Sequence Similarity Clusters for the Entities in PDB 3TCL

Entity #1 | Chains: A,H
CH04 Heavy Chain Fab protein, length: 237 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 4 10399
95 % 1 4 10424 Flexibility: Low
Max RMSD: 3.0, Avg RMSD: 1.5
PDBFlex
90 % 1 4 10297
70 % 394 2280 2
50 % 806 4713 1
40 % 806 4713 1
30 % 875 5567 1
Entity #2 | Chains: B,L
CH04 Light Chain Fab protein, length: 215 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 21251
95 % 1 2 18476 Flexibility: Low
Max RMSD: 2.3, Avg RMSD: 1.5
PDBFlex
90 % 117 720 3
70 % 394 2327 1
50 % 807 4713 1
40 % 807 4713 1
30 % 876 5567 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 4XCF 1 L 4E10 Fab light chain 9606
4 5X08 2 L Fab 4E10 Light chain 9606
5 4XAW 1 L 4E10 Fab light chain 9606
6 2VXV 2 L HUMAN IGG ABT-325 9606
7 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
8 5I8C 2 B VRC34.01 Fab light chain 9606
9 3PP4 2 L GA101 Fab light chain 10090
10 4PTU 1 A Antibody pn132p2C05, light chain 9606
11 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
12 4XC3 1 L 4E10 Fab light chain 9606
13 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
14 5VSI 2 L CH1/Ckappa Fab light chain 9606
15 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
16 4NWU 2 L APE1551 Ab Fab light chain 9606
17 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
18 5EWI 2 L VRC38.01 Light Chain 9606
19 5E2W 1 L AT8 LIGHT CHAIN 10090
20 5E2V 1 L AT8 LIGHT CHAIN 10090
21 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
22 5OB5 3 L fAb Light chain 9606
23 3QQ9 1 C, L 101F LIGHT CHAIN 10090
24 5I1K 1 L FAB LIGHT CHAIN 9606
25 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
26 5V7U 1 L CBTAU-22.1 Fab light chain 9606
27 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
28 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
29 3QRG 1 L Fab light chain 9606
30 3NCJ 1 L Fab15 Mut8 light chain 9606
31 5W05 1 L M59 FAB LIGHT CHAIN 10090
32 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
33 1UM5 1 L Antibody 21H3 L chain 10090
34 4NWT 1 L APE1531 Ab Fab light chain 9606
35 3NA9 1 L Fab15 light chain 9606
36 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
37 4LRI 1 A, B MSL-109 Light Chain 9606
38 4JN2 1 A, L anti dabigatran Fab 10090
39 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
40 4HHA 1 A Fab KE5 Fab fragment KE5 9606
41 3NAA 1 L Fab15 Mut5 light chain 9606
42 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
43 5IK3 2 B, D 1E03 Fab fragment light chain 9606
44 5IT2 2 L light chain 9606
45 4PUB 2 L DX-2930 LIGHT CHAIN 9606
46 3OAZ 2 K, L Fab 2G12, light chain 9606
47 4YGV 2 B, L aDabi-Fab2a light chain 9606
48 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
49 3EO0 1 A, C GC-1008 Fab Light Chain 10090
50 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
51 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
52 4JHA 2 L D25 light chain 9606
53 4PTT 1 A Antibody pn132p2C05, light chain 9606
54 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
55 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
56 4DGV 2 L HCV1 Light Chain 9606
57 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
58 3IU4 2 L chP3 Fab light chain 10090
59 3P0Y 3 L Fab DL11 light chain 9606
60 5IBU 1 B, L 6652 Light Chain 9606
61 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
62 6ELE 2 B, L fAB light chain 9606
63 3NAC 1 L Fab15 Mut7 light chain 9606
64 4YHO 2 L aDabi-Fab3 light chain 9606
65 4DGY 2 L HCV1 Light Chain 9606
66 3MXW 2 L 5E1 light chain 9606
67 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
68 3EO9 1 L Efalizumab Fab fragment, light chain 9606
69 5WUV 1 L light chain 9606
70 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
71 6B0G 1 C 1245 Antibody, Light Chain 9606
72 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
73 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
74 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
75 5TL5 1 L M2177 LIGHT CHAIN 10090
76 2FX7 1 L Fab 4E10 Light Chain 9606
77 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
78 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
79 5I18 1 L FAB LIGHT CHAIN 9606
80 4JN1 2 L anti-dabigatran Fab1, light chain 10090
81 3SOB 1 L antibody light chain 9606
82 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
83 5DR5 2 L AbD09097 Fab light chain 9606
84 4KQ3 1 L CNTO3186 light chain Fab 9606
85 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
86 4I77 2 L Lebrikizumab light chain Fab 9606
87 4HJG 1 A Trastuzumab light chain 9606
88 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
89 3FN0 1 L Fab Z13e1 light chain 9606
90 4YHI 2 B, L aDabi-Fab2a light chain 9606
91 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
92 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
93 6ELJ 2 B, L fAB light chain 9606
94 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
95 4MAU 1 L C2244 light chain SEE REMARK 999 10090
96 1OP3 1 K, L FAB 2G12, light chain light chain 9606
97 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
98 4LKX 2 B Fab fragment light chain 9606
