Sequence Similarity Clusters for the Entities in PDB 3TCL

Entity #1 | Chains: A,H
CH04 Heavy Chain Fab protein, length: 237 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 9491
95 % 1 4 9524
90 % 1 4 9420
70 % 345 2010 1
50 % 705 4154 1
40 % 705 4155 1
30 % 760 4901 1
Entity #2 | Chains: B,L
CH04 Light Chain Fab protein, length: 215 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 19360
95 % 1 2 16862
90 % 94 613 3
70 % 286 1704 2
50 % 706 4154 1
40 % 706 4155 1
30 % 761 4901 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 4XCF 1 L 4E10 Fab light chain 9606
3 4XAW 1 L 4E10 Fab light chain 9606
4 2VXV 2 L HUMAN IGG ABT-325 9606
5 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
6 5I8C 2 B VRC34.01 Fab light chain 9606
7 3PP4 2 L GA101 Fab light chain 10090
8 4PTU 1 A Antibody pn132p2C05, light chain 9606
9 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
10 4XC3 1 L 4E10 Fab light chain 9606
11 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
12 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
13 4NWU 2 L APE1551 Ab Fab light chain 9606
14 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
15 5EWI 2 L VRC38.01 Light Chain 9606
16 5E2W 1 L AT8 LIGHT CHAIN 10090
17 5E2V 1 L AT8 LIGHT CHAIN 10090
18 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
19 3QQ9 1 C, L 101F LIGHT CHAIN 10090
20 5I1K 1 L FAB LIGHT CHAIN 9606
21 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
22 3QRG 1 L Fab light chain 9606
23 3NCJ 1 L Fab15 Mut8 light chain 9606
24 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
25 4NWT 1 L APE1531 Ab Fab light chain 9606
26 3NA9 1 L Fab15 light chain 9606
27 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
28 4LRI 1 A, B MSL-109 Light Chain 9606
29 4JN2 1 A, L anti dabigatran Fab 10090
30 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
31 4HHA 1 A Fab KE5 Fab fragment KE5 9606
32 3NAA 1 L Fab15 Mut5 light chain 9606
33 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
34 4PUB 2 L DX-2930 LIGHT CHAIN 9606
35 3OAZ 2 K, L Fab 2G12, light chain 9606
36 4YGV 2 B, L aDabi-Fab2a light chain 9606
37 3EO0 1 A, C GC-1008 Fab Light Chain 10090
38 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
39 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
40 4JHA 2 L D25 light chain 9606
41 4PTT 1 A Antibody pn132p2C05, light chain 9606
42 4DGV 2 L HCV1 Light Chain 9606
43 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
44 3IU4 2 L chP3 Fab light chain 10090
45 3P0Y 3 L Fab DL11 light chain 9606
46 5IBU 1 B, L 6652 Light Chain 9606
47 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
48 3NAC 1 L Fab15 Mut7 light chain 9606
49 4YHO 2 L aDabi-Fab3 light chain 9606
50 4DGY 2 L HCV1 Light Chain 9606
51 3MXW 2 L 5E1 light chain 9606
52 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
53 3EO9 1 L Efalizumab Fab fragment, light chain 9606
54 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
55 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
56 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
57 2FX7 1 L Fab 4E10 Light Chain 9606
58 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
59 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
60 5I18 1 L FAB LIGHT CHAIN 9606
61 4JN1 2 L anti-dabigatran Fab1, light chain 10090
62 3SOB 1 L antibody light chain 9606
63 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
64 5DR5 2 L AbD09097 Fab light chain 9606
65 4KQ3 1 L CNTO3186 light chain Fab 9606
66 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
67 4I77 2 L Lebrikizumab light chain Fab 9606
68 4HJG 1 A Trastuzumab light chain 9606
69 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
70 3FN0 1 L Fab Z13e1 light chain 9606
71 4YHI 2 B, L aDabi-Fab2a light chain 9606
72 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
73 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
74 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
75 4MAU 1 L C2244 light chain SEE REMARK 999 10090
76 1OP3 1 K, L FAB 2G12, light chain light chain 9606
77 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
78 4LKX 2 B Fab fragment light chain 9606
79 5JW5 2 B, L MEDI8852 Light chain 9606
80 3QWO 1 B, L motavizumab light chain 10090
81 4IOI 1 A Trastuzumab light chain 9606
82 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
83 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
84 5I16 1 A, L FAB LIGHT CHAIN 9606
85 5F9O 3 L CH235.09 Light chain 9606
86 4RBP 1 K, L Fab 2G12 light chain 9606
87 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
88 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
89 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
90 5GGQ 1 L nivolumab light chain 9606
91 3OAY 1 K, L Fab 2G12, light chain 9606
92 5K9J 2 L 56.a.09 light chain 9606
93 5TF1 2 L O2-CC Fab Light Chain 9606
94 3TCL 2 B, L CH04 Light Chain Fab 9606
95 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
96 5F7E 2 L Fab light chain 9606
97 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
98 5FHA 2 L Antibody 114 Fab light chain 9606
99 4X7S 2 L Ig kappa chain C region residues 23-236 9606
