Sequence Similarity Clusters for the Entities in PDB 4B3R

Entity #1 | Chains: A
16S RIBOSOMAL RNA rna, length: 1521 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: J
30S RIBOSOMAL PROTEIN S10 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 312 37
95 % 93 312 52 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
PDBFlex
90 % 93 312 56
70 % 93 312 67
50 % 119 498 21
40 % 130 635 21
30 % 130 637 36
Entity #11 | Chains: K
30S RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 313 34
95 % 93 313 49 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
PDBFlex
90 % 93 313 53
70 % 93 313 65
50 % 113 492 29
40 % 126 640 20
30 % 126 640 35
Entity #12 | Chains: L
30S RIBOSOMAL PROTEIN S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 80 280 46
95 % 93 320 40 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
PDBFlex
90 % 93 320 44
70 % 114 507 14
50 % 114 510 20
40 % 114 510 34
30 % 114 510 54
Entity #13 | Chains: M
30S RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 314 31
95 % 93 314 45 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
PDBFlex
90 % 93 314 50
70 % 93 314 61
50 % 114 496 28
40 % 114 496 39
30 % 125 641 38
Entity #14 | Chains: N
30S RIBOSOMAL PROTEIN S14 TYPE Z protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 312 36
95 % 93 312 51 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
PDBFlex
90 % 93 312 55
70 % 93 319 54
50 % 93 330 90
40 % 93 330 108
30 % 93 330 120
Entity #15 | Chains: O
30S RIBOSOMAL PROTEIN S15 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 318 25
95 % 96 321 39 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 96 321 43
70 % 96 321 53
50 % 119 504 22
40 % 119 509 33
30 % 119 509 53
Entity #16 | Chains: P
30S RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 308 38
95 % 93 313 47 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
PDBFlex
90 % 93 313 51
70 % 93 313 62
50 % 93 325 93
40 % 114 489 42
30 % 114 489 62
Entity #17 | Chains: Q
30S RIBOSOMAL PROTEIN S17 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 40 923
95 % 93 310 54 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 0.7
PDBFlex
90 % 93 310 58
70 % 93 310 69
50 % 93 310 98
40 % 93 310 116
30 % 93 310 128
Entity #18 | Chains: R
30S RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 252 53
95 % 84 260 66 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
PDBFlex
90 % 84 260 71
70 % 84 260 86
50 % 84 260 114
40 % 84 260 138
30 % 84 260 150
Entity #19 | Chains: S
30S RIBOSOMAL PROTEIN S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 316 28
95 % 94 316 42 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
PDBFlex
90 % 94 316 47
70 % 114 492 16
50 % 114 498 25
40 % 114 501 35
30 % 114 501 57
Entity #2 | Chains: B
30S RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 313 30
95 % 93 314 44 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.6
PDBFlex
90 % 93 314 49
70 % 93 314 60
50 % 113 478 34
40 % 113 484 44
30 % 113 484 63
Entity #20 | Chains: T
30S RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 87 267 49
95 % 93 312 53 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
PDBFlex
90 % 93 312 57
70 % 93 312 68
50 % 93 312 97
40 % 93 312 115
30 % 93 312 126
Entity #21 | Chains: V
30S RIBOSOMAL PROTEIN THX protein, length: 26 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 302 42
95 % 93 302 55 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
PDBFlex
90 % 93 302 59
70 % 93 302 72
50 % 93 302 100
40 % 93 302 119
30 % 93 302 132
Entity #22 | Chains: W
5'-R(*UP*UP*CP*AP*AP*AP)-3' rna, length: 6 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #23 | Chains: Z
5'-R(*GP*GP*GP*AP*UP*UP*GP*AP*AP*AP*AP*UP*CP*CP*CP-3' rna, length: 16 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #3 | Chains: C
30S RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 84 260 51
95 % 84 260 65 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 84 260 70
70 % 84 260 85
50 % 87 336 89
40 % 87 336 106
30 % 87 336 119
Entity #4 | Chains: D
30S RIBOSOMAL PROTEIN S4 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 314 29
95 % 93 314 43 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
PDBFlex
90 % 93 314 48
70 % 93 314 59
50 % 113 492 27
40 % 113 498 37
30 % 113 498 59
Entity #5 | Chains: E
30S RIBOSOMAL PROTEIN S5 protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 313 33
95 % 93 313 48 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
PDBFlex
90 % 93 313 52
70 % 93 313 63
50 % 114 488 31
40 % 114 488 41