99 5JW5 2 B, L MEDI8852 Light chain 9606
100 3QWO 1 B, L motavizumab light chain 10090
101 4IOI 1 A Trastuzumab light chain 9606
102 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
103 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
104 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
105 5I16 1 A, L FAB LIGHT CHAIN 9606
106 5F9O 3 L CH235.09 Light chain 9606
107 1UM4 1 L Antibody 21H3 L chain 10090
108 4RBP 1 K, L Fab 2G12 light chain 9606
109 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
110 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
111 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
112 5GGQ 1 L nivolumab light chain 9606
113 3OAY 1 K, L Fab 2G12, light chain 9606
114 5K9J 2 L 56.a.09 light chain 9606
115 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
116 5TF1 2 L O2-CC Fab Light Chain 9606
117 3TCL 2 B, L CH04 Light Chain Fab 9606
118 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
119 5F7E 2 L Fab light chain 9606
120 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
121 5FHA 2 L Antibody 114 Fab light chain 9606
122 5UMN 3 D, F Antibody C05, light chain 9606
123 4X7S 2 L Ig kappa chain C region residues 23-236 9606
124 1UM6 1 L antibody 21h3, L chain 10090
125 4X0K 2 B, L Fab fragment light chain 9606
126 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
127 5E8E 1 A IGA FAB LIGHT CHAIN 9606
128 6ELL 2 B, L fAB light chain 9606
129 2HFF 1 A, L CB2 Fab, light chain 9606
130 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
131 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
132 5GGS 2 B, D light chain 9606
133 5I1L 1 A, L FAB LIGHT CHAIN 9606
134 5GGV 1 L light chain 9606
135 3L5X 1 L H2L6 LIGHT CHAIN 9606
136 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
137 2R8S 2 L Fab light chain 10090
138 4HKZ 1 A Trastuzumab light chain 9606
139 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
140 3SO3 2 B A11 FAB light chain 9606
141 3IDG 1 A 2F5 Fab light chain 9606
142 3OAU 2 L Fab 2G12, light chain 9606
143 4WY7 2 L Fab 4E10Light chain 9606
144 4ZYK 2 B, L AM14 light chain 9606
145 5E94 1 A, C Antibody Fab fragment light chain 10090
146 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
147 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
148 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
149 4HIE 1 A Fab 023.102 9606
150 4LEX 1 L FAB HEAVY CHAIN 10090
151 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
152 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
153 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
154 5Y11 2 B MAb 4-5 light chain 9606
155 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
156 4KMT 1 L light chain O12/KAPPA Fab 9606
157 3NZH 1 L 5F6 LIGHT CHAIN 10090
158 1RHH 1 A, C Fab X5, light chain 9606
159 1TJG 1 L FAB 2F5 Light Chain 9606
160 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
161 4XTR 3 D, F Antibody Light chain 32630
162 1RZ7 1 L Fab 48d light chain 9606
163 1RZG 2 B, D Fab 412d heavy chain 9606
164 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
165 3PGF 3 L SAB Light Chain 9606
166 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
167 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
168 4YHL 2 L aDabi-Fab2b light chain 9606
169 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
170 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
171 2QQN 3 L Antibody light chain 9606
172 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
173 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
174 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
175 4YHM 2 L aDabi-Fab2b light chain 9606
176 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
177 3X3F 2 L Light chain of KMTR2 9606
178 2CMR 3 L D5 9606
179 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
180 5CZX 3 D, L 20358 Fab light chain 9606
181 3GRW 2 L Fab light chain 9606
182 5I1D 1 A, L FAB LIGHT CHAIN 9606
183 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
184 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
185 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
186 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
187 5DRX 2 B, L CLL240 BCR light chain 9606
188 4HIX 2 L Humanized 3D6 Fab light chain 10090
189 4LKC 1 A Fab fragment of PCSK9 antibody 9606
190 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
191 4KZD 2 L BL3-6 Fab antibody, light chain 10090
192 4HCR 2 L, N PF-547659 light chain 9606
193 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
194 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
195 4HIH 1 A, C Fab 023.102 9606
196 4YHK 2 L aDabi-Fab2a light chain 9606
197 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
198 3DRQ 1 A 2F5 Fab' light chain 9606
199 5IES 2 L VRC01cHuGL2 Fab light chain 9606
200 4UV7 3 L GC1118A 9606
201 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
202 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
203 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
204 3D0V 1 A 2F5 Fab heavy chain 9606
205 3S34 1 L 1121B Fab light chain 10090
206 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
