Sequence Similarity Clusters for the Entities in PDB 3JWD

Entity #1 | Chains: A,B
HIV-1 GP120 ENVELOPE GLYCOPROTEIN protein, length: 379 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 35337
95 % 1 2 25510 Flexibility: Low
Max RMSD: 0.6, Avg RMSD: 0.5
PDBFlex
90 % 1 2 24620
70 % 71 185 132
50 % 71 185 159
40 % 71 185 171
30 % 71 188 189
Entity #2 | Chains: C,D
T-cell surface glycoprotein CD4 protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 19 38 888
95 % 20 43 914 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.2
PDBFlex
90 % 20 43 947
70 % 20 43 974
50 % 20 43 1027
40 % 20 43 1039
30 % 20 43 1025
Entity #3 | Chains: L,O
FAB 48D LIGHT CHAIN protein, length: 213 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 17281
95 % 2 5 10377 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.9
PDBFlex
90 % 444 811 2
70 % 1433 2621 1
50 % 2939 5323 1
40 % 3348 6003 1
30 % 4094 7460 1
Entity #4 | Chains: H,P
FAB 48D HEAVY CHAIN protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 17074
95 % 2 5 10352 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 1.1
PDBFlex
90 % 2 5 10215
70 % 1425 2580 2
50 % 2940 5323 1
40 % 3349 6003 1
30 % 4095 7460 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 4XCF 1 L 4E10 Fab light chain 9606
4 5X08 2 L Fab 4E10 Light chain 9606
5 4XAW 1 L 4E10 Fab light chain 9606
6 5UCB 2 L Fab Light Chain 9606
7 2VXV 2 L HUMAN IGG ABT-325 9606
8 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
9 5I8C 2 B VRC34.01 Fab light chain 9606
10 5WK2 1 L M116 LIGHT CHAIN 9606
11 3PP4 2 L GA101 Fab light chain 10090
12 4PTU 1 A Antibody pn132p2C05, light chain 9606
13 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
14 4XC3 1 L 4E10 Fab light chain 9606
15 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
16 5VSI 2 L CH1/Ckappa Fab light chain 9606
17 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
18 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
19 4NWU 2 L APE1551 Ab Fab light chain 9606
20 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
21 5EWI 2 L VRC38.01 Light Chain 9606
22 5E2W 1 L AT8 LIGHT CHAIN 10090
23 5E2V 1 L AT8 LIGHT CHAIN 10090
24 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
25 6CA7 1 L PCT64_13C light chain 9606
26 5OB5 3 L fAb Light chain 9606
27 3QQ9 1 C, L 101F LIGHT CHAIN 10090
28 5I1K 1 L FAB LIGHT CHAIN 9606
29 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
30 5V7U 1 L CBTAU-22.1 Fab light chain 9606
31 5UEA 3 B, L Fab Light Chain 9606
32 5NMV 1 L Fab light chain 10088
33 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
34 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
35 3QRG 1 L Fab light chain 9606
36 3NCJ 1 L Fab15 Mut8 light chain 9606
37 5W05 1 L M59 FAB LIGHT CHAIN 10090
38 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
39 1UM5 1 L Antibody 21H3 L chain 10090
40 4NWT 1 L APE1531 Ab Fab light chain 9606
41 3NA9 1 L Fab15 light chain 9606
42 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
43 4LRI 1 A, B MSL-109 Light Chain 9606
44 4JN2 1 A, L anti dabigatran Fab 10090
45 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
46 5U6A 1 A Light Chain 9606
47 4HHA 1 A Fab KE5 Fab fragment KE5 9606
48 5UEK 3 L Fab 12E Light Chain 9606
49 3NAA 1 L Fab15 Mut5 light chain 9606
50 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
51 5IK3 2 B, D 1E03 Fab fragment light chain 9606
52 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
53 5U3O 2 L DH511.2_K3 Fab Light Chain 9606
54 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
55 5IT2 2 L light chain 9606
56 6DW2 1 A 6078 Fab light chain 9606
57 6BQB 1 L MGG4 Fab light chain 9606
58 4PUB 2 L DX-2930 LIGHT CHAIN 9606
59 6B14 2 L Light chain of Fab BL3-6S97N 10090
60 5VKD 3 L Fab light chain 9606
61 5XHG 1 A, C polypeptide(L) 10090
62 3OAZ 2 K, L Fab 2G12, light chain 9606
63 4YGV 2 B, L aDabi-Fab2a light chain 9606
64 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
65 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
66 3EO0 1 A, C GC-1008 Fab Light Chain 10090
67 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
68 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
69 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
70 4JHA 2 L D25 light chain 9606
71 6B9Z 1 A Trastuzumab Fab light chain 10090
72 4PTT 1 A Antibody pn132p2C05, light chain 9606
73 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
74 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
75 4DGV 2 L HCV1 Light Chain 9606