100 4X0K 2 B, L Fab fragment light chain 9606
101 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
102 5E8E 1 A IGA FAB LIGHT CHAIN 9606
103 2HFF 1 A, L CB2 Fab, light chain 9606
104 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
105 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
106 5GGS 2 B, D light chain 9606
107 5I1L 1 A, L FAB LIGHT CHAIN 9606
108 5GGV 1 L light chain 9606
109 3L5X 1 L H2L6 LIGHT CHAIN 9606
110 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
111 2R8S 2 L Fab light chain 10090
112 4HKZ 1 A Trastuzumab light chain 9606
113 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
114 3SO3 2 B A11 FAB light chain 9606
115 3IDG 1 A 2F5 Fab light chain 9606
116 3OAU 2 L Fab 2G12, light chain 9606
117 4WY7 2 L Fab 4E10Light chain 9606
118 4ZYK 2 B, L AM14 light chain 9606
119 5E94 1 A, C Antibody Fab fragment light chain 10090
120 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
121 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
122 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
123 4HIE 1 A Fab 023.102 9606
124 4LEX 1 L FAB HEAVY CHAIN 10090
125 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
126 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
127 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
128 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
129 4KMT 1 L light chain O12/KAPPA Fab 9606
130 3NZH 1 L 5F6 LIGHT CHAIN 10090
131 1RHH 1 A, C Fab X5, light chain 9606
132 1TJG 1 L FAB 2F5 Light Chain 9606
133 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
134 4XTR 3 D, F Antibody Light chain 32630
135 1RZ7 1 L Fab 48d light chain 9606
136 1RZG 2 B, D Fab 412d heavy chain 9606
137 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
138 3PGF 3 L SAB Light Chain 9606
139 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
140 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
141 4YHL 2 L aDabi-Fab2b light chain 9606
142 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
143 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
144 2QQN 3 L Antibody light chain 9606
145 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
146 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
147 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
148 4YHM 2 L aDabi-Fab2b light chain 9606
149 3X3F 2 L Light chain of KMTR2 9606
150 2CMR 3 L D5 9606
151 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
152 5CZX 3 D, L 20358 Fab light chain 9606
153 3GRW 2 L Fab light chain 9606
154 5I1D 1 A, L FAB LIGHT CHAIN 9606
155 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
156 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
157 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
158 5DRX 2 B, L CLL240 BCR light chain 9606
159 4HIX 2 L Humanized 3D6 Fab light chain 10090
160 4LKC 1 A Fab fragment of PCSK9 antibody 9606
161 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
162 4KZD 2 L BL3-6 Fab antibody, light chain 10090
163 4HCR 2 L, N PF-547659 light chain 9606
164 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
165 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
166 4HIH 1 A, C Fab 023.102 9606
167 4YHK 2 L aDabi-Fab2a light chain 9606
168 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
169 3DRQ 1 A 2F5 Fab' light chain 9606
170 5IES 2 L VRC01cHuGL2 Fab light chain 9606
171 4UV7 3 L GC1118A 9606
172 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
173 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
174 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
175 3D0V 1 A 2F5 Fab heavy chain 9606
176 3S34 1 L 1121B Fab light chain 10090
177 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
178 5E2T 1 L AT8 LIGHT CHAIN 10090
179 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
180 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
181 2AJ3 1 A, C, E Fab m18, Light Chain 9606
182 3IDI 1 A 2F5 Fab light chain 9606
183 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
184 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
185 4NRX 3 B, E, L m66 Light Chain 9606
186 3O2D 1 L ibalizumab light chain 10090
187 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
188 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
189 2R0L 1 L antibody light chain 32630
190 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
191 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
192 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
193 3Q1S 1 L Z13e1 Fab light chain 9606
194 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
195 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
196 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
197 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
198 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
199 3KR3 3 L antibody-Fab (light chain) 9606
200 5DK3 1 A, F Light Chain 9606
201 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
202 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
203 4YHN 2 B, L aDabi-Fab3 light chain 9606
204 5GGU 2 B, L light chain 9606