207 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
208 5E2T 1 L AT8 LIGHT CHAIN 10090
209 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
210 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
211 6EMJ 2 B, L fAb light chain 9606
212 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
213 2AJ3 1 A, C, E Fab m18, Light Chain 9606
214 3IDI 1 A 2F5 Fab light chain 9606
215 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
216 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
217 4NRX 3 B, E, L m66 Light Chain 9606
218 3O2D 1 L ibalizumab light chain 10090
219 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
220 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
221 5V7R 1 L CBTAU-7.1 Fab light chain 9606
222 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
223 2R0L 1 L antibody light chain 32630
224 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
225 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
226 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
227 5NBI 2 L Design of antibodies 562
228 3Q1S 1 L Z13e1 Fab light chain 9606
229 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
230 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
231 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
232 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
233 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
234 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
235 3KR3 3 L antibody-Fab (light chain) 9606
236 5DK3 1 A, F Light Chain 9606
237 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
238 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
239 4YHN 2 B, L aDabi-Fab3 light chain 9606
240 5GGU 2 B, L light chain 9606
241 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
242 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
243 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
244 4D9Q 2 D, L Anti-Factor D, light chain 9606
245 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
246 5KW9 3 L IgA Light chain 9606
247 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
248 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
249 5DRW 2 B CLL183 BCR antibody light chain 9606
250 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
251 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
252 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
253 5MVZ 2 B, L Fab 4AB007 L-chain 9606
254 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
255 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
256 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
257 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
258 2FX9 1 L, M Fab 4E10 Light Chain 9606
259 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
260 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
261 1TZG 1 L, M Fab 4E10 light chain 9606
262 3W9D 2 B, D Antibody Fab light chain 9606
263 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
264 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
265 3BN9 2 C, E E2 Fab Light Chain 9606
266 4HWE 2 L Fab light chain light chain 9606
267 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
268 5TZ2 2 L C47B222 Fab Light Chain 9606
269 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
270 4OGX 3 L DX-2930 LIGHT CHAIN 9606
271 3W9E 3 B Antibody Fab light chain 9606
272 5TFS 2 L 02-K Fab Light chain 9606
273 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
274 5E2U 1 L AT8 LIGHT CHAIN 10090
275 1OM3 1 L, M FAB 2G12, light chain light chain 9606
276 4KZE 2 L BL3-6 Fab antibody, light chain 10090
277 5WT9 2 L Light Chain of Nivolumab 9606
278 4HIJ 1 A, C Fab 023.102 light chain 9606
279 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
280 4XVU 3 D, F, J, L Antibody light chain 32630
281 5B71 1 A, C SKY59 Fab light chain 9606
282 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
283 3EYF 1 A, C 8f9 Fab 9606
284 3NAB 1 L Fab15 Mut6 light chain 9606
285 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
286 3IDN 1 A 2F5 Fab light chain 9606
287 5I1C 1 L FAB LIGHT CHAIN 9606
288 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
289 1RZ8 1 A, C Fab 17b light chain 9606
290 4WV1 3 A, D Fab light chain 9606
291 5EII 2 B, L Fab Light Chain 9606
292 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
293 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
294 4FNL 2 L, M Antibody C05, Light Chain 9606
295 4UB0 2 L IgG1, light chain 9606
296 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
297 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
298 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
299 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
300 5I1H 1 L FAB LIGHT CHAIN 9606
301 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
302 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
303 5I1J 1 L FAB LIGHT CHAIN 9606
304 3IDX 3 L Fab b13 light chain 9606
305 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
306 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
307 3IDJ 1 A 2F5 Fab light chain 9606