30 % 114 490 61
Entity #6 | Chains: F
30S RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 318 26
95 % 100 324 36 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 0.9
PDBFlex
90 % 100 324 42
70 % 100 324 52
50 % 100 324 91
40 % 100 324 109
30 % 119 428 84
Entity #7 | Chains: G
30S RIBOSOMAL PROTEIN S7 protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 318 27
95 % 94 318 41 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
PDBFlex
90 % 94 318 45
70 % 94 318 55
50 % 113 431 58
40 % 113 437 68
30 % 113 437 83
Entity #8 | Chains: H
30S RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 313 32
95 % 94 313 46 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
PDBFlex
90 % 94 317 46
70 % 94 317 57
50 % 116 497 24
40 % 129 657 19
30 % 129 657 34
Entity #9 | Chains: I
30S RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 96 246
95 % 93 313 50 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
PDBFlex
90 % 93 313 54
70 % 93 313 66
50 % 113 483 33
40 % 113 483 45
30 % 124 639 37

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 6CFL 42 1k, 2k 30S ribosomal protein S11 274
8 6CAE 42 1k, 2k 30S ribosomal protein S11 274
9 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
10 5FDV 43 1k, 2k 30S ribosomal protein S11 274
11 5J4B 42 1k, 2k 30S ribosomal protein S11 274
12 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
13 6CFK 42 1k, 2k 30S ribosomal protein S11 274
14 5J7L 11 AK, BK 30S ribosomal protein S11 562
15 5W4K 42 1k, 2k 30S ribosomal protein S11 274
16 4LFB 11 K ribosomal protein S11 274
17 1VY4 11 AK, CK 30S ribosomal protein S11 274
18 4WOI 11 AK, DK 30S ribosomal protein S11 562
19 5FDU 42 1k, 2k 30S ribosomal protein S11 274
20 6I7V 15 AK, BK 30S ribosomal protein S11 562
21 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
22 5JC9 11 AK, BK 30S ribosomal protein S11 562
23 1VY5 11 AK, CK 30S ribosomal protein S11 274
24 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
25 4WQF 44 BK, DK 30S ribosomal protein S11 274
26 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
27 4WPO 44 BK, DK 30S ribosomal protein S11 274
28 5J8A 11 AK, BK 30S ribosomal protein S11 562
29 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
30 4JI1 11 K RIBOSOMAL PROTEIN S11 274
31 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
32 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
33 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
34 5J5B 11 AK, BK 30S ribosomal protein S11 562
35 5HD1 42 1k, 2k 30S ribosomal protein S11 274
36 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
37 4DR6 11 K 30S ribosomal protein S11 274
38 4LF7 11 K ribosomal protein S11 274
39 4LF8 11 K ribosomal protein S11 274
40 5WIS 42 1k, 2k 30S ribosomal protein S11 274
41 4WSD 11 2A, 2I 30S ribosomal protein S11 274
42 4WQU 44 BK, DK 30S ribosomal protein S11 274
43 5WIT 42 1k, 2k 30S ribosomal protein S11 274
44 5E81 11 2A, 2I 30S ribosomal protein S11 274
45 2VQE 11 K 30S RIBOSOMAL PROTEIN S11 274
46 6GSJ 11 2A, 2I 30S ribosomal protein S11 274
47 4U27 11 AK, CK 30S ribosomal protein S11 562
48 6CFJ 42 1k, 2k 30S ribosomal protein S11 274
49 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
50 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
51 5HCR 42 1k, 2k 30S ribosomal protein S11 274
52 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
53 2UUB 11 K 30S RIBOSOMAL PROTEIN S11 274
54 4DV6 11 K ribosomal protein S11 274
55 4JYA 11 K 30S ribosomal protein S11 274
56 5IBB 11 2A, 2I 30S ribosomal protein S11 274
57 4DR5 11 K 30S ribosomal protein S11 274
58 5J4C 42 1k, 2k 30S ribosomal protein S11 274
59 4KHP 11 K 30S Ribosomal protein S11 274
60 4DR2 11 K 30S ribosomal protein S11 274
61 4WRO 15 2I 30S ribosomal protein S11 274
62 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
63 4LF9 11 K ribosomal protein S11 274
64 4WQY 44 BK, DK 30S ribosomal protein S11 274
65 4DUY 11 K ribosomal protein S11 274
66 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
67 4DV7 11 K ribosomal protein S11 274
68 4WRA 11 2A, 2I 30S ribosomal protein S11 274
69 5IB7 11 2A, 2I 30S ribosomal protein S11 274
70 4U26 11 AK, CK 30S ribosomal protein S11 562
71 4X64 11 K 30S ribosomal protein S11 274
72 5HCP 42 1k, 2k 30S ribosomal protein S11 274
73 5IT8 11 AK, BK 30S ribosomal protein S11 562
74 4V9D 11 AK, BK 30S ribosomal protein S11 562
75 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
76 4V9H 5 AK 30S ribosomal protein S11 274