205 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
206 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
207 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
208 4D9Q 2 D, L Anti-Factor D, light chain 9606
209 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
210 5KW9 3 L IgA Light chain 9606
211 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
212 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
213 5DRW 2 B CLL183 BCR antibody light chain 9606
214 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
215 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
216 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
217 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
218 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
219 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
220 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
221 2FX9 1 L, M Fab 4E10 Light Chain 9606
222 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
223 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
224 1TZG 1 L, M Fab 4E10 light chain 9606
225 3W9D 2 B, D Antibody Fab light chain 9606
226 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
227 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
228 3BN9 2 C, E E2 Fab Light Chain 9606
229 4HWE 2 L Fab light chain light chain 9606
230 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
231 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
232 4OGX 3 L DX-2930 LIGHT CHAIN 9606
233 3W9E 3 B Antibody Fab light chain 9606
234 5TFS 2 L 02-K Fab Light chain 9606
235 3UTZ 1 A, D, E Metalloproteinase 10090
236 5E2U 1 L AT8 LIGHT CHAIN 10090
237 1OM3 1 L, M FAB 2G12, light chain light chain 9606
238 4KZE 2 L BL3-6 Fab antibody, light chain 10090
239 4HIJ 1 A, C Fab 023.102 light chain 9606
240 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
241 4XVU 3 D, F, J, L Antibody light chain 32630
242 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
243 3EYF 1 A, C 8f9 Fab 9606
244 3NAB 1 L Fab15 Mut6 light chain 9606
245 3IDN 1 A 2F5 Fab light chain 9606
246 5I1C 1 L FAB LIGHT CHAIN 9606
247 1RZ8 1 A, C Fab 17b light chain 9606
248 4WV1 3 A, D Fab light chain 9606
249 5EII 2 B, L Fab Light Chain 9606
250 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
251 4FNL 2 L, M Antibody C05, Light Chain 9606
252 4UB0 2 L IgG1, light chain 9606
253 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
254 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
255 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
256 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
257 5I1H 1 L FAB LIGHT CHAIN 9606
258 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
259 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
260 5I1J 1 L FAB LIGHT CHAIN 9606
261 3IDX 3 L Fab b13 light chain 9606
262 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
263 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
264 3IDJ 1 A 2F5 Fab light chain 9606
265 3IDM 1 A 2F5 Fab light chain 9606
266 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
267 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
268 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
269 4K94 1 L Fab19 heavy chain 9606
270 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
271 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
272 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
273 3D0L 1 A 2F5 heavy chain 9606
274 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
275 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
276 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
277 3X3G 2 L Light chain of KMTR2 9606
278 5E08 2 L Fab Light Chain 9606
279 2P8L 1 A nmAb 2F5, light chain 9606
280 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN FAB FRAGMENT 10090
281 5IBT 2 L UCA Light Chain 9606
282 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
283 1A4K 1 A, L ANTIBODY FAB FAB 10090
284 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
285 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
286 4NGH 1 L FAB LIGHT CHAIN 9606
287 4EDW 2 L tanezumab Fab light chain 9606
288 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
289 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
290 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
291 4NM4 1 L, M Antibody CR8043, Light Chain 9606
292 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
293 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
294 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
295 4D9R 2 D, L Fab light chain 9606
296 3U7W 2 L Light chain, Ig kappa chain C region 9606
297 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
298 4G7V 2 L fragment antibody light chain 9606
299 4HFW 1 A, L 6-26 Fab Light chain 9606
300 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
301 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
302 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
303 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
304 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
305 3INU 2 L, N KZ52 antibody fragment light chain 9606
