Sequence Similarity Clusters for the Entities in PDB 4B3R

Entity #1 | Chains: A
16S RIBOSOMAL RNA rna, length: 1521 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
30S RIBOSOMAL PROTEIN S10 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 314 38
95 % 93 314 55 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 93 314 60
70 % 93 314 69
50 % 119 502 21
40 % 130 640 23
30 % 130 642 36
Entity #11 | Chains: K
30S RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 315 36
95 % 93 315 52 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 93 315 57
70 % 93 315 67
50 % 113 495 29
40 % 126 644 22
30 % 126 644 35
Entity #12 | Chains: L
30S RIBOSOMAL PROTEIN S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 80 282 46
95 % 93 322 42 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 93 322 48
70 % 114 510 14
50 % 114 513 20
40 % 114 513 34
30 % 114 513 54
Entity #13 | Chains: M
30S RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 316 33
95 % 93 316 48 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 93 316 54
70 % 93 316 64
50 % 114 499 28
40 % 114 499 39
30 % 125 645 38
Entity #14 | Chains: N
30S RIBOSOMAL PROTEIN S14 TYPE Z protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 314 37
95 % 93 314 54 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
PDBFlex
90 % 93 314 59
70 % 93 321 58
50 % 93 332 91
40 % 93 332 108
30 % 93 332 121
Entity #15 | Chains: O
30S RIBOSOMAL PROTEIN S15 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 320 27
95 % 96 323 41 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 96 323 46
70 % 96 323 57
50 % 119 507 22
40 % 119 512 33
30 % 119 512 53
Entity #16 | Chains: P
30S RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 310 40
95 % 93 315 50 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 93 315 55
70 % 93 315 65
50 % 93 327 93
40 % 114 492 43
30 % 114 492 60
Entity #17 | Chains: Q
30S RIBOSOMAL PROTEIN S17 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 40 941
95 % 93 312 57 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 0.7
PDBFlex
90 % 93 312 62
70 % 93 312 73
50 % 93 312 98
40 % 93 312 116
30 % 93 312 129
Entity #18 | Chains: R
30S RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 254 55
95 % 84 262 71 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 84 262 75
70 % 84 262 87
50 % 84 262 117
40 % 84 262 140
30 % 84 262 154
Entity #19 | Chains: S
30S RIBOSOMAL PROTEIN S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 318 30
95 % 94 318 45 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 94 318 51
70 % 114 495 16
50 % 114 501 24
40 % 114 504 35
30 % 114 504 55
Entity #2 | Chains: B
30S RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 315 32
95 % 93 316 47 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.6
PDBFlex
90 % 93 316 53
70 % 93 316 63
50 % 113 481 36
40 % 113 487 44
30 % 113 487 61
Entity #20 | Chains: T
30S RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 87 269 50
95 % 93 314 56 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 93 314 61
70 % 93 314 70
50 % 93 314 96
40 % 93 314 113
30 % 93 314 126
Entity #21 | Chains: V
30S RIBOSOMAL PROTEIN THX protein, length: 26 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 304 43
95 % 93 304 58 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 93 304 63
70 % 93 304 74
50 % 93 304 101
40 % 93 304 119
30 % 93 304 131
Entity #22 | Chains: W
5'-R(*UP*UP*CP*AP*AP*AP)-3' rna, length: 6 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #23 | Chains: Z
5'-R(*GP*GP*GP*AP*UP*UP*GP*AP*AP*AP*AP*UP*CP*CP*CP-3' rna, length: 16 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #3 | Chains: C
30S RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 262 54
95 % 84 262 70 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 84 262 74
70 % 84 262 86
50 % 87 338 89
40 % 87 338 105
30 % 87 338 119
Entity #4 | Chains: D
30S RIBOSOMAL PROTEIN S4 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 316 31
95 % 93 316 46 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 93 316 52
70 % 93 316 61
50 % 113 495 27
40 % 113 501 36
30 % 113 501 56
Entity #5 | Chains: E
30S RIBOSOMAL PROTEIN S5 protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 315 35
95 % 93 315 51 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 93 315 56
70 % 93 315 66
50 % 114 491 31
40 % 114 491 42
30 % 114 493 59
Entity #6 | Chains: F
30S RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 320 28
95 % 100 326 40 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 0.9