77 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
78 5J91 11 AK, BK 30S ribosomal protein S11 562
79 4V8D 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
80 5WNT 11 K RIBOSOMAL PROTEIN S11 274
81 4DR3 11 K 30S ribosomal protein S11 274
82 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
83 4JI3 11 K RIBOSOMAL PROTEIN S11 274
84 4WQR 11 2A, 2I 30S ribosomal protein S11 274
85 4JI6 11 K RIBOSOMAL PROTEIN S11 274
86 4JI8 11 K RIBOSOMAL PROTEIN S11 274
87 2UXC 11 K RIBOSOMAL PROTEIN S11 274
88 5IB8 11 2A, 2I 30S ribosomal protein S11 274
89 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
90 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
91 5EL6 11 2A, 2I 30S ribosomal protein S11 274
92 5EL7 11 2A, 2I 30S ribosomal protein S11 274
93 5VP2 42 1k, 2k 30S ribosomal protein S11 274
94 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
95 4LF4 11 K ribosomal protein S11 274
96 5DFE 45 QK, XK 30S ribosomal protein S11 274
97 5NDK 6 2A, 2I 30S ribosomal protein S11 274
98 4LF6 11 K ribosomal protein S11 274
99 4JI7 11 K RIBOSOMAL PROTEIN S11 274
100 5J88 11 AK, BK 30S ribosomal protein S11 562
101 4U24 11 AK, CK 30S ribosomal protein S11 562
102 4WU1 11 2A, 2I 30S ribosomal protein S11 274
103 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
104 5EL4 11 2A, 2I 30S ribosomal protein S11 274
105 5WNV 11 K 30S ribosomal protein S11 274
106 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
107 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
108 4WR6 11 2A, 2I 30S ribosomal protein S11 274
109 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
110 5HAU 44 1k, 2k 30S ribosomal protein S11 274
111 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
112 2VQF 11 K 30S RIBOSOMAL PROTEIN S11 274
113 2UUA 11 K 30S RIBOSOMAL PROTEIN S11 274
114 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
115 4WF1 11 AK, CK 30S ribosomal protein S11 562
116 4U25 11 AK, CK 30S ribosomal protein S11 562
117 4V95 11 AK, CK 30S Ribosomal Protein S11 274
118 4WWW 42 QK, XK 30S ribosomal protein S11 562
119 4V7T 11 AK, CK 30S ribosomal protein S11 562
120 1VY7 11 AK, CK 30S ribosomal protein S11 274
121 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
122 5E7K 11 2A, 2I 30S ribosomal protein S11 274
123 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
124 5EL5 11 2A, 2I 30S ribosomal protein S11 274
125 6FKR 42 1k, 2k 30S ribosomal protein S11 274
126 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
127 4LNT 11 QK, XK 30S ribosomal protein S11 274
128 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
129 4DR1 11 K 30S ribosomal protein S11 274
130 4LFA 11 K ribosomal protein S11 274
131 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
132 4DV4 11 K ribosomal protein S11 274
133 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
134 4YZV 11 QK, XK 30S ribosomal protein S11 274
135 4JI0 11 K ribosomal protein S11 274
136 5IWA 10 K 30S ribosomal protein S11 274
137 4V7U 11 AK, CK 30S ribosomal protein S11 562
138 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
139 4JI2 11 K RIBOSOMAL PROTEIN S11 274
140 4V6C 10 AK, CK 30S ribosomal protein S11 562
141 4JV5 11 K 30S ribosomal protein S11 274
142 4DR7 11 K 30S ribosomal protein S11 274
143 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
144 4GKK 11 K 30S ribosomal protein S11 274
145 4DUZ 11 K ribosomal protein S11 274
146 5NDJ 6 2A, 2I 30S ribosomal protein S11 274
147 4V7V 11 AK, CK 30S ribosomal protein S11 562
148 4X65 11 K 30S ribosomal protein S11 274
149 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
150 4GKJ 11 K 30S ribosomal protein S11 274
151 4DV3 11 K ribosomal protein S11 274
152 4V7S 11 AK, CK 30S ribosomal protein S11 562
153 4DV5 11 K ribosomal protein S11 274
154 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
155 2UUC 11 K 30S RIBOSOMAL PROTEIN S11 274
156 4LFC 11 K ribosomal protein S11 274
157 1FJG 12 K 30S RIBOSOMAL PROTEIN S11 274
158 3T1Y 11 K 30S ribosomal protein S11 274
159 4WZO 11 2A, 2I 30S ribosomal protein S11 274
160 4JI4 11 K RIBOSOMAL PROTEIN S11 274
161 1VY6 11 AK, CK 30S ribosomal protein S11 274
162 1XMQ 13 K 30S Ribosomal Protein S11 274
163 5WNP 11 K 30S ribosomal protein S11 274
164 6CAP 11 K 30S ribosomal protein S11 274
165 4U20 11 AK, CK 30S ribosomal protein S11 562
166 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
167 4DV0 11 K ribosomal protein S11 274
168 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
169 4U1V 11 AK, CK 30S ribosomal protein S11 562