308 3IDM 1 A 2F5 Fab light chain 9606
309 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
310 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
311 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
312 4K94 1 L Fab19 heavy chain 9606
313 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
314 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
315 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
316 3D0L 1 A 2F5 heavy chain 9606
317 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
318 5XAJ 2 B, L FabHM14c10 light chain 9606
319 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
320 5VEB 2 B, L anti-CDH6 Fab light chain 9606
321 5VZX 2 I, L Crenezumab Fab light chain 9606
322 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
323 3X3G 2 L Light chain of KMTR2 9606
324 5WAW 1 L fAb Light Chain 9606
325 5E08 2 L Fab Light Chain 9606
326 2P8L 1 A nmAb 2F5, light chain 9606
327 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
328 5IBT 2 L UCA Light Chain 9606
329 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
330 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
331 1A4K 1 A, L ANTIBODY FAB FAB 10090
332 5MO9 2 L AB20 Fab light chain 10090
333 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
334 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
335 4NGH 1 L FAB LIGHT CHAIN 9606
336 4EDW 2 L tanezumab Fab light chain 9606
337 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
338 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
339 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
340 4NM4 1 L, M Antibody CR8043, Light Chain 9606
341 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
342 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
343 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
344 4D9R 2 D, L Fab light chain 9606
345 3U7W 2 L Light chain, Ig kappa chain C region 9606
346 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
347 4G7V 2 L fragment antibody light chain 9606
348 5W06 2 L M1587 FAB LIGHT CHAIN 10090
349 4HFW 1 A, L 6-26 Fab Light chain 9606
350 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
351 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
352 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
353 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
354 5JO4 2 B D80 Fab Light Chain 9606
355 5JO4 4 D G6 Fab Light Chain 9606
356 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
357 3INU 2 L, N KZ52 antibody fragment light chain 9606
358 5EU7 3 C, D FAB light chain 9606
359 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
360 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
361 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
362 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
363 5X8M 3 C durvalumab light chain 9606
364 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
365 4HII 1 A, C Fab 023.102 light chain 9606
366 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
367 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
368 4DN3 1 L CNTO888 LIGHT CHAIN 9606
369 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
370 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
371 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
372 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
373 3EYV 1 A, L hu3S193 Fab, light chain 10090
374 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
375 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
376 3PP3 2 K, L GA101 Fab light chain 10090
377 5IJK 3 C, D 1E03 Fab fragment light chain 9606
378 3BDY 2 L Fab Fragment -Light Chain 9606
379 5I8E 2 B, D VRC34.01 Fab light chain 9606
380 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
381 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
382 5UIX 2 L DH576 Fab light chain 9606
383 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
384 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
385 4HWB 3 L Fab light chain 9606
386 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
387 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
388 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
389 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
390 2HFG 1 L CB3s Fab light chain (kappa) 9606
391 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
392 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
393 4JQI 3 L Fab30 light chain 10090
394 6B0H 3 A, C 1262 antibody, light chain 9606
395 3SKJ 1 L, M Antibody, light chain 9606
396 3U30 2 B, E Light chain Fab 9606
397 6B0A 2 L 1269 antibody, light chain 9606
398 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
399 3U0T 1 A, C ponezumab LC Fab 9606
400 5HYS 2 B, D, F, L Uncharacterized protein 9606
401 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
402 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
403 5I15 1 L FAB LIGHT CHAIN 9606
404 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
405 5I1E 1 L FAB LIGHT CHAIN 9606
406 2NYY 2 C CR1 monoclonal antibody light chain 9606
407 2GCY 1 A huC25 fab fragment light chain 10090
408 4JLR 2 B, L Motavizumab Fab light chain 9606