PDBFlex
90 % 100 326 45
70 % 100 326 55
50 % 100 326 92
40 % 100 326 110
30 % 119 431 87
Entity #7 | Chains: G
30S RIBOSOMAL PROTEIN S7 protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 320 29
95 % 94 320 43 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
PDBFlex
90 % 94 320 49
70 % 94 320 59
50 % 113 434 62
40 % 113 440 76
30 % 113 440 86
Entity #8 | Chains: H
30S RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 315 34
95 % 94 315 49 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 94 319 50
70 % 94 319 60
50 % 116 500 23
40 % 129 661 21
30 % 129 661 34
Entity #9 | Chains: I
30S RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 96 251
95 % 93 315 53 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 93 315 58
70 % 93 315 68
50 % 113 486 33
40 % 113 486 45
30 % 124 643 37

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 6CFL 42 1k, 2k 30S ribosomal protein S11 274
8 6CAE 42 1k, 2k 30S ribosomal protein S11 274
9 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
10 5FDV 43 1k, 2k 30S ribosomal protein S11 274
11 5J4B 42 1k, 2k 30S ribosomal protein S11 274
12 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
13 6CFK 42 1k, 2k 30S ribosomal protein S11 274
14 5J7L 11 AK, BK 30S ribosomal protein S11 562
15 5W4K 42 1k, 2k 30S ribosomal protein S11 274
16 4LFB 11 K ribosomal protein S11 274
17 1VY4 11 AK, CK 30S ribosomal protein S11 274
18 4WOI 11 AK, DK 30S ribosomal protein S11 562
19 5FDU 42 1k, 2k 30S ribosomal protein S11 274
20 6I7V 15 AK, BK 30S ribosomal protein S11 562
21 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
22 5JC9 11 AK, BK 30S ribosomal protein S11 562
23 1VY5 11 AK, CK 30S ribosomal protein S11 274
24 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
25 4WQF 44 BK, DK 30S ribosomal protein S11 274
26 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
27 4WPO 44 BK, DK 30S ribosomal protein S11 274
28 5J8A 11 AK, BK 30S ribosomal protein S11 562
29 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
30 4JI1 11 K RIBOSOMAL PROTEIN S11 274
31 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
32 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
33 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
34 5J5B 11 AK, BK 30S ribosomal protein S11 562
35 5HD1 42 1k, 2k 30S ribosomal protein S11 274
36 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
37 4DR6 11 K 30S ribosomal protein S11 274
38 4LF7 11 K ribosomal protein S11 274
39 4LF8 11 K ribosomal protein S11 274
40 5WIS 42 1k, 2k 30S ribosomal protein S11 274
41 4WSD 11 2A, 2I 30S ribosomal protein S11 274
42 4WQU 44 BK, DK 30S ribosomal protein S11 274
43 5WIT 42 1k, 2k 30S ribosomal protein S11 274
44 5E81 11 2A, 2I 30S ribosomal protein S11 274
45 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
46 6GSJ 11 2A, 2I 30S ribosomal protein S11 274
47 4U27 11 AK, CK 30S ribosomal protein S11 562
48 6CFJ 42 1k, 2k 30S ribosomal protein S11 274
49 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
50 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
51 5HCR 42 1k, 2k 30S ribosomal protein S11 274
52 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
53 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
54 4DV6 11 K ribosomal protein S11 274
55 4JYA 11 K 30S ribosomal protein S11 274
56 5IBB 11 2A, 2I 30S ribosomal protein S11 274
57 4DR5 11 K 30S ribosomal protein S11 274
58 5J4C 42 1k, 2k 30S ribosomal protein S11 274
59 4KHP 11 K 30S Ribosomal protein S11 274
60 4DR2 11 K 30S ribosomal protein S11 274
61 4WRO 15 2I 30S ribosomal protein S11 274
62 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
63 4LF9 11 K ribosomal protein S11 274
64 4WQY 44 BK, DK 30S ribosomal protein S11 274
65 4DUY 11 K ribosomal protein S11 274
66 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
67 4DV7 11 K ribosomal protein S11 274
68 4WRA 11 2A, 2I 30S ribosomal protein S11 274
69 5IB7 11 2A, 2I 30S ribosomal protein S11 274
70 4U26 11 AK, CK 30S ribosomal protein S11 562
71 4X64 11 K 30S ribosomal protein S11 274
72 5HCP 42 1k, 2k 30S ribosomal protein S11 274
73 5IT8 11 AK, BK 30S ribosomal protein S11 562
74 4V9D 11 AK, BK 30S ribosomal protein S11 562
75 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
76 4V9H 5 AK 30S ribosomal protein S11 274
77 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
78 5J91 11 AK, BK 30S ribosomal protein S11 562
79 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
80 5WNT 11 K RIBOSOMAL PROTEIN S11 274
81 4DR3 11 K 30S ribosomal protein S11 274