306 5EU7 3 C, D FAB light chain 9606
307 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
308 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
309 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
310 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
311 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
312 4HII 1 A, C Fab 023.102 light chain 9606
313 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
314 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
315 4DN3 1 L CNTO888 LIGHT CHAIN 9606
316 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
317 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
318 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
319 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
320 3EYV 1 A, L hu3S193 Fab, light chain 10090
321 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
322 3PP3 2 K, L GA101 Fab light chain 10090
323 3BDY 2 L Fab Fragment -Light Chain 9606
324 5I8E 2 B, D VRC34.01 Fab light chain 9606
325 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
326 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
327 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
328 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
329 4HWB 3 L Fab light chain 9606
330 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
331 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
332 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
333 2HFG 1 L CB3s Fab light chain (kappa) 9606
334 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
335 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
336 4JQI 3 L Fab30 light chain 10090
337 3SKJ 1 L, M Antibody, light chain 9606
338 3U30 2 B, E Light chain Fab 9606
339 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
340 3U0T 1 A, C ponezumab LC Fab 9606
341 5HYS 2 B, D, F, L Uncharacterized protein 9606
342 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
343 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
344 5I15 1 L FAB LIGHT CHAIN 9606
345 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
346 5I1E 1 L FAB LIGHT CHAIN 9606
347 2NYY 2 C CR1 monoclonal antibody light chain 9606
348 2GCY 1 A huC25 fab fragment light chain 10090
349 4JLR 2 B, L Motavizumab Fab light chain 9606
350 2QQK 3 L Antibody Light Chain 9606
351 4J1U 1 A, C, E antibody 93F3 Light chain 10090
352 2PW2 1 A 2F5 Fab' heavy chain 9606
353 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
354 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
355 5SX5 1 K, L Panitumumab Fab Light Chain 9606
356 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
357 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
358 2PW1 1 A 2F5 Fab fragment heavy chain 9606
359 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
360 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
361 1TZH 2 A, L Fab YADS1 Light Chain 10090
362 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
363 4JZJ 3 B, L Fab Light Chain 10090
364 5BMF 2 L Fab fragment light chain 9606
365 5BO1 3 L, M Fab light chain 9606
366 4M6O 1 L CNTO7309 light chain 9606
367 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
368 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
369 4DVR 2 L Fab 48d Light chain 9606
370 3EYQ 1 C M2J5 Fab 9606
371 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
372 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
373 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
374 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
375 4XXD 1 A, D Fab Light Chain 9606
376 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
377 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
378 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
379 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
380 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
381 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
382 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
383 3DVG 1 A Human IgG1 fab fragment light chain 9606
384 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
385 2AGJ 1 L Yvo Fab, Light Chain 9606
386 4JKP 3 L Light chain of antibody 45-46M2 9606
387 3EYO 1 A, C 8f9 Fab 9606
388 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
389 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
390 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
391 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
392 4DN4 1 L CNTO888 LIGHT CHAIN 9606
393 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
394 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
395 2FJG 2 A, L Fab light chain 9606
396 4DKF 3 L, M FAb2 Light Chain 9606
397 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
398 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
399 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
400 3EFD 1 L FabL 10090
401 4LF3 1 A, D Fab heavy chain 10090
402 5K59 4 F, L Fab light chain 9606
403 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
404 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
405 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