409 2QQK 3 L Antibody Light Chain 9606
410 4J1U 1 A, C, E antibody 93F3 Light chain 10090
411 2PW2 1 A 2F5 Fab' heavy chain 9606
412 5N4G 2 L LIGHT CHAIN 9606
413 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
414 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
415 5SX5 1 K, L Panitumumab Fab Light Chain 9606
416 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
417 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
418 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
419 2PW1 1 A 2F5 Fab fragment heavy chain 9606
420 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
421 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
422 1TZH 2 A, L Fab YADS1 Light Chain 10090
423 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
424 4JZJ 3 B, L Fab Light Chain 10090
425 5BMF 2 L Fab fragment light chain 9606
426 5BO1 3 L, M Fab light chain 9606
427 4M6O 1 L CNTO7309 light chain 9606
428 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
429 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
430 5LSP 3 L, T 107_A07 Fab light chain 9606
431 4DVR 2 L Fab 48d Light chain 9606
432 3EYQ 1 C M2J5 Fab 9606
433 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
434 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
435 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
436 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
437 4XXD 1 A, D Fab Light Chain 9606
438 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
439 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
440 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
441 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
442 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
443 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
444 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
445 3DVG 1 A Human IgG1 fab fragment light chain 9606
446 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
447 2AGJ 1 L Yvo Fab, Light Chain 9606
448 4JKP 3 L Light chain of antibody 45-46M2 9606
449 3EYO 1 A, C 8f9 Fab 9606
450 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
451 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
452 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
453 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
454 4DN4 1 L CNTO888 LIGHT CHAIN 9606
455 5TRP 2 L DH272 Fab light chain 9606
456 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
457 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
458 2FJG 2 A, L Fab light chain 9606
459 4DKF 3 L, M FAb2 Light Chain 9606
460 5TLK 1 A, E M2177 LIGHT CHAIN 10090
461 5TLK 3 C, G H2191 LIGHT CHAIN 10090
462 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
463 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
464 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
465 3EFD 1 L FabL 10090
466 4LF3 1 A, D Fab heavy chain 10090
467 5K59 4 F, L Fab light chain 9606
468 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
469 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
470 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
471 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
472 4LEO 2 B RG7116 Fab light chain 10090
473 4G7Y 2 L Fragment antibody light chain 9606
474 4PY8 4 J antibody 3.1 light chain Fab 9606
475 3SDY 4 L Antibody CR8020, Light Chain 9606
476 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
477 3IXT 1 B, L Motavizumab Fab light chain 10090
478 2P8M 1 A nmAb 2F5, light chain 9606
479 4NP4 3 L, M bezlotoxumab light chain 9606
480 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
481 4XCE 1 B, D, L 4E10 Fab light chain 9606
482 5I1I 1 L FAB LIGHT CHAIN 9606
483 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
484 4ERS 1 L Fab light chain 9606
485 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
486 4MWF 2 B, L Fab AR3C light chain 9606
487 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
488 3SQO 3 L J16 Light chain 9606
489 4K3J 4 L Onartuzumab Fab light chain 10090
490 4PS4 1 L M1295 LIGHT CHAIN 9606
491 5GGT 3 L IGK@ protein 9606
492 3HI1 2 A, L F105 Light Chain 9606
493 4PY7 2 B, J antibody 3.1 light chain Fab 9606
494 4K8R 3 C Fab1, light chain 9606
495 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
496 5VOB 7 L Fab 8I21 light chain 9606
497 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
498 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
499 1TZI 1 A Fab YADS2 Light Chain 10090
500 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
501 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
502 4X7T 2 B, L Omalizumab-Fab Light chain 9606
503 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
504 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
505 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
506 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
507 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
508 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
509 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
510 5I1G 1 L FAB LIGHT CHAIN 9606
511 2QQL 3 L Antibody Light Chain 9606