82 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
83 4JI3 11 K RIBOSOMAL PROTEIN S11 274
84 4WQR 11 2A, 2I 30S ribosomal protein S11 274
85 4JI6 11 K RIBOSOMAL PROTEIN S11 274
86 4JI8 11 K RIBOSOMAL PROTEIN S11 274
87 2UXC 11 K RIBOSOMAL PROTEIN S11 274
88 5IB8 11 2A, 2I 30S ribosomal protein S11 274
89 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
90 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
91 5EL6 11 2A, 2I 30S ribosomal protein S11 274
92 5EL7 11 2A, 2I 30S ribosomal protein S11 274
93 5VP2 42 1k, 2k 30S ribosomal protein S11 274
94 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
95 4LF4 11 K ribosomal protein S11 274
96 5DFE 45 QK, XK 30S ribosomal protein S11 274
97 5NDK 6 2A, 2I 30S ribosomal protein S11 274
98 4LF6 11 K ribosomal protein S11 274
99 4JI7 11 K RIBOSOMAL PROTEIN S11 274
100 5J88 11 AK, BK 30S ribosomal protein S11 562
101 4U24 11 AK, CK 30S ribosomal protein S11 562
102 4WU1 11 2A, 2I 30S ribosomal protein S11 274
103 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
104 5EL4 11 2A, 2I 30S ribosomal protein S11 274
105 5WNV 11 K 30S ribosomal protein S11 274
106 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
107 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
108 4WR6 11 2A, 2I 30S ribosomal protein S11 274
109 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
110 5HAU 44 1k, 2k 30S ribosomal protein S11 274
111 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
112 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
113 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
114 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
115 4WF1 11 AK, CK 30S ribosomal protein S11 562
116 4U25 11 AK, CK 30S ribosomal protein S11 562
117 4V95 11 AK, CK 30S Ribosomal Protein S11 274
118 4WWW 42 QK, XK 30S ribosomal protein S11 562
119 4V7T 11 AK, CK 30S ribosomal protein S11 562
120 1VY7 11 AK, CK 30S ribosomal protein S11 274
121 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
122 5E7K 11 2A, 2I 30S ribosomal protein S11 274
123 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
124 5EL5 11 2A, 2I 30S ribosomal protein S11 274
125 6FKR 42 1k, 2k 30S ribosomal protein S11 274
126 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
127 4LNT 11 QK, XK 30S ribosomal protein S11 274
128 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
129 4DR1 11 K 30S ribosomal protein S11 274
130 4LFA 11 K ribosomal protein S11 274
131 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
132 4DV4 11 K ribosomal protein S11 274
133 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
134 4YZV 11 QK, XK 30S ribosomal protein S11 274
135 4JI0 11 K ribosomal protein S11 274
136 5IWA 10 K 30S ribosomal protein S11 274
137 4V7U 11 AK, CK 30S ribosomal protein S11 562
138 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
139 4JI2 11 K RIBOSOMAL PROTEIN S11 274
140 4V6C 10 AK, CK 30S ribosomal protein S11 562
141 4JV5 11 K 30S ribosomal protein S11 274
142 4DR7 11 K 30S ribosomal protein S11 274
143 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
144 4GKK 11 K 30S ribosomal protein S11 274
145 4DUZ 11 K ribosomal protein S11 274
146 5NDJ 6 2A, 2I 30S ribosomal protein S11 274
147 4V7V 11 AK, CK 30S ribosomal protein S11 562
148 4X65 11 K 30S ribosomal protein S11 274
149 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
150 4GKJ 11 K 30S ribosomal protein S11 274
151 4DV3 11 K ribosomal protein S11 274
152 4V7S 11 AK, CK 30S ribosomal protein S11 562
153 4DV5 11 K ribosomal protein S11 274
154 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
155 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
156 4LFC 11 K ribosomal protein S11 274
157 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
158 3T1Y 11 K 30S ribosomal protein S11 274
159 4WZO 11 2A, 2I 30S ribosomal protein S11 274
160 4JI4 11 K RIBOSOMAL PROTEIN S11 274
161 1VY6 11 AK, CK 30S ribosomal protein S11 274
162 1XMQ 13 K 30S Ribosomal Protein S11 274
163 5WNP 11 K 30S ribosomal protein S11 274
164 6CAP 11 K 30S ribosomal protein S11 274
165 4U20 11 AK, CK 30S ribosomal protein S11 562
166 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
167 4DV0 11 K ribosomal protein S11 274
168 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
169 4U1V 11 AK, CK 30S ribosomal protein S11 562
170 4V6F 41 BN, CN 30S ribosomal protein S11 274
171 4X62 11 K 30S ribosomal protein S11 274
172 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
173 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