76 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
77 3IU4 2 L chP3 Fab light chain 10090
78 3P0Y 3 L Fab DL11 light chain 9606
79 6ANA 3 L LL2 Fab Light Chain 10090
80 5IBU 1 B, L 6652 Light Chain 9606
81 6AOD 1 A FXIa Antibody FAB Light Chain 9606
82 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
83 6ELE 2 B, L fAB light chain 9606
84 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
85 3NAC 1 L Fab15 Mut7 light chain 9606
86 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
87 4YHO 2 L aDabi-Fab3 light chain 9606
88 4DGY 2 L HCV1 Light Chain 9606
89 3MXW 2 L 5E1 light chain 9606
90 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
91 3EO9 1 L Efalizumab Fab fragment, light chain 9606
92 5WUV 1 L light chain 9606
93 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
94 6B0G 1 C 1245 Antibody, Light Chain 9606
95 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
96 6BAH 1 A Trastuzumab Fab light chain,Immunoglobulin kappa constant 10090
97 6D0X 2 B 1210 Antibody, light chain 9606
98 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
99 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
100 5TL5 1 L M2177 LIGHT CHAIN 10090
101 2FX7 1 L Fab 4E10 Light Chain 9606
102 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
103 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
104 5XKU 2 B HNIgGA6 light chain 9606
105 5I18 1 L FAB LIGHT CHAIN 9606
106 4JN1 2 L anti-dabigatran Fab1, light chain 10090
107 3SOB 1 L antibody light chain 9606
108 6B5M 2 L CIS43 Fab Light chain 9606
109 4ZFO 2 L J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
110 4ZFO 4 B J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
111 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
112 5DR5 2 L AbD09097 Fab light chain 9606
113 4KQ3 1 L CNTO3186 light chain Fab 9606
114 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
115 4I77 2 L Lebrikizumab light chain Fab 9606
116 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
117 4HJG 1 A Trastuzumab light chain 9606
118 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
119 3FN0 1 L Fab Z13e1 light chain 9606
120 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
121 4YHI 2 B, L aDabi-Fab2a light chain 9606
122 5NYX 2 L, N, P LIGHT CHAIN fab light chain 9606
123 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
124 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
125 6ELJ 2 B, L fAB light chain 9606
126 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
127 4MAU 1 L C2244 light chain SEE REMARK 999 10090
128 1OP3 1 K, L FAB 2G12, light chain light chain 9606
129 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
130 4LKX 2 B Fab fragment light chain 9606
131 5JW5 2 B, L MEDI8852 Light chain 9606
132 6DCV 1 A, L Light chain of CBTAU27.1 Fab 9606
133 3QWO 1 B, L motavizumab light chain 10090
134 4IOI 1 A Trastuzumab light chain 9606
135 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
136 6GHG 2 B, L Fab light chain 9606
137 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
138 5VAG 2 B Light chain of antibody m826 9606
139 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
140 5I16 1 A, L FAB LIGHT CHAIN 9606
141 5F9O 3 L CH235.09 Light chain 9606
142 1UM4 1 L Antibody 21H3 L chain 10090
143 4RBP 1 K, L Fab 2G12 light chain 9606
144 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
145 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
146 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
147 6DCW 1 L Light chain of CBTAU27.1 Fab 9606
148 5GGQ 1 L nivolumab light chain 9606
149 6B5N 2 L CIS43 Fab Light chain 9606
150 3OAY 1 K, L Fab 2G12, light chain 9606
151 6AND 3 L Pinatuzumab Fab light chain 9606
152 5K9J 2 L 56.a.09 light chain 9606
153 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
154 5TF1 2 L O2-CC Fab Light Chain 9606
155 3TCL 2 B, L CH04 Light Chain Fab 9606
156 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
157 5F7E 2 L Fab light chain 9606
158 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
159 5FHA 2 L Antibody 114 Fab light chain 9606
160 5UMN 3 D, F Antibody C05, light chain 9606
161 4X7S 2 L Ig kappa chain C region residues 23-236 9606
162 1UM6 1 L antibody 21h3, L chain 10090
163 4X0K 2 B, L Fab fragment light chain 9606
164 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
165 5E8E 1 A IGA FAB LIGHT CHAIN 9606
166 6ELL 2 B, L fAB light chain 9606
167 2HFF 1 A, L CB2 Fab, light chain 9606