512 2P8P 1 A nmAb 2F5, light chain 9606
513 4XCC 1 L 4E10 Fab light chain 9606
514 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
515 5SX4 1 I, L Panitumumab Fab Light Chain 9606
516 3WD5 2 L Adalimumab Light Chain 9606
517 4NHC 1 L FAB LIGHT CHAIN 9606
518 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
519 5GZO 3 D, L Antibody light chain 9606
520 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
521 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
522 5GMQ 3 C MCA1 light chain 9606
523 3U46 2 B, L CH02 Light chain Fab 9606
524 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
525 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
526 4HFU 4 L Fab 8M2 light chain 9606
527 5TRU 1 L, l Ipilimumab Fab light chain 9606
528 4FP8 3 L, M, N, O Antibody C05, light chain 9606
529 4YPG 1 A, L Sifalimumab light chain 9606
530 3BE1 3 L Fab Fragment-Light Chain 9606
531 2FJH 2 A, L Fab fragment light chain 9606
532 5XEZ 3 D, L Antibody, mAb1, light chain 9606
533 4K9E 1 L light chain 10090
534 3U4B 2 L CH02 Light chain 9606
535 3P0V 1 L, M Fab DL11 light chain 9606
536 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
537 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
538 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
539 5VIG 2 B, L Fab light chain 9606
540 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
541 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
542 4KVN 3 L Human IgG Light Chain 9606
543 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
544 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
545 5WUX 2 B, D, L light 9606
546 3OB0 1 K, L Fab 2G12, light chain Fab 9606
547 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
548 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
549 5DUM 2 L 65C6 Light Chain 9606
550 4I18 1 B, L antibody light chain Fab 10090
551 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
552 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
553 3IDY 3 C, L Fab b13 light chain 9606
554 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
555 3IVK 1 B, L Fab light chain man 10090
556 3KYK 2 L Light Chain Li33 IgG1 9606
557 5TGB 2 B, L 02-CB Fab Light Chain 9606
558 5I19 1 L FAB LIGHT CHAIN 9606
559 5TH9 1 L, M, N GS-5745 Fab light chain 9986
560 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
561 4IRZ 2 L Fab Natalizumab light chain 9606
562 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
563 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
564 5FEC 2 B, L germline 3BNC60 light chain 9606
565 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
566 5ESV 2 B, D, L CH03 Light Chain 9606
567 2R56 2 L, M IgE Fab Fragment, light chain 9606
568 1ZA6 1 A, C, E, G IGG Light chain 9606
569 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
570 4ZS6 1 D, L fab Light Chain 9606
571 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
572 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
573 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
574 5K9K 2 B, L 56.a.09 Light chain 9606
575 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
576 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
577 5W4L 6 C, E Antibody N12-i3 light chain 9606
578 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
579 5NB5 1 L, M design of antibodies 562
580 5CZV 3 L Fab 20350 light chain 9606
581 5XF1 3 D, L Antibody mAb1 Light chain 9606
582 4P59 3 L MOR09825 Fab fragment light chain 9606
583 5XXY 2 L light chain of atezolizumab fab 9606
584 5CJO 3 L FAB light chain 10090
585 4LMQ 3 I, L Stromal cell-derived factor 1 9606
586 3N85 2 L Fab37 Light Chain 9606
587 3G6J 3 E, G Fab light chain 9606
588 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
589 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
590 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
591 4DKE 3 L, M FAb1.1 Light Chain 9606
592 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
593 3DRT 1 A 2F5 Fab' light chain 9606
594 5I17 1 A, L FAB LIGHT CHAIN 9606
595 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
596 5VIC 2 L Fab light chain 9606
597 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
598 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
599 5USI 3 B, L Fab vv138 Light chain 9606
600 4R8W 4 L Light chain of neutralizing antibody CT149 9606
601 5TPN 3 L hRSV0 light chain 9606
602 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
603 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
604 4NRY 1 B, L m66 Heavy Chain 9606
605 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
606 3S37 1 L 1121B Fab light chain 10090
607 5TZT 1 B, L Light Chain of Fab C47B161 9606
608 5VL7 4 L Fab33 light chain 9606
609 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
610 5JXE 2 C, F Pembrolizumab Fab light chain 9606
611 5KZC 3 D, G, L VRC01 Fab light chain 9606
612 4JM2 3 C 17b Light chain Fab 9606
613 1S78 2 C, E Pertuzumab Fab light chain 10090
614 1OP5 1 K, L FAB 2G12, light chain light chain 9606
615 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