170 4V6F 41 BN, CN 30S ribosomal protein S11 274
171 4X62 11 K 30S ribosomal protein S11 274
172 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
173 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
174 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
175 4DV2 11 K ribosomal protein S11 274
176 4DV1 11 K ribosomal protein S11 274
177 5WNU 11 K 30S ribosomal protein S11 274
178 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
179 5F8K 42 1k, 2k 30S ribosomal protein S11 274
180 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
181 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
182 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
183 4JI5 11 K RIBOSOMAL PROTEIN S11 274
184 6CAQ 11 K 30S ribosomal protein S11 274
185 4K0K 11 K 30S ribosomal protein S11 274
186 4W2E 44 k 30S ribosomal protein S11 274
187 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
188 5BR8 11 K 30S ribosomal protein S11 274
189 4LF5 11 K ribosomal protein S11 274
190 5J4D 45 TA, YC 30S ribosomal protein S11 274
191 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
192 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
193 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
194 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
195 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
196 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
197 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
198 4V7Y 11 AK, CK 30S ribosomal protein S11 274
199 6GSK 11 2A, 2I 30S ribosomal protein S11 274
200 4V9C 11 AK, CK 30S ribosomal protein S11 562
201 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
202 5J30 42 QK, XK 30S ribosomal protein S11 274
203 4DR4 11 K 30S ribosomal protein S11 274
204 4WZD 11 2A, 2I 30S ribosomal protein S11 274
205 3OTO 11 K 30S RIBOSOMAL PROTEIN S11 274
206 4X66 11 K 30S ribosomal protein S11 274
207 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
208 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
209 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
210 4V85 11 AK 30S ribosomal protein S11 562
211 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
212 4AQY 11 K 30S RIBOSOMAL PROTEIN S11 274
213 4W4G 11 QK, XK 30S ribosomal protein S11 274
214 4NXM 11 K ribosomal protein S11 274
215 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
216 4YPB 11 QK, XK 30S ribosomal protein S11 274
217 4V7X 11 AK, CK 30S ribosomal protein S11 274
218 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
219 4U1U 11 AK, CK 30S ribosomal protein S11 562
220 4ZER 42 1k, 2k 30S ribosomal protein S11 274
221 1IBL 14 K 30S RIBOSOMAL PROTEIN S11 274
222 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
223 4V7W 11 AK, CK 30S ribosomal protein S11 274
224 4WT1 11 2A, 2I 30S ribosomal protein S11 274
225 6C5L 11 AK, CK 30S ribosomal protein S11 274
226 4WT8 11 AK, BK 30S ribosomal protein S11 274
227 5DOX 42 1k, 2k 30S ribosomal protein S11 274
228 4NXN 11 K ribosomal protein S11 274
229 1XNR 13 K 16S Ribosomal protein S11 274
230 4LT8 11 QK, XK 30S ribosomal protein S11 274
231 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
232 5WNQ 11 K 30S ribosomal protein S11 274
233 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
234 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
235 4V7L 11 AK, CK 30S ribosomal protein S11 274
236 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
237 1HNZ 12 K 30S RIBOSOMAL PROTEIN S11 274
238 1XNQ 13 K Ribosomal protein S11 274
239 4V8A 41 CK, DK 30S ribosomal protein S11 274
240 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
241 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
242 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
243 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
244 6BZ6 11 QK, XK 30S ribosomal protein S11 274
245 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
246 5J3C 42 QK, XK 30S ribosomal protein S11 274
247 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
248 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
249 4L47 11 QK, XK 30S ribosomal protein S11 274
250 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
251 5V8I 42 1k, 2k 30S ribosomal protein S11 274
252 4ZSN 11 QK, XK 30S ribosomal protein S11 274
253 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
254 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
255 6BUW 11 QK, XK 30S ribosomal protein S11 274
256 4V7Z 11 AK, CK 30S ribosomal protein S11 274
