 4KZX 15 O 40S ribosomal protein S14 9986
360 4KZY 15 O 40S Ribosomal Protein S14 9986
361 4V49 13 AK 30S ribosomal protein S11 562
362 4V4A 11 AK 30S ribosomal protein S11 562
363 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
364 6HA1 41 k 30S ribosomal protein S11 1423
365 6HA8 43 k 30S ribosomal protein S11 1423
366 6H58 42 k, kk 30S ribosomal protein S11 562
367 6H4N 11 k 30S ribosomal protein S11 562
368 6DZI 11 t 30S ribosomal protein S11 1772
369 6DZK 11 K 30S ribosomal protein S11 1772
370 6GXM 44 k 30S ribosomal protein S11 562
371 6GXN 44 k 30S ribosomal protein S11 562
372 6GXO 44 k 30S ribosomal protein S11 562
373 6GXP 43 k 30S ribosomal protein S11 562
374 6GWT 44 k 30S ribosomal protein S11 562
375 6GSL 11 2A, 2I 30S ribosomal protein S11 274
376 6GQV 62 AE 40S ribosomal protein S14-B 4932
377 6GQ1 62 AE 40S ribosomal protein S14-B 4932
378 6GQB 62 AE 40S ribosomal protein S14-B 4932
379 6DNC 48 XA 30S ribosomal protein S11 562
380 6D9J 64 PP uS11 9986
381 6D90 65 PP uS11 9986
382 5ZLU 17 P 30S ribosomal protein S11 274
383 6G5H 12 O 40S ribosomal protein S14 9606
384 6G5I 16 O 40S ribosomal protein S14 9606
385 6G4S 27 O 40S ribosomal protein S14 9606
386 6G4W 23 O 40S ribosomal protein S14 9606
387 6G51 13 O 40S ribosomal protein S14 9606
388 6G53 13 O 40S ribosomal protein S14 9606
389 6G18 23 O 40S ribosomal protein S14 9606
390 6FXC 11 Ak, Bk 30S ribosomal protein S11 1280
391 5ZEU 8 k 30S ribosomal protein S11 1772
392 5ZEB 8 k 30S ribosomal protein S11 1772
393 5ZEP 8 k 30S ribosomal protein S11 1772
394 6C4I 44 k 30S ribosomal protein S11 562
395 6FEC 38 j 40S ribosomal protein S14 9606
396 6FAI 25 O 40S ribosomal protein S14-A 4932
397 6BU8 41 K 30S ribosomal protein S11 562
398 6BOH 45 UA, ZC 30S ribosomal protein S11 274
399 6BOK 44 SA, VC 30S ribosomal protein S11 274
400 6ERI 44 BK 30S ribosomal protein S11, chloroplastic 3562
401 6ENU 11 k 30S ribosomal protein S11 562
402 6ENJ 41 k 30S ribosomal protein S11 562
403 6ENF 11 k 30S ribosomal protein S11 562
404 6EML 22 Z 40S ribosomal protein S14-A 4932
405 6B4V 45 TA, XC 30S ribosomal protein S11 274
406 6EK0 75 SO 40S ribosomal protein S14 9606
407 6AZ1 15 O ribosomal protein S11 5661
408 6AWB 16 N 30S ribosomal protein S11 562
409 6AWC 16 N 30S ribosomal protein S11 562
410 6AWD 15 N 30S ribosomal protein S11 562
411 5OT7 17 J 30S ribosomal protein S11 274
412 5OQL 42 t 40S ribosomal protein S14-like protein 209285
413 5OPT 14 V 40S ribosomal protein S14, putative 5693
414 5WLC 40 NG rpS14_uS11 4932
415 5WFK 44 k 30S ribosomal protein S11 562
416 5WFS 44 k 30S ribosomal protein S11 562
417 5WF0 44 k 30S ribosomal protein S11 562
418 5XYU 10 K 30S ribosomal protein S11 1772
419 5XYI 16 O Ribosomal protein S14 5722
420 5WE4 44 k 30S ribosomal protein S11 562
421 5WE6 44 k 30S ribosomal protein S11 562
422 5WDT 44 k 30S ribosomal protein S11 562
423 5XXU 16 O Ribosomal protein uS11 5811
424 5OA3 19 O 40S ribosomal protein S14 9606
425 5O61 45 BK 30S ribosomal protein S11 1772
426 5O5J 11 K 30S ribosomal protein S11 1772
427 5O2R 45 k 30S ribosomal protein S11 562
428 5NWY 45 A 30S ribosomal protein S11 562
429 5VPP 40 QK, XK 30S ribosomal protein S11 274
430 5NP6 14 N 30S ribosomal protein S11 562
431 5NO2 9 K 30S ribosomal protein S11 562
432 5NO3 10 K 30S ribosomal protein S11 562
433 5NO4 10 K 30S ribosomal protein S11 562
434 5NJT 11 K 30S ribosomal protein S11 1423
435 5V93 42 k 30S ribosomal protein S11 1773
436 5NGM 11 Ak 30S ribosomal protein S11 1280
437 5ND8 11 k 30S ribosomal protein S11 1280
438 5ND9 11 k 30S ribosomal protein S11 1280
439 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
440 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
441 5UYK 41 K 30S ribosomal protein S11 562
442 5UYL 41 K 30S ribosomal protein S11 562
443 5UYM 41 K 30S ribosomal protein S11 562
444 5UYN 41 K 30S ribosomal protein S11 562
445 5UYP 41 K 30S ribosomal protein S11 562
446 5UYQ 41 K 30S ribosomal protein S11 562
447 5UZ4 10 K 30S ribosomal protein S11 562
448 5UQ7 42 k 30S ribosomal protein S11 274