616 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
617 5D1Z 1 A, H Y10 Light Chain 9606
618 5D1Z 3 C, E D4-10 Light Chain 9606
619 5GGR 2 B, L light chain 9606
620 5IBL 4 D, L 6639 Light Chain 9606
621 4XHJ 3 C, G Fab-RC light chain 9606
622 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
623 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
624 4N90 3 E, G, I Fab light chain 9606
625 5VGJ 3 L VRC38.01 Fab Light Chain 9606
626 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
627 6B0E 1 A 1260 antibody, light chain 9606
628 5D1Q 1 A D2-06 Light Chain 9606
629 5D1Q 4 D P5 Light Chain 9606
630 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
631 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
632 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
633 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
634 5XHV 3 L, Q S40 light chain 9606
635 4IOF 3 D, F Fab-bound IDE, light chain 10090
636 5FUO 3 L FAB LIGHT CHAIN 9606
637 4JHW 2 L D25 light chain 9606
638 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
639 3BQU 1 A 2F5 Fab' light chain 9606
640 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
641 4M1C 3 D, F Fab-bound IDE, light chain 9606
642 5UQY 3 C, G, K, O MR78 Fab light chain 9606
643 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
644 3ULV 2 L Fab15 light chain 9606
645 5UG0 3 C 2897 light chain 9606
646 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
647 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
648 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
649 3EGS 1 A 2F5 Fab' light chain 9606
650 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
651 5D1X 1 A D4-30 Light Chain 9606
652 5D1X 4 D P5 Light Chain 9606
653 5JW3 4 L MEDI8852 light chain 9606
654 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
655 5UMI 2 B, L PA50 Fab Light chain 9606
656 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
657 3S36 1 L 1121B light chain 10090
658 3DRO 1 A 2F5 Fab light chain 9606
659 5CWS 1 A, G sAB-158 Fab Light Chain 9606
660 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
661 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
662 2R0K 2 L antibody light chain of Fab58 9606
663 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
664 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
665 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
666 4G80 3 B, D, F, H fragment antibody light chain 9606
667 3JWO 3 L FAB 48D LIGHT CHAIN 9606
668 5CD5 3 D DRVIA7 Fab Light Chain 9606
669 3P11 2 L Fab DL11 light chain 9606
670 3F12 1 A, C M2J1 Fab 9606
671 3B2V 1 L IMC-11F8 FAB Light chain 9606
672 5IGX 3 L germline NIH45-46 light chain 9606
673 3ULU 2 L Fab15 light chain 9606
674 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
675 4XI5 3 C Fab-94 light chain 9606
676 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
677 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
678 4Q5Z 3 J, L, N, P, R, T, V, X IDE-bound Fab, light chain 10090
679 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
680 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
681 5K9O 2 B, L 31.b.09 Light Fv 9606
682 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
683 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
684 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
685 5JW4 6 R MEDI8852 light chain 9606
686 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
687 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
688 5VOC 7 L Fab 8I21 light chain 9606
689 5J3D 2 B, D, L 14N4 light chain 9606
690 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
691 5ESZ 2 B, L CH04 Light Chain 9606
692 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
693 3EFF 1 A, C FAB 10090
694 3PJS 1 A, C FAB light chain 10090
695 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
696 4ZYP 5 E, G, I AM14 antibody light chain 9606
697 5DWU 4 L Fab - Light Chain 9606
698 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9605
699 5I8H 5 F, H VRC34.01 Fab light chain 9606
700 4RQS 2 C 17b Fab Light Chain 9606
701 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
702 4R4H 3 L Antibody 2.2c, Light chain 9606
703 5VOD 7 L Fab 9I6 light chain 9606
704 5FHC 5 L Antibody 114 Fab light chain 9606
705 4XMN 6 L Antibody 87 light chain 32630
706 4XMM 8 L Antibody 57 light chain 9606
707 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
708 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
709 5VN3 1 L, N, O 17b Fab light chain 9606
710 5GZR 4 L, N Z23 Fab light chain 9606
711 5THR 4 J, K, L 17b Fab VL domain 9606
712 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
713 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
714 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
715 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
716 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
717 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
718 2ESG 1 L, M Immunoglobulin A1 light chain 9606
719 1R70 1 A, C Human IgA2(m1) Light Chain 9606
720 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606