257 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
258 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
259 4V9I 11 AK, CK 30S Ribosomal protein S11 274
260 1XMO 13 K 30S ribosomal protein S11 274
261 3T1H 11 K 30S ribosomal protein S11 274
262 2UXD 11 K RIBOSOMAL PROTEIN S11 274
263 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
264 1IBK 12 K 30S RIBOSOMAL PROTEIN S11 274
265 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
266 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
267 4V97 11 AK, CK 30S ribosomal protein S11 274
268 6CAR 11 K 30S ribosomal protein S11 274
269 1HNW 12 K 30S RIBOSOMAL PROTEIN S11 274
270 4V7M 11 AK, CK 30S ribosomal protein S11 274
271 4WSM 11 2A, 2I 30S ribosomal protein S11 274
272 4TUD 11 QK, XK 30S ribosomal protein S11 274
273 1IBM 14 K 30S RIBOSOMAL PROTEIN S11 274
274 5WNR 11 K 30S ribosomal protein S11 274
275 6CAO 11 K 30S ribosomal protein S11 274
276 4V6A 11 AK, CK 30S ribosomal protein S11 274
277 4TUE 11 QK, XK 30S ribosomal protein S11 274
278 4TUA 11 QK, XK 30S ribosomal protein S11 274
279 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
280 4V84 11 AK, CK 30S ribosomal protein S11 274
281 5WNS 11 K 30S ribosomal protein S11 274
282 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
283 4YY3 11 K 30S ribosomal protein S11 274
284 1HNX 12 K 30S RIBOSOMAL PROTEIN S11 274
285 4V9Q 41 BK, DK 30S ribosomal protein S11 274
286 6BZ8 11 QK, XK 30S ribosomal protein S11 274
287 4TUC 11 QK, XK 30S ribosomal protein S11 274
288 4YHH 11 K 30S ribosomal protein S11 274
289 5VPO 12 QK, XK 30S ribosomal protein S11 274
290 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
291 4TUB 11 QK, XK 30S ribosomal protein S11 274
292 4V9N 14 AK, CK 30S ribosomal protein S11 274
293 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
294 4P70 11 QK, XK 30S ribosomal protein S11 274
295 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
296 4LSK 11 QK, XK 30S ribosomal protein S11 274
297 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
298 4V6D 10 AK, CK 30S ribosomal protein S11 562
299 4P6F 11 QK, XK 30S ribosomal protein S11 274
300 4V67 13 AK, CK 30S ribosomal protein S11 274
301 4V83 11 AK, CK 30S ribosomal protein S11 274
302 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
303 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
304 4V5O 20 AK, BK RPS14E 5911
305 1VVJ 11 QK, XK 30S ribosomal protein S11 274
306 4LFZ 11 QK, XK 30S ribosomal protein S11 274
307 2E5L 12 K 30S ribosomal protein S11 274
308 6BZ7 11 QK, XK 30S ribosomal protein S11 274
309 4V6E 10 AK, CK 30S ribosomal protein S11 562
310 6CAS 11 K 30S ribosomal protein S11 274
311 4V52 10 AK, CK 30S ribosomal protein S11 562
312 5CZP 42 QK, XK 30S ribosomal protein S11 274
313 2HHH 11 K 30S ribosomal protein S11 274
314 4V89 11 AK 30S ribosomal protein S11 562
315 4OX9 11 K 30S ribosomal protein S11 274
316 4V54 10 AK, CK 30S ribosomal protein S11 562
317 2UXB 11 K RIBOSOMAL PROTEIN S11 274
318 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
319 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
320 4V9K 10 AK, CK 30S ribosomal protein S11 274
321 4V50 13 AK, CK 30S ribosomal protein S11 562
322 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
323 4V57 10 AK, CK 30S ribosomal protein S11 562
324 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
325 4V63 13 AK, CK 30S ribosomal protein S11 274
326 4L71 11 QK, XK 30S ribosomal protein S11 274
327 4KVB 11 K 30S ribosomal protein S11 274
328 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
329 4V64 10 AK, CK 30S ribosomal protein S11 562
330 4V7P 11 AK, DK 30S ribosomal protein S11 274
331 4V8J 11 AK, CK 30S ribosomal protein S11 274
332 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
333 2ZM6 11 K 30S ribosomal protein S11 274
334 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
335 4V4Q 10 AK, CK 30S ribosomal protein S11 562
336 4V5B 43 BK, DK 30S RIBOSOMAL PROTEIN S11 RESIDUES 2-129 562
337 5D8B 38 HC, LA 30S ribosomal protein S11 274
338 4LEL 11 QK, XK 30S ribosomal protein S11 274
339 4V53 10 AK, CK 30S ribosomal protein S11 562
340 2F4V 12 K 30S ribosomal protein S11 274
341 4V9L 10 AK, CK 30S ribosomal protein S11 274
342 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
343 4V56 10 AK, CK 30S ribosomal protein S11 562
344 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
345 4V9J 10 AK, CK 30S ribosomal protein S11 274
346 4V55 10 AK, CK 30S ribosomal protein S11 562