449 5UQ8 42 k 30S ribosomal protein S11 274
450 5MYJ 11 AK 30S ribosomal protein S11 1358
451 5MY1 10 K 30S ribosomal protein S11 562
452 5WYJ 45 SP 40S ribosomal protein S14-A 4932
453 5WYK 41 SP 40S ribosomal protein S14-A 4932
454 5U9F 49 K 30S ribosomal protein S11 562
455 5U9G 49 K 30S ribosomal protein S11 562
456 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
457 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
458 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
459 5MGP 42 k 30S ribosomal protein S11 562
460 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
461 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
462 5MDV 48 p 30S ribosomal protein S11 562
463 5MDW 48 p 30S ribosomal protein S11 562
464 5MDY 48 p 30S ribosomal protein S11 562
465 5MDZ 46 p 30S ribosomal protein S11 562
466 5H5U 49 r 30S ribosomal protein S11 562
467 5MC6 27 Z 40S ribosomal protein S14-A 4932
468 5M1J 22 O2 40S ribosomal protein S14-A 4932
469 5LZA 11 k 30S ribosomal protein S11 562
470 5LZB 11 k 30S ribosomal protein S11 562
471 5LZC 11 k 30S ribosomal protein S11 562
472 5LZD 11 k 30S ribosomal protein S11 562
473 5LZE 11 k 30S ribosomal protein S11 562
474 5LZF 11 k 30S ribosomal protein S11 562
475 5TCU 10 S2 30S ribosomal protein S11 1280
476 5T7V 3 S2 30S ribosomal protein S11 1280
477 5T2A 63 AH uS11 5661
478 5T2C 80 AO 40S ribosomal protein S14 9606
479 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
480 5LMO 11 K 30S ribosomal protein S11 274
481 5LMP 11 K 30S ribosomal protein S11 274
482 5LMQ 11 K 30S ribosomal protein S11 274
483 5LMR 11 K 30S ribosomal protein S11 274
484 5LMS 11 K 30S ribosomal protein S11 274
485 5LMT 11 K 30S ribosomal protein S11 274
486 5LMU 11 K 30S ribosomal protein S11 274
487 5LMV 11 K 30S ribosomal protein S11 274
488 5LL6 12 Z 40S ribosomal protein S14-A 4932
489 5LKS 74 SO 40S ribosomal protein S14 9606
490 5LI0 11 k 30S ribosomal protein S11 1280
491 5KPS 42 16 30S ribosomal protein S11 562
492 5KPV 41 15 30S ribosomal protein S11 562
493 5KPW 41 15 30S ribosomal protein S11 562
494 5KPX 41 15 30S ribosomal protein S11 562
495 5KCR 43 1k 30S ribosomal protein S11 562
496 5KCS 45 1k 30S ribosomal protein S11 562
497 5L3P 42 k 30S ribosomal protein S11 562
498 5K0Y 32 j ribosomal protein uS11 9986
499 5JU8 11 AK 30S ribosomal protein S11 562
500 5JUO 64 LB uS11 (yeast S14) 4932
501 5JUP 64 LB uS11 (yeast S14) 4932
502 5JUS 64 LB uS11 (yeast S14) 4932
503 5JUT 64 LB uS11 (yeast S14) 4932
504 5JUU 64 LB uS11 (yeast S14) 4932
505 5JTE 11 AK 30S ribosomal protein S11 562
506 5JPQ 29 w uS11 209285
507 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
508 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
509 5IT7 62 O 40S ribosomal protein S14 28985
510 5IT9 15 O Ribosomal protein uS14 28985
511 5IQR 41 p 30S ribosomal protein S11 562
512 5IMQ 18 O 30S ribosomal protein S11 274
513 5IMR 11 O 30S ribosomal protein S11 274
514 3JCN 42 l 30S ribosomal protein S11 562
515 3JCJ 47 q 30S ribosomal protein S11 562
516 3JCD 10 k 30S ribosomal protein S11 562
517 3JCE 10 k 30S ribosomal protein S11 562
518 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
519 3JBU 10 K 30S ribosomal protein S11 562
520 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 562
521 3JBN 26 P 40S ribosomal protein uS11 5833
522 3JBO 32 P 40S ribosomal protein uS11 5833
523 3JBP 26 P 40S ribosomal protein uS11 5833
524 5A9Z 44 BO 30S ribosomal protein S11 274
525 5AA0 44 BO 30S ribosomal protein S11 274
526 3JAP 18 O uS11 28985
527 3JAQ 18 O uS11 28985
528 3JAM 16 O uS11 28985
529 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
530 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
531 3JAG 66 OO uS11 9986
532 3JAH 66 OO uS11 9986
533 3JAI 66 OO uS11 9986
534 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
535 3JA1 11 SK 30S ribosomal protein S11 562
536 3J9Z 5 SK 30S ribosomal protein S11 562
537 3J9Y 7 k 30S ribosomal protein S11 562
538 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
539 3J9W 11 AK 30S ribosomal protein uS11 1423