406 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
407 4LEO 2 B RG7116 Fab light chain 10090
408 4G7Y 2 L Fragment antibody light chain 9606
409 4PY8 4 J antibody 3.1 light chain Fab 9606
410 3SDY 4 L Antibody CR8020, Light Chain 9606
411 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
412 3IXT 1 B, L Motavizumab Fab light chain 10090
413 2P8M 1 A nmAb 2F5, light chain 9606
414 4NP4 3 L, M bezlotoxumab light chain 9606
415 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
416 4XCE 1 B, D, L 4E10 Fab light chain 9606
417 5I1I 1 L FAB LIGHT CHAIN 9606
418 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
419 4ERS 1 L Fab light chain 9606
420 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
421 4MWF 2 B, L Fab AR3C light chain 9606
422 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
423 3SQO 3 L J16 Light chain 9606
424 4K3J 4 L Onartuzumab Fab light chain 10090
425 4PS4 1 L M1295 LIGHT CHAIN 9606
426 5GGT 3 L IGK@ protein 9606
427 3HI1 2 A, L F105 Light Chain 9606
428 4PY7 2 B, J antibody 3.1 light chain Fab 9606
429 4K8R 3 C Fab1, light chain 9606
430 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
431 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
432 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
433 1TZI 1 A Fab YADS2 Light Chain 10090
434 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
435 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
436 4X7T 2 B, L Omalizumab-Fab Light chain 9606
437 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
438 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
439 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
440 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
441 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
442 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
443 5I1G 1 L FAB LIGHT CHAIN 9606
444 2QQL 3 L Antibody Light Chain 9606
445 2P8P 1 A nmAb 2F5, light chain 9606
446 4XCC 1 L 4E10 Fab light chain 9606
447 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
448 5SX4 1 I, L Panitumumab Fab Light Chain 9606
449 3WD5 2 L Adalimumab Light Chain 9606
450 4NHC 1 L FAB LIGHT CHAIN 9606
451 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
452 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
453 3U46 2 B, L CH02 Light chain Fab 9606
454 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
455 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
456 4HFU 4 L Fab 8M2 light chain 9606
457 4FP8 3 L, M, N, O Antibody C05, light chain 9606
458 4YPG 1 A, L Sifalimumab light chain 9606
459 3BE1 3 L Fab Fragment-Light Chain 9606
460 2FJH 2 A, L Fab fragment light chain 9606
461 4K9E 1 L light chain 10090
462 3U4B 2 L CH02 Light chain 9606
463 3P0V 1 L, M Fab DL11 light chain 9606
464 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
465 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
466 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
467 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
468 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
469 4KVN 3 L Human IgG Light Chain 9606
470 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
471 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
472 3OB0 1 K, L Fab 2G12, light chain Fab 9606
473 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
474 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
475 5DUM 2 L 65C6 Light Chain 9606
476 4I18 1 B, L antibody light chain Fab 10090
477 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
478 3IDY 3 C, L Fab b13 light chain 9606
479 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
480 3IVK 1 B, L Fab light chain man 10090
481 3KYK 2 L Light Chain Li33 IgG1 9606
482 5TGB 2 B, L 02-CB Fab Light Chain 9606
483 5I19 1 L FAB LIGHT CHAIN 9606
484 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
485 4IRZ 2 L Fab Natalizumab light chain 9606
486 5FEC 2 B, L germline 3BNC60 light chain 9606
487 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
488 5ESV 2 B, D, L CH03 Light Chain 9606
489 2R56 2 L, M IgE Fab Fragment, light chain 9606
490 1ZA6 1 A, C, E, G IGG Light chain 9606
491 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
492 4ZS6 1 D, L fab Light Chain 9606
493 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
494 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
495 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
496 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
497 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
498 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
499 5CZV 3 L Fab 20350 light chain 9606
500 4P59 3 L MOR09825 Fab fragment light chain 9606
501 5CJO 3 L FAB light chain 10090
502 4LMQ 3 I, L Stromal cell-derived factor 1 9606
503 3N85 2 L Fab37 Light Chain 9606
504 3G6J 3 E, G Fab light chain 9606
505 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
506 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
507 4DKE 3 L, M FAb1.1 Light Chain 9606
508 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
509 3DRT 1 A 2F5 Fab' light chain 9606