347 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
348 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
349 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
350 4V9M 10 AK, CK 30S ribosomal protein S11 274
351 4W29 10 AK, CK 30S ribosomal protein S11 274
352 4V5Y 10 AK, CK 30S ribosomal protein S11 562
353 4V4Y 13 AN 30S ribosomal protein S11 274
354 4V4J 44 l 30S ribosomal protein S11 274
355 4V4X 13 AN 30S ribosomal protein S11 274
356 4V4Z 14 AN 30S ribosomal protein S11 274
357 4V4I 44 l 30S ribosomal protein S11 274
358 4V4P 46 BN 30S ribosomal protein S11 274
359 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
360 4V4R 14 AK 30S ribosomal protein S11 274
361 4V4S 14 AK 30S ribosomal protein S11 274
362 4V4T 14 AK 30S ribosomal protein S11 274
363 4KZZ 15 O 40S Ribosomal Protein S14 9986
364 4KZX 15 O 40S ribosomal protein S14 9986
365 4KZY 15 O 40S Ribosomal Protein S14 9986
366 4V49 13 AK 30S ribosomal protein S11 562
367 4V4A 11 AK 30S ribosomal protein S11 562
368 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
369 6MTB 65 OO 40S ribosomal protein S14 9986
370 6MTC 64 OO 40S ribosomal protein S14 9986
371 6MTD 66 OO uS11 9986
372 6MTE 65 OO uS11 9986
373 6HA1 41 k 30S ribosomal protein S11 1423
374 6HA8 43 k 30S ribosomal protein S11 1423
375 6H58 42 k, kk 30S ribosomal protein S11 562
376 6H4N 11 k 30S ribosomal protein S11 562
377 6DZI 11 t 30S ribosomal protein S11 1772
378 6DZK 11 K 30S ribosomal protein S11 1772
379 6GZX 41 K3, K4 30S ribosomal protein S11 274
380 6GZZ 41 K3, K4 30S ribosomal protein S11 274
381 6GZQ 41 K2 30S ribosomal protein S11 274
382 6GZ3 31 BO ribosomal protein uS11 9986
383 6GZ4 34 BO ribosomal protein uS11 9986
384 6GZ5 31 BO ribosomal protein uS11 9986
385 6GXM 44 k 30S ribosomal protein S11 562
386 6GXN 44 k 30S ribosomal protein S11 562
387 6GXO 44 k 30S ribosomal protein S11 562
388 6GXP 43 k 30S ribosomal protein S11 562
389 6GWT 44 k 30S ribosomal protein S11 562
390 6GSL 11 2A, 2I 30S ribosomal protein S11 274
391 6GQV 62 AE 40S ribosomal protein S14-B 4932
392 6GQ1 62 AE 40S ribosomal protein S14-B 4932
393 6GQB 62 AE 40S ribosomal protein S14-B 4932
394 6DNC 48 XA 30S ribosomal protein S11 562
395 6D9J 64 PP uS11 9986
396 6D90 65 PP uS11 9986
397 5ZLU 17 P 30S ribosomal protein S11 274
398 6G5H 12 O 40S ribosomal protein S14 9606
399 6G5I 16 O 40S ribosomal protein S14 9606
400 6G4S 27 O 40S ribosomal protein S14 9606
401 6G4W 23 O 40S ribosomal protein S14 9606
402 6G51 13 O 40S ribosomal protein S14 9606
403 6G53 13 O 40S ribosomal protein S14 9606
404 6G18 23 O 40S ribosomal protein S14 9606
405 6FYX 18 O 40S ribosomal protein S14 28985
406 6FYY 18 O 40S ribosomal protein S14 28985
407 6FXC 11 Ak, Bk 30S ribosomal protein S11 1280
408 5ZEU 8 k 30S ribosomal protein S11 1772
409 5ZEB 8 k 30S ribosomal protein S11 1772
410 5ZEP 8 k 30S ribosomal protein S11 1772
411 6C4I 44 k 30S ribosomal protein S11 562
412 6FEC 38 j 40S ribosomal protein S14 9606
413 6FAI 25 O 40S ribosomal protein S14-A 4932
414 6BU8 41 K 30S ribosomal protein S11 562
415 6BOH 45 UA, ZC 30S ribosomal protein S11 274
416 6BOK 44 SA, VC 30S ribosomal protein S11 274
417 6ERI 44 BK 30S ribosomal protein S11, chloroplastic 3562
418 6ENU 11 k 30S ribosomal protein S11 562
419 6ENJ 41 k 30S ribosomal protein S11 562
420 6ENF 11 k 30S ribosomal protein S11 562
421 6EML 22 Z 40S ribosomal protein S14-A 4932
422 6B4V 45 TA, XC 30S ribosomal protein S11 274
423 6EK0 75 SO 40S ribosomal protein S14 9606
424 6AZ1 15 O ribosomal protein S11 5661
425 6AWB 16 N 30S ribosomal protein S11 562
426 6AWC 16 N 30S ribosomal protein S11 562
427 6AWD 15 N 30S ribosomal protein S11 562
428 5OT7 17 J 30S ribosomal protein S11 274
429 5OQL 42 t 40S ribosomal protein S14-like protein 209285
430 5OPT 14 V 40S ribosomal protein S14, putative 5693
431 5WLC 40 NG rpS14_uS11 4932
432 5WFK 44 k 30S ribosomal protein S11 562
433 5WFS 44 k 30S ribosomal protein S11 562
434 5WF0 44 k 30S ribosomal protein S11 562
435 5XYU 10 K 30S ribosomal protein S11 1772
436 5XYI 16 O Ribosomal protein S14 5722
437 5WE4 44 k 30S ribosomal protein S11 562
438 5WE6 44 k 30S ribosomal protein S11 562
439 5WDT 44 k 30S ribosomal protein S11 562
440 5XXU 16 O Ribosomal protein uS11 5811
441 5OA3 19 O 40S ribosomal protein S14 9606
442 5O61 45 BK 30S ribosomal protein S11 1772
443 5O5J 11 K 30S ribosomal protein S11 1772
444 5O2R 45 k 30S ribosomal protein S11 562
445 5NWY 45 A 30S ribosomal protein S11 562