174 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
175 4DV2 11 K ribosomal protein S11 274
176 4DV1 11 K ribosomal protein S11 274
177 5WNU 11 K 30S ribosomal protein S11 274
178 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
179 5F8K 42 1k, 2k 30S ribosomal protein S11 274
180 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
181 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
182 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
183 4JI5 11 K RIBOSOMAL PROTEIN S11 274
184 6CAQ 11 K 30S ribosomal protein S11 274
185 4K0K 11 K 30S ribosomal protein S11 274
186 4W2E 44 k 30S ribosomal protein S11 274
187 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
188 5BR8 11 K 30S ribosomal protein S11 274
189 4LF5 11 K ribosomal protein S11 274
190 5J4D 45 TA, YC 30S ribosomal protein S11 274
191 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
192 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
193 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
194 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
195 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
196 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
197 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
198 4V7Y 11 AK, CK 30S ribosomal protein S11 274
199 6GSK 11 2A, 2I 30S ribosomal protein S11 274
200 4V9C 11 AK, CK 30S ribosomal protein S11 562
201 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
202 5J30 42 QK, XK 30S ribosomal protein S11 274
203 4DR4 11 K 30S ribosomal protein S11 274
204 4WZD 11 2A, 2I 30S ribosomal protein S11 274
205 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
206 4X66 11 K 30S ribosomal protein S11 274
207 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
208 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
209 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
210 4V85 11 AK 30S ribosomal protein S11 562
211 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
212 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
213 4W4G 11 QK, XK 30S ribosomal protein S11 274
214 4NXM 11 K ribosomal protein S11 274
215 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
216 4YPB 11 QK, XK 30S ribosomal protein S11 274
217 4V7X 11 AK, CK 30S ribosomal protein S11 274
218 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
219 4U1U 11 AK, CK 30S ribosomal protein S11 562
220 4ZER 42 1k, 2k 30S ribosomal protein S11 274
221 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
222 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
223 4V7W 11 AK, CK 30S ribosomal protein S11 274
224 4WT1 11 2A, 2I 30S ribosomal protein S11 274
225 6C5L 11 AK, CK 30S ribosomal protein S11 274
226 4WT8 11 AK, BK 30S ribosomal protein S11 274
227 5DOX 42 1k, 2k 30S ribosomal protein S11 274
228 4NXN 11 K ribosomal protein S11 274
229 1XNR 13 K 16S Ribosomal protein S11 274
230 4LT8 11 QK, XK 30S ribosomal protein S11 274
231 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
232 5WNQ 11 K 30S ribosomal protein S11 274
233 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
234 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
235 4V7L 11 AK, CK 30S ribosomal protein S11 274
236 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
237 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
238 1XNQ 13 K Ribosomal protein S11 274
239 4V8A 41 CK, DK 30S ribosomal protein S11 274
240 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
241 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
242 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
243 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
244 6BZ6 11 QK, XK 30S ribosomal protein S11 274
245 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
246 5J3C 42 QK, XK 30S ribosomal protein S11 274
247 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
248 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
249 4L47 11 QK, XK 30S ribosomal protein S11 274
250 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
251 5V8I 42 1k, 2k 30S ribosomal protein S11 274
252 4ZSN 11 QK, XK 30S ribosomal protein S11 274
253 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
254 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
255 6BUW 11 QK, XK 30S ribosomal protein S11 274
256 4V7Z 11 AK, CK 30S ribosomal protein S11 274
257 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
258 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
259 4V9I 11 AK, CK 30S Ribosomal protein S11 274
260 1XMO 13 K 30S ribosomal protein S11 274