510 5I17 1 A, L FAB LIGHT CHAIN 9606
511 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
512 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
513 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
514 4R8W 4 L Light chain of neutralizing antibody CT149 9606
515 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
516 4NRY 1 B, L m66 Heavy Chain 9606
517 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
518 3S37 1 L 1121B Fab light chain 10090
519 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
520 5JXE 2 C, F Pembrolizumab Fab light chain 9606
521 5KZC 3 D, G, L VRC01 Fab light chain 9606
522 4JM2 3 C 17b Light chain Fab 9606
523 1S78 2 C, E Pertuzumab Fab light chain 10090
524 1OP5 1 K, L FAB 2G12, light chain light chain 9606
525 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
526 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
527 5D1Z 1 A, H Y10 Light Chain 9606
528 5D1Z 3 C, E D4-10 Light Chain 9606
529 5GGR 2 B, L light chain 9606
530 5IBL 4 D, L 6639 Light Chain 9606
531 4XHJ 3 C, G Fab-RC light chain 9606
532 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
533 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
534 4N90 3 E, G, I Fab light chain 9606
535 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
536 5D1Q 1 A D2-06 Light Chain 9606
537 5D1Q 4 D P5 Light Chain 9606
538 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
539 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
540 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
541 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
542 4IOF 3 D, F Fab-bound IDE, light chain 10090
543 5FUO 3 L FAB LIGHT CHAIN 9606
544 4JHW 2 L D25 light chain 9606
545 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
546 3BQU 1 A 2F5 Fab' light chain 9606
547 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
548 4M1C 3 D, F Fab-bound IDE, light chain 9606
549 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
550 3ULV 2 L Fab15 light chain 9606
551 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
552 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
553 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
554 3EGS 1 A 2F5 Fab' light chain 9606
555 5D1X 1 A D4-30 Light Chain 9606
556 5D1X 4 D P5 Light Chain 9606
557 5JW3 4 L MEDI8852 light chain 9606
558 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
559 3S36 1 L 1121B light chain 10090
560 3DRO 1 A 2F5 Fab light chain 9606
561 5CWS 1 A, G sAB-158 Fab Light Chain 9606
562 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
563 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
564 2R0K 2 L antibody light chain of Fab58 9606
565 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
566 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
567 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
568 4G80 3 B, D, F, H fragment antibody light chain 9606
569 3X2D 3 C, G, K, O Fab light chain 9606
570 3JWO 3 L FAB 48D LIGHT CHAIN 9606
571 5CD5 3 D DRVIA7 Fab Light Chain 9606
572 3P11 2 L Fab DL11 light chain 9606
573 3F12 1 A, C M2J1 Fab 9606
574 3B2V 1 L IMC-11F8 FAB Light chain 9606
575 5IGX 3 L germline NIH45-46 light chain 9606
576 3ULU 2 L Fab15 light chain 9606
577 4XI5 3 C Fab-94 light chain 9606
578 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
579 4Q5Z 3 J, L, N, P, R, T, V, X IDE-bound Fab, light chain 10090
580 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
581 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
582 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
583 5JW4 6 R MEDI8852 light chain 9606
584 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
585 5J3D 2 B, D, L 14N4 light chain 9606
586 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
587 5ESZ 2 B, L CH04 Light Chain 9606
588 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
589 3EFF 1 A, C FAB 10090
590 3PJS 1 A, C FAB light chain 10090
591 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
592 4ZYP 5 E, G, I AM14 antibody light chain 9606
593 5DWU 4 L Fab - Light Chain 9606
594 5I8H 5 F, H VRC34.01 Fab light chain 9606
595 4RQS 2 C 17b Fab Light Chain 9606
596 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
597 4R4H 3 L Antibody 2.2c, Light chain 9606
598 5FHC 5 L Antibody 114 Fab light chain 9606
599 4XMN 6 L Antibody 87 light chain 32630
600 4XMM 8 L Antibody 57 light chain 9606
601 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
602 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
603 5GZR 4 L, N Z23 Fab light chain 9606
604 5THR 4 J, K, L 17b Fab VL domain 9606
605 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
606 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
607 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
608 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
609 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
610 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
611 2ESG 1 L, M Immunoglobulin A1 light chain 9606
612 1R70 1 A, C Human IgA2(m1) Light Chain 9606
613 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606