540 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
541 5AJ0 64 BO 40S ribosomal protein S14 9606
542 5AFI 11 k 30S ribosomal protein S11 562
543 4UER 21 K US11 4934
544 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
545 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
546 4V3P 9 SK 40S ribosomal protein S14 4565
547 3J81 16 O uS11 28985
548 3J80 12 O uS11 28985
549 3J7P 64 SO Ribosomal protein uS11 9823
550 3J7R 65 SO Ribosomal protein uS11 9823
551 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
552 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
553 3J7A 16 P 40S ribosomal protein uS11 5833
554 3J77 60 14 40S ribosomal protein S14 4932
555 3J78 60 14 40S ribosomal protein S14 4932
556 3J6X 61 14 40S ribosomal protein S14 4932
557 3J6Y 61 14 40S ribosomal protein S14 4932
558 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
559 4V92 17 BO US11 28985
560 4V7E 16 BO 40S ribosomal protein S11 4565
561 4V7D 45 BK 30S ribosomal protein S11 562
562 4V7C 11 AK 30S ribosomal protein S11 562
563 4V7B 11 AK 30S ribosomal protein S11 562
564 4V6Y 10 AK 30S ribosomal protein S11 562
565 4V6Z 10 AK 30S ribosomal protein S11 562
566 4V70 10 AK 30S ribosomal protein S11 562
567 4V71 10 AK 30S ribosomal protein S11 562
568 4V72 10 AK 30S ribosomal protein S11 562
569 4V73 10 AK 30S ribosomal protein S11 562
570 4V74 10 AK 30S ribosomal protein S11 562
571 4V75 10 AK 30S ribosomal protein S11 562
572 4V76 10 AK 30S ribosomal protein S11 562
573 4V77 10 AK 30S ribosomal protein S11 562
574 4V78 10 AK 30S ribosomal protein S11 562
575 4V79 10 AK 30S ribosomal protein S11 562
576 4V7A 10 AK 30S ribosomal protein S11 562
577 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
578 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
579 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
580 4V6W 5 AO 40S ribosomal protein S14 7227
581 4V6X 5 AO 40S ribosomal protein S14 9606
582 4V6V 2 AK 30S ribosomal protein S11 562
583 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
584 4V6U 14 AM 30S ribosomal protein S11P 2261
585 4V6T 11 AK 30S ribosomal protein S11 562
586 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
587 4V6S 47 BM 30S ribosomal protein S11 562
588 4V6P 14 AN 30S ribosomal protein S11 562
589 4V6Q 14 AN 30S ribosomal protein S11 562
590 4V6R 14 AN 30S ribosomal protein S11 562
591 4V6N 48 BN 30S ribosomal protein S11 562
592 4V6O 14 AN 30S ribosomal protein S11 562
593 3J0O 12 K Ribosomal protein S14 9986
594 3J0L 12 K Ribosomal protein S14 9986
595 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
596 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
597 4V6M 15 AK 30S ribosomal protein S11 562
598 4V6K 47 BO 30S ribosomal protein S11 562
599 4V6L 14 AO 30S ribosomal protein S11 562
600 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
601 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
602 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
603 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
604 4V7I 46 BK 30S ribosomal protein S11 562
605 4V7H 10 AK 40S ribosomal protein S14(A) 5541
606 3IY8 6 K 30S ribosomal protein S11 562
607 4V68 7 AK 30S ribosomal protein S11 274
608 4V69 2 AK 30S ribosomal protein S11 562
609 4V65 5 AC 30S ribosomal protein S11 562
610 4V66 5 AC 30S ribosomal protein S11 562
611 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
612 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
613 4V4V 12 AK 30S ribosomal subunit protein S11 562
614 4V4W 12 AK 30S ribosomal subunit protein S11 562
615 1X18 7 G 30S ribosomal protein S11 274
616 4V4B 11 AK 40S ribosomal protein S14-A 4932
617 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
618 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
619 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
620 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
621 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
622 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
623 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274