261 3T1H 11 K 30S ribosomal protein S11 274
262 2UXD 11 K RIBOSOMAL PROTEIN S11 274
263 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
264 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
265 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
266 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
267 4V97 11 AK, CK 30S ribosomal protein S11 274
268 6CAR 11 K 30S ribosomal protein S11 274
269 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
270 4V7M 11 AK, CK 30S ribosomal protein S11 274
271 4WSM 11 2A, 2I 30S ribosomal protein S11 274
272 4TUD 11 QK, XK 30S ribosomal protein S11 274
273 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
274 5WNR 11 K 30S ribosomal protein S11 274
275 6CAO 11 K 30S ribosomal protein S11 274
276 4V6A 11 AK, CK 30S ribosomal protein S11 274
277 4TUE 11 QK, XK 30S ribosomal protein S11 274
278 4TUA 11 QK, XK 30S ribosomal protein S11 274
279 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
280 4V84 11 AK, CK 30S ribosomal protein S11 274
281 5WNS 11 K 30S ribosomal protein S11 274
282 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
283 4YY3 11 K 30S ribosomal protein S11 274
284 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
285 4V9Q 41 BK, DK 30S ribosomal protein S11 274
286 6BZ8 11 QK, XK 30S ribosomal protein S11 274
287 4TUC 11 QK, XK 30S ribosomal protein S11 274
288 4YHH 11 K 30S ribosomal protein S11 274
289 5VPO 12 QK, XK 30S ribosomal protein S11 274
290 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
291 4TUB 11 QK, XK 30S ribosomal protein S11 274
292 4V9N 14 AK, CK 30S ribosomal protein S11 274
293 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
294 4P70 11 QK, XK 30S ribosomal protein S11 274
295 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
296 4LSK 11 QK, XK 30S ribosomal protein S11 274
297 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
298 4V6D 10 AK, CK 30S ribosomal protein S11 562
299 4P6F 11 QK, XK 30S ribosomal protein S11 274
300 4V67 13 AK, CK 30S ribosomal protein S11 274
301 4V83 11 AK, CK 30S ribosomal protein S11 274
302 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
303 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
304 4V5O 20 AK, BK RPS14E 5911
305 1VVJ 11 QK, XK 30S ribosomal protein S11 274
306 4LFZ 11 QK, XK 30S ribosomal protein S11 274
307 2E5L 12 K 30S ribosomal protein S11 274
308 6BZ7 11 QK, XK 30S ribosomal protein S11 274
309 4V6E 10 AK, CK 30S ribosomal protein S11 562
310 6CAS 11 K 30S ribosomal protein S11 274
311 4V52 10 AK, CK 30S ribosomal protein S11 562
312 5CZP 42 QK, XK 30S ribosomal protein S11 274
313 6N9F 42 1k, 2k 30S ribosomal protein S11 274
314 6N9E 42 1k, 2k 30S ribosomal protein S11 274
315 2HHH 11 K 30S ribosomal protein S11 274
316 4V89 11 AK 30S ribosomal protein S11 562
317 4OX9 11 K 30S ribosomal protein S11 274
318 4V54 10 AK, CK 30S ribosomal protein S11 562
319 2UXB 11 K RIBOSOMAL PROTEIN S11 274
320 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
321 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
322 4V9K 10 AK, CK 30S ribosomal protein S11 274
323 4V50 13 AK, CK 30S ribosomal protein S11 562
324 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
325 4V57 10 AK, CK 30S ribosomal protein S11 562
326 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
327 4V63 13 AK, CK 30S ribosomal protein S11 274
328 4L71 11 QK, XK 30S ribosomal protein S11 274
329 4KVB 11 K 30S ribosomal protein S11 274
330 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
331 4V64 10 AK, CK 30S ribosomal protein S11 562
332 4V7P 11 AK, DK 30S ribosomal protein S11 274
333 4V8J 11 AK, CK 30S ribosomal protein S11 274
334 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
335 2ZM6 11 K 30S ribosomal protein S11 274
336 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
337 4V4Q 10 AK, CK 30S ribosomal protein S11 562
338 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
339 5D8B 38 HC, LA 30S ribosomal protein S11 274
340 4LEL 11 QK, XK 30S ribosomal protein S11 274
341 4V53 10 AK, CK 30S ribosomal protein S11 562
342 2F4V 12 K 30S ribosomal protein S11 274
343 4V9L 10 AK, CK 30S ribosomal protein S11 274
344 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
345 4V56 10 AK, CK 30S ribosomal protein S11 562
346 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
347 4V9J 10 AK, CK 30S ribosomal protein S11 274
348 4V55 10 AK, CK 30S ribosomal protein S11 562
349 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