446 5VPP 40 QK, XK 30S ribosomal protein S11 274
447 5NP6 14 N 30S ribosomal protein S11 562
448 5NO2 9 K 30S ribosomal protein S11 562
449 5NO3 10 K 30S ribosomal protein S11 562
450 5NO4 10 K 30S ribosomal protein S11 562
451 5NJT 11 K 30S ribosomal protein S11 1423
452 5V93 42 k 30S ribosomal protein S11 1773
453 5NGM 11 Ak 30S ribosomal protein S11 1280
454 5ND8 11 k 30S ribosomal protein S11 1280
455 5ND9 11 k 30S ribosomal protein S11 1280
456 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
457 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
458 5UYK 41 K 30S ribosomal protein S11 562
459 5UYL 41 K 30S ribosomal protein S11 562
460 5UYM 41 K 30S ribosomal protein S11 562
461 5UYN 41 K 30S ribosomal protein S11 562
462 5UYP 41 K 30S ribosomal protein S11 562
463 5UYQ 41 K 30S ribosomal protein S11 562
464 5UZ4 10 K 30S ribosomal protein S11 562
465 5UQ7 42 k 30S ribosomal protein S11 274
466 5UQ8 42 k 30S ribosomal protein S11 274
467 5MYJ 11 AK 30S ribosomal protein S11 1358
468 5MY1 10 K 30S ribosomal protein S11 562
469 5WYJ 45 SP 40S ribosomal protein S14-A 4932
470 5WYK 41 SP 40S ribosomal protein S14-A 4932
471 5U9F 49 K 30S ribosomal protein S11 562
472 5U9G 49 K 30S ribosomal protein S11 562
473 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
474 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
475 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
476 5MGP 42 k 30S ribosomal protein S11 562
477 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
478 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
479 5MDV 48 p 30S ribosomal protein S11 562
480 5MDW 48 p 30S ribosomal protein S11 562
481 5MDY 48 p 30S ribosomal protein S11 562
482 5MDZ 46 p 30S ribosomal protein S11 562
483 5H5U 49 r 30S ribosomal protein S11 562
484 5MC6 27 Z 40S ribosomal protein S14-A 4932
485 5M1J 22 O2 40S ribosomal protein S14-A 4932
486 5LZA 11 k 30S ribosomal protein S11 562
487 5LZB 11 k 30S ribosomal protein S11 562
488 5LZC 11 k 30S ribosomal protein S11 562
489 5LZD 11 k 30S ribosomal protein S11 562
490 5LZE 11 k 30S ribosomal protein S11 562
491 5LZF 11 k 30S ribosomal protein S11 562
492 5TCU 10 S2 30S ribosomal protein S11 1280
493 5T7V 3 S2 30S ribosomal protein S11 1280
494 5T2A 63 AH uS11 5661
495 5T2C 80 AO 40S ribosomal protein S14 9606
496 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
497 5LMO 11 K 30S ribosomal protein S11 274
498 5LMP 11 K 30S ribosomal protein S11 274
499 5LMQ 11 K 30S ribosomal protein S11 274
500 5LMR 11 K 30S ribosomal protein S11 274
501 5LMS 11 K 30S ribosomal protein S11 274
502 5LMT 11 K 30S ribosomal protein S11 274
503 5LMU 11 K 30S ribosomal protein S11 274
504 5LMV 11 K 30S ribosomal protein S11 274
505 5LL6 12 Z 40S ribosomal protein S14-A 4932
506 5LKS 74 SO 40S ribosomal protein S14 9606
507 5LI0 11 k 30S ribosomal protein S11 1280
508 5KPS 42 16 30S ribosomal protein S11 562
509 5KPV 41 15 30S ribosomal protein S11 562
510 5KPW 41 15 30S ribosomal protein S11 562
511 5KPX 41 15 30S ribosomal protein S11 562
512 5KCR 43 1k 30S ribosomal protein S11 562
513 5KCS 45 1k 30S ribosomal protein S11 562
514 5L3P 42 k 30S ribosomal protein S11 562
515 5K0Y 32 j ribosomal protein uS11 9986
516 5JU8 11 AK 30S ribosomal protein S11 562
517 5JUO 64 LB uS11 (yeast S14) 4932
518 5JUP 64 LB uS11 (yeast S14) 4932
519 5JUS 64 LB uS11 (yeast S14) 4932
520 5JUT 64 LB uS11 (yeast S14) 4932
521 5JUU 64 LB uS11 (yeast S14) 4932
522 5JTE 11 AK 30S ribosomal protein S11 562
523 5JPQ 29 w uS11 209285
524 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
525 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
526 5IT7 62 O 40S ribosomal protein S14 28985
527 5IT9 15 O Ribosomal protein uS14 28985
528 5IQR 41 p 30S ribosomal protein S11 562
529 5IMQ 18 O 30S ribosomal protein S11 274
530 5IMR 11 O 30S ribosomal protein S11 274
531 3JCN 42 l 30S ribosomal protein S11 562
532 3JCJ 47 q 30S ribosomal protein S11 562
533 3JCD 10 k 30S ribosomal protein S11 562
534 3JCE 10 k 30S ribosomal protein S11 562
535 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
536 3JBU 10 K 30S ribosomal protein S11 562
537 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 562
538 3JBN 26 P 40S ribosomal protein uS11 5833
539 3JBO 32 P 40S ribosomal protein uS11 5833
540 3JBP 26 P 40S ribosomal protein uS11 5833
541 5A9Z 44 BO 30S ribosomal protein S11 274
542 5AA0 44 BO 30S ribosomal protein S11 274
543 3JAP 18 O uS11 28985
544 3JAQ 18 O uS11 28985
545 3JAM 16 O uS11 28985