168 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
169 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
170 5GGS 2 B, D light chain 9606
171 5I1L 1 A, L FAB LIGHT CHAIN 9606
172 5GGV 1 L light chain 9606
173 3L5X 1 L H2L6 LIGHT CHAIN 9606
174 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
175 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
176 2R8S 2 L Fab light chain 10090
177 4HKZ 1 A Trastuzumab light chain 9606
178 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
179 3SO3 2 B A11 FAB light chain 9606
180 3OAU 2 L Fab 2G12, light chain 9606
181 5WEQ 1 A MR78 mutant light chain 9606
182 4WY7 2 L Fab 4E10Light chain 9606
183 4ZYK 2 B, L AM14 light chain 9606
184 6DWA 1 A, L 4497 Fab Light Chain 9606
185 6C9U 2 L Light chain of Fab 1B2 9606
186 5E94 1 A, C Antibody Fab fragment light chain 10090
187 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
188 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
189 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
190 4HIE 1 A Fab 023.102 9606
191 4LEX 1 L FAB HEAVY CHAIN 10090
192 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
193 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
194 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
195 5Y11 2 B MAb 4-5 light chain 9606
196 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
197 4KMT 1 L light chain O12/KAPPA Fab 9606
198 3NZH 1 L 5F6 LIGHT CHAIN 10090
199 1RHH 1 A, C Fab X5, light chain 9606
200 6CW3 2 B, D antibody light chain 9606
201 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
202 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
203 4XTR 3 D, F Antibody Light chain 32630
204 1RZ7 1 L Fab 48d light chain 9606
205 1RZG 2 B, D Fab 412d heavy chain 9606
206 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
207 3PGF 3 L SAB Light Chain 9606
208 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
209 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
210 4YHL 2 L aDabi-Fab2b light chain 9606
211 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
212 6B9Y 1 A Trastuzumab Fab light chain 9606
213 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
214 2QQN 3 L Antibody light chain 9606
215 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
216 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
217 6BAE 1 A Trastuzumab Fab light chain 10090
218 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
219 4YHM 2 L aDabi-Fab2b light chain 9606
220 6H0E 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF dmCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
221 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
222 3X3F 2 L Light chain of KMTR2 9606
223 2CMR 3 L D5 9606
224 5ZV3 3 L Light chain (kappa) of antibody CBTAU28.1 9606
225 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
226 5CZX 3 D, L 20358 Fab light chain 9606
227 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
228 3GRW 2 L Fab light chain 9606
229 6B3K 2 L Light chain of Fab BL3-6 10090
230 6C6Z 3 D, L Antibody CDC2-C2 light chain 9606
231 5I1D 1 A, L FAB LIGHT CHAIN 9606
232 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
233 6AYZ 2 C, D Fab Light Chain 9606
234 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
235 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
236 6CDO 2 B vFP16.02 Fab light chain 10090
237 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
238 5DRX 2 B, L CLL240 BCR light chain 9606
239 4HIX 2 L Humanized 3D6 Fab light chain 10090
240 4LKC 1 A Fab fragment of PCSK9 antibody 9606
241 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
242 4KZD 2 L BL3-6 Fab antibody, light chain 10090
243 4HCR 2 L, N PF-547659 light chain 9606
244 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
245 4HIH 1 A, C Fab 023.102 9606
246 4YHK 2 L aDabi-Fab2a light chain 9606
247 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
248 5IES 2 L VRC01cHuGL2 Fab light chain 9606
249 4UV7 3 L GC1118A 9606
250 5TKJ 2 B, E, H, K vFP1.01 chimeric mouse antibody light chain 10090
251 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
252 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
253 3S34 1 L 1121B Fab light chain 10090
254 6AZX 2 B, D 663 antibody, light chain 9606
255 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
256 5E2T 1 L AT8 LIGHT CHAIN 10090
257 6EMJ 2 B, L fAb light chain 9606
258 5W1G 2 L CR1-07 Fab light chain 9606
259 6CNR 1 L Aducanumab light chain 9606
260 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