350 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
351 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
352 4V9M 10 AK, CK 30S ribosomal protein S11 274
353 4W29 10 AK, CK 30S ribosomal protein S11 274
354 4V5Y 10 AK, CK 30S ribosomal protein S11 562
355 4V4Y 13 AN 30S ribosomal protein S11 274
356 4V4J 44 l 30S ribosomal protein S11 274
357 4V4X 13 AN 30S ribosomal protein S11 274
358 4V4Z 14 AN 30S ribosomal protein S11 274
359 4V4I 44 l 30S ribosomal protein S11 274
360 4V4P 46 BN 30S ribosomal protein S11 274
361 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
362 4V4R 14 AK 30S ribosomal protein S11 274
363 4V4S 14 AK 30S ribosomal protein S11 274
364 4V4T 14 AK 30S ribosomal protein S11 274
365 4KZZ 15 O 40S Ribosomal Protein S14 9986
366 4KZX 15 O 40S ribosomal protein S14 9986
367 4KZY 15 O 40S Ribosomal Protein S14 9986
368 4V49 13 AK 30S ribosomal protein S11 562
369 4V4A 11 AK 30S ribosomal protein S11 562
370 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
371 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
372 6MTB 65 OO 40S ribosomal protein S14 9986
373 6MTC 64 OO 40S ribosomal protein S14 9986
374 6MTD 66 OO uS11 9986
375 6MTE 65 OO uS11 9986
376 6HRM 43 p 30S ribosomal protein S11 562
377 6HA1 41 k 30S ribosomal protein S11 1423
378 6HA8 43 k 30S ribosomal protein S11 1423
379 6H58 42 k, kk 30S ribosomal protein S11 562
380 6H4N 11 k 30S ribosomal protein S11 562
381 6DZI 11 t 30S ribosomal protein S11 1772
382 6DZK 11 K 30S ribosomal protein S11 1772
383 6GZX 41 K3, K4 30S ribosomal protein S11 274
384 6GZZ 41 K3, K4 30S ribosomal protein S11 274
385 6GZQ 41 K2 30S ribosomal protein S11 274
386 6GZ3 31 BO ribosomal protein uS11 9986
387 6GZ4 34 BO ribosomal protein uS11 9986
388 6GZ5 31 BO ribosomal protein uS11 9986
389 6GXM 44 k 30S ribosomal protein S11 562
390 6GXN 44 k 30S ribosomal protein S11 562
391 6GXO 44 k 30S ribosomal protein S11 562
392 6GXP 43 k 30S ribosomal protein S11 562
393 6GWT 44 k 30S ribosomal protein S11 562
394 6GSL 11 2A, 2I 30S ribosomal protein S11 274
395 6GQV 62 AE 40S ribosomal protein S14-B 4932
396 6GQ1 62 AE 40S ribosomal protein S14-B 4932
397 6GQB 62 AE 40S ribosomal protein S14-B 4932
398 6DNC 48 XA 30S ribosomal protein S11 562
399 6D9J 64 PP uS11 9986
400 6D90 65 PP uS11 9986
401 5ZLU 17 P 30S ribosomal protein S11 274
402 6G5H 12 O 40S ribosomal protein S14 9606
403 6G5I 16 O 40S ribosomal protein S14 9606
404 6G4S 27 O 40S ribosomal protein S14 9606
405 6G4W 23 O 40S ribosomal protein S14 9606
406 6G51 13 O 40S ribosomal protein S14 9606
407 6G53 13 O 40S ribosomal protein S14 9606
408 6G18 23 O 40S ribosomal protein S14 9606
409 6FYX 18 O 40S ribosomal protein S14 28985
410 6FYY 18 O 40S ribosomal protein S14 28985
411 6FXC 11 Ak, Bk 30S ribosomal protein S11 1280
412 5ZEU 8 k 30S ribosomal protein S11 1772
413 5ZEB 8 k 30S ribosomal protein S11 1772
414 5ZEP 8 k 30S ribosomal protein S11 1772
415 6C4I 44 k 30S ribosomal protein S11 562
416 6FEC 38 j 40S ribosomal protein S14 9606
417 6FAI 25 O 40S ribosomal protein S14-A 4932
418 6BU8 41 K 30S ribosomal protein S11 562
419 6BOH 45 UA, ZC 30S ribosomal protein S11 274
420 6BOK 44 SA, VC 30S ribosomal protein S11 274
421 6ERI 44 BK 30S ribosomal protein S11, chloroplastic 3562
422 6ENU 11 k 30S ribosomal protein S11 562
423 6ENJ 41 k 30S ribosomal protein S11 562
424 6ENF 11 k 30S ribosomal protein S11 562
425 6EML 22 Z 40S ribosomal protein S14-A 4932
426 6B4V 45 TA, XC 30S ribosomal protein S11 274
427 6EK0 75 SO 40S ribosomal protein S14 9606
428 6AZ1 15 O ribosomal protein S11 5661
429 6AWB 16 N 30S ribosomal protein S11 562
430 6AWC 16 N 30S ribosomal protein S11 562
431 6AWD 15 N 30S ribosomal protein S11 562
432 5OT7 17 J 30S ribosomal protein S11 274
433 5OQL 42 t 40S ribosomal protein S14-like protein 209285
434 5OPT 14 V 40S ribosomal protein S14, putative 5693
435 5WLC 40 NG rpS14_uS11 4932
436 5WFK 44 k 30S ribosomal protein S11 562
437 5WFS 44 k 30S ribosomal protein S11 562
438 5WF0 44 k 30S ribosomal protein S11 562
439 5XYU 10 K 30S ribosomal protein S11 1772
440 5XYI 16 O Ribosomal protein S14 5722
441 5WE4 44 k 30S ribosomal protein S11 562
442 5WE6 44 k 30S ribosomal protein S11 562
443 5WDT 44 k 30S ribosomal protein S11 562
444 5XXU 16 O Ribosomal protein uS11 5811
445 5OA3 19 O 40S ribosomal protein S14 9606
446 5O61 45 BK 30S ribosomal protein S11 1772
447 5O5J 11 K 30S ribosomal protein S11 1772
448 5O2R 45 k 30S ribosomal protein S11 562
449 5NWY 45 A 30S ribosomal protein S11 562