546 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
547 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
548 3JAG 66 OO uS11 9986
549 3JAH 66 OO uS11 9986
550 3JAI 66 OO uS11 9986
551 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
552 3JA1 11 SK 30S ribosomal protein S11 562
553 3J9Z 5 SK 30S ribosomal protein S11 562
554 3J9Y 7 k 30S ribosomal protein S11 562
555 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
556 3J9W 11 AK 30S ribosomal protein uS11 1423
557 5AJ4 9 AK MITORIBOSOMAL PROTEIN US11M, MRPS11 9823
558 5AJ0 64 BO 40S ribosomal protein S14 9606
559 5AFI 11 k 30S ribosomal protein S11 562
560 4UER 21 K US11 4934
561 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
562 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
563 4V3P 9 SK 40S ribosomal protein S14 4565
564 3J81 16 O uS11 28985
565 3J80 12 O uS11 28985
566 3J7P 64 SO Ribosomal protein uS11 9823
567 3J7R 65 SO Ribosomal protein uS11 9823
568 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
569 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
570 3J7A 16 P 40S ribosomal protein uS11 5833
571 3J77 60 14 40S ribosomal protein S14 4932
572 3J78 60 14 40S ribosomal protein S14 4932
573 3J6X 61 14 40S ribosomal protein S14 4932
574 3J6Y 61 14 40S ribosomal protein S14 4932
575 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
576 4V92 17 BO US11 28985
577 4V7E 16 BO 40S ribosomal protein S11 4565
578 4V7D 45 BK 30S ribosomal protein S11 562
579 4V7C 11 AK 30S ribosomal protein S11 562
580 4V7B 11 AK 30S ribosomal protein S11 562
581 4V6Y 10 AK 30S ribosomal protein S11 562
582 4V6Z 10 AK 30S ribosomal protein S11 562
583 4V70 10 AK 30S ribosomal protein S11 562
584 4V71 10 AK 30S ribosomal protein S11 562
585 4V72 10 AK 30S ribosomal protein S11 562
586 4V73 10 AK 30S ribosomal protein S11 562
587 4V74 10 AK 30S ribosomal protein S11 562
588 4V75 10 AK 30S ribosomal protein S11 562
589 4V76 10 AK 30S ribosomal protein S11 562
590 4V77 10 AK 30S ribosomal protein S11 562
591 4V78 10 AK 30S ribosomal protein S11 562
592 4V79 10 AK 30S ribosomal protein S11 562
593 4V7A 10 AK 30S ribosomal protein S11 562
594 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
595 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
596 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
597 4V6W 5 AO 40S ribosomal protein S14 7227
598 4V6X 5 AO 40S ribosomal protein S14 9606
599 4V6V 2 AK 30S ribosomal protein S11 562
600 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
601 4V6U 14 AM 30S ribosomal protein S11P 2261
602 4V6T 11 AK 30S ribosomal protein S11 562
603 4ADV 11 K 30S RIBOSOMAL PROTEIN S11 562
604 4V6S 47 BM 30S ribosomal protein S11 562
605 4V6P 14 AN 30S ribosomal protein S11 562
606 4V6Q 14 AN 30S ribosomal protein S11 562
607 4V6R 14 AN 30S ribosomal protein S11 562
608 4V6N 48 BN 30S ribosomal protein S11 562
609 4V6O 14 AN 30S ribosomal protein S11 562
610 3J0O 12 K Ribosomal protein S14 9986
611 3J0L 12 K Ribosomal protein S14 9986
612 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
613 2YKR 11 K 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
614 4V6M 15 AK 30S ribosomal protein S11 562
615 4V6K 47 BO 30S ribosomal protein S11 562
616 4V6L 14 AO 30S ribosomal protein S11 562
617 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
618 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
619 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
620 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
621 4V7I 46 BK 30S ribosomal protein S11 562
622 4V7H 10 AK 40S ribosomal protein S14(A) 5541
623 3IY8 6 K 30S ribosomal protein S11 562
624 4V68 7 AK 30S ribosomal protein S11 274
625 4V69 2 AK 30S ribosomal protein S11 562
626 4V65 5 AC 30S ribosomal protein S11 562
627 4V66 5 AC 30S ribosomal protein S11 562
628 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
629 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
630 4V4V 12 AK 30S ribosomal subunit protein S11 562
631 4V4W 12 AK 30S ribosomal subunit protein S11 562
632 1X18 7 G 30S ribosomal protein S11 274
633 4V4B 11 AK 40S ribosomal protein S14-A 4932
634 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
635 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
636 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
637 1JGO 14 N 30S RIBOSOMAL PROTEIN S11 274
638 1JGP 14 N 30S RIBOSOMAL PROTEIN S11 274
639 1JGQ 14 N 30S RIBOSOMAL PROTEIN S11 274
640 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274