450 5VPP 40 QK, XK 30S ribosomal protein S11 274
451 5NP6 14 N 30S ribosomal protein S11 562
452 5NO2 9 K 30S ribosomal protein S11 562
453 5NO3 10 K 30S ribosomal protein S11 562
454 5NO4 10 K 30S ribosomal protein S11 562
455 5NJT 11 K 30S ribosomal protein S11 1423
456 5V93 42 k 30S ribosomal protein S11 1773
457 5NGM 11 Ak 30S ribosomal protein S11 1280
458 5ND8 11 k 30S ribosomal protein S11 1280
459 5ND9 11 k 30S ribosomal protein S11 1280
460 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
461 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
462 5UYK 41 K 30S ribosomal protein S11 562
463 5UYL 41 K 30S ribosomal protein S11 562
464 5UYM 41 K 30S ribosomal protein S11 562
465 5UYN 41 K 30S ribosomal protein S11 562
466 5UYP 41 K 30S ribosomal protein S11 562
467 5UYQ 41 K 30S ribosomal protein S11 562
468 5UZ4 10 K 30S ribosomal protein S11 562
469 5UQ7 42 k 30S ribosomal protein S11 274
470 5UQ8 42 k 30S ribosomal protein S11 274
471 5MYJ 11 AK 30S ribosomal protein S11 1358
472 5MY1 10 K 30S ribosomal protein S11 562
473 5WYJ 45 SP 40S ribosomal protein S14-A 4932
474 5WYK 41 SP 40S ribosomal protein S14-A 4932
475 5U9F 49 K 30S ribosomal protein S11 562
476 5U9G 49 K 30S ribosomal protein S11 562
477 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
478 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
479 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
480 5MGP 42 k 30S ribosomal protein S11 562
481 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
482 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
483 5MDV 48 p 30S ribosomal protein S11 562
484 5MDW 48 p 30S ribosomal protein S11 562
485 5MDY 48 p 30S ribosomal protein S11 562
486 5MDZ 46 p 30S ribosomal protein S11 562
487 5H5U 49 r 30S ribosomal protein S11 562
488 5MC6 27 Z 40S ribosomal protein S14-A 4932
489 5M1J 22 O2 40S ribosomal protein S14-A 4932
490 5LZA 11 k 30S ribosomal protein S11 562
491 5LZB 11 k 30S ribosomal protein S11 562
492 5LZC 11 k 30S ribosomal protein S11 562
493 5LZD 11 k 30S ribosomal protein S11 562
494 5LZE 11 k 30S ribosomal protein S11 562
495 5LZF 11 k 30S ribosomal protein S11 562
496 5TCU 10 S2 30S ribosomal protein S11 1280
497 5T7V 3 S2 30S ribosomal protein S11 1280
498 5T2A 63 AH uS11 5661
499 5T2C 80 AO 40S ribosomal protein S14 9606
500 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
501 5LMO 11 K 30S ribosomal protein S11 274
502 5LMP 11 K 30S ribosomal protein S11 274
503 5LMQ 11 K 30S ribosomal protein S11 274
504 5LMR 11 K 30S ribosomal protein S11 274
505 5LMS 11 K 30S ribosomal protein S11 274
506 5LMT 11 K 30S ribosomal protein S11 274
507 5LMU 11 K 30S ribosomal protein S11 274
508 5LMV 11 K 30S ribosomal protein S11 274
509 5LL6 12 Z 40S ribosomal protein S14-A 4932
510 5LKS 74 SO 40S ribosomal protein S14 9606
511 5LI0 11 k 30S ribosomal protein S11 1280
512 5KPS 42 16 30S ribosomal protein S11 562
513 5KPV 41 15 30S ribosomal protein S11 562
514 5KPW 41 15 30S ribosomal protein S11 562
515 5KPX 41 15 30S ribosomal protein S11 562
516 5KCR 43 1k 30S ribosomal protein S11 562
517 5KCS 45 1k 30S ribosomal protein S11 562
518 5L3P 42 k 30S ribosomal protein S11 562
519 5K0Y 32 j ribosomal protein uS11 9986
520 5JU8 11 AK 30S ribosomal protein S11 562
521 5JUO 64 LB uS11 (yeast S14) 4932
522 5JUP 64 LB uS11 (yeast S14) 4932
523 5JUS 64 LB uS11 (yeast S14) 4932
524 5JUT 64 LB uS11 (yeast S14) 4932
525 5JUU 64 LB uS11 (yeast S14) 4932
526 5JTE 11 AK 30S ribosomal protein S11 562
527 5JPQ 29 w uS11 209285
528 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
529 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
530 5IT7 62 O 40S ribosomal protein S14 28985
531 5IT9 15 O Ribosomal protein uS14 28985
532 5IQR 41 p 30S ribosomal protein S11 562
533 5IMQ 18 O 30S ribosomal protein S11 274
534 5IMR 11 O 30S ribosomal protein S11 274
535 3JCN 42 l 30S ribosomal protein S11 562
536 3JCJ 47 q 30S ribosomal protein S11 562
537 3JCD 10 k 30S ribosomal protein S11 562
538 3JCE 10 k 30S ribosomal protein S11 562
539 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
540 3JBU 10 K 30S ribosomal protein S11 562
541 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 562
542 3JBN 26 P 40S ribosomal protein uS11 5833
543 3JBO 32 P 40S ribosomal protein uS11 5833
544 3JBP 26 P 40S ribosomal protein uS11 5833
545 5A9Z 44 BO 30S ribosomal protein S11 274
546 5AA0 44 BO 30S ribosomal protein S11 274
547 3JAP 18 O uS11 28985
548 3JAQ 18 O uS11 28985
549 3JAM 16 O uS11 28985
550 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
551 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
552 3JAG 66 OO uS11 9986
553 3JAH 66 OO uS11 9986
554 3JAI 66 OO uS11 9986
555 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
556 3JA1 11 SK 30S ribosomal protein S11 562
557 3J9Z 5 SK 30S ribosomal protein S11 562
558 3J9Y 7 k 30S ribosomal protein S11 562
559 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
560 3J9W 11 AK 30S ribosomal protein uS11 1423
561 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
562 5AJ0 64 BO 40S ribosomal protein S14 9606
563 5AFI 11 k 30S ribosomal protein S11 562
564 4UER 21 K US11 4934
565 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
566 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
567 4V3P 9 SK 40S ribosomal protein S14 4565
568 3J81 16 O uS11 28985
569 3J80 12 O uS11 28985
570 3J7P 64 SO Ribosomal protein uS11 9823
571 3J7R 65 SO Ribosomal protein uS11 9823
572 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
573 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
574 3J7A 16 P 40S ribosomal protein uS11 5833
575 3J77 60 14 40S ribosomal protein S14 4932
576 3J78 60 14 40S ribosomal protein S14 4932
577 3J6X 61 14 40S ribosomal protein S14 4932
578 3J6Y 61 14 40S ribosomal protein S14 4932
579 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
580 4V92 17 BO US11 28985
581 4V7E 16 BO 40S ribosomal protein S11 4565
582 4V7D 45 BK 30S ribosomal protein S11 562
583 4V7C 11 AK 30S ribosomal protein S11 562
584 4V7B 11 AK 30S ribosomal protein S11 562
585 4V6Y 10 AK 30S ribosomal protein S11 562
586 4V6Z 10 AK 30S ribosomal protein S11 562
587 4V70 10 AK 30S ribosomal protein S11 562
588 4V71 10 AK 30S ribosomal protein S11 562
589 4V72 10 AK 30S ribosomal protein S11 562
590 4V73 10 AK 30S ribosomal protein S11 562
591 4V74 10 AK 30S ribosomal protein S11 562
592 4V75 10 AK 30S ribosomal protein S11 562
593 4V76 10 AK 30S ribosomal protein S11 562
594 4V77 10 AK 30S ribosomal protein S11 562
595 4V78 10 AK 30S ribosomal protein S11 562
596 4V79 10 AK 30S ribosomal protein S11 562
597 4V7A 10 AK 30S ribosomal protein S11 562
598 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
599 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
600 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
601 4V6W 5 AO 40S ribosomal protein S14 7227
602 4V6X 5 AO 40S ribosomal protein S14 9606
603 4V6V 2 AK 30S ribosomal protein S11 562
604 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
605 4V6U 14 AM 30S ribosomal protein S11P 2261
606 4V6T 11 AK 30S ribosomal protein S11 562
607 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
608 4V6S 47 BM 30S ribosomal protein S11 562
609 4V6P 14 AN 30S ribosomal protein S11 562
610 4V6Q 14 AN 30S ribosomal protein S11 562
611 4V6R 14 AN 30S ribosomal protein S11 562
612 4V6N 48 BN 30S ribosomal protein S11 562
613 4V6O 14 AN 30S ribosomal protein S11 562
614 3J0O 12 K Ribosomal protein S14 9986
615 3J0L 12 K Ribosomal protein S14 9986
616 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
617 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
618 4V6M 15 AK 30S ribosomal protein S11 562
619 4V6K 47 BO 30S ribosomal protein S11 562
620 4V6L 14 AO 30S ribosomal protein S11 562
621 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
622 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
623 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
624 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
625 4V7I 46 BK 30S ribosomal protein S11 562
626 4V7H 10 AK 40S ribosomal protein S14(A) 5541
627 3IY8 6 K 30S ribosomal protein S11 562
628 4V68 7 AK 30S ribosomal protein S11 274
629 4V69 2 AK 30S ribosomal protein S11 562
630 4V65 5 AC 30S ribosomal protein S11 562
631 4V66 5 AC 30S ribosomal protein S11 562
632 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
633 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
634 4V4V 12 AK 30S ribosomal subunit protein S11 562
635 4V4W 12 AK 30S ribosomal subunit protein S11 562
636 1X18 7 G 30S ribosomal protein S11 274
637 4V4B 11 AK 40S ribosomal protein S14-A 4932
638 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
639 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
640 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
641 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
642 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
643 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
644 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274