261 2AJ3 1 A, C, E Fab m18, Light Chain 9606
262 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
263 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
264 4NRX 3 B, E, L m66 Light Chain 9606
265 3O2D 1 L ibalizumab light chain 10090
266 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
267 5O14 3 D, L Fab 1A12 Light Chain 9606
268 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
269 5V7R 1 L CBTAU-7.1 Fab light chain 9606
270 6B5O 2 L CIS43 Fab Light chain 9606
271 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
272 2R0L 1 L antibody light chain 32630
273 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
274 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
275 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
276 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
277 3Q1S 1 L Z13e1 Fab light chain 9606
278 6DWC 1 A, L 4497 Fab Light Chain 9606
279 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
280 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
281 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
282 5VZ1 1 A, C Apo Antibody Fab Light Chain 9606
283 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
284 5OD8 2 B B2 Fab fragment - Light chain 9606
285 3KR3 3 L antibody-Fab (light chain) 9606
286 5DK3 1 A, F Light Chain 9606
287 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
288 6DZN 1 L Antibody ADI-15878, light chain 9606
289 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
290 4YHN 2 B, L aDabi-Fab3 light chain 9606
291 5GGU 2 B, L light chain 9606
292 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
293 4D9Q 2 D, L Anti-Factor D, light chain 9606
294 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
295 5KW9 3 L IgA Light chain 9606
296 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
297 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
298 5W2B 2 L Fab Light Chain 9606
299 5DRW 2 B CLL183 BCR antibody light chain 9606
300 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
301 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
302 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
303 5MVZ 2 B, L Fab 4AB007 L-chain 9606
304 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
305 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
306 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
307 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
308 2FX9 1 L, M Fab 4E10 Light Chain 9606
309 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
310 6AXL 1 B, C Fab317 light chains 9606
311 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
312 1TZG 1 L, M Fab 4E10 light chain 9606
313 3W9D 2 B, D Antibody Fab light chain 9606
314 6CO3 1 L Fab light chain 9606
315 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
316 3BN9 2 C, E E2 Fab Light Chain 9606
317 6EYN 1 A, C, L 8D6 Fab light chain 8D6 Fab light chain 9606
318 4HWE 2 L Fab light chain light chain 9606
319 5TZ2 2 L C47B222 Fab Light Chain 9606
320 6CDM 2 B, E vFP7.04 light chain 10090
321 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
322 4OGX 3 L DX-2930 LIGHT CHAIN 9606
323 3W9E 3 B Antibody Fab light chain 9606
324 5TFS 2 L 02-K Fab Light chain 9606
325 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
326 5E2U 1 L AT8 LIGHT CHAIN 10090
327 1OM3 1 L, M FAB 2G12, light chain light chain 9606
328 4KZE 2 L BL3-6 Fab antibody, light chain 10090
329 5WT9 2 L Light Chain of Nivolumab 9606
330 4HIJ 1 A, C Fab 023.102 light chain 9606
331 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
332 4XVU 3 D, F, J, L Antibody light chain 32630
333 5B71 1 A, C SKY59 Fab light chain 9606
334 6BF4 3 C, L VRC-PG05 Fab light chain 9606
335 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
336 3EYF 1 A, C 8f9 Fab 9606
337 3NAB 1 L Fab15 Mut6 light chain 9606
338 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
339 5I1C 1 L FAB LIGHT CHAIN 9606
340 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
341 5WNA 2 D, L mAb 3D3 Fab light chain 9606
342 1RZ8 1 A, C Fab 17b light chain 9606
343 4WV1 3 A, D Fab light chain 9606
344 6ANP 1 A, L CAT192 Fab Light chain 9606
345 5EII 2 B, L Fab Light Chain 9606
346 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
347 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
348 4FNL 2 L, M Antibody C05, Light Chain 9606
349 4UB0 2 L IgG1, light chain 9606
350 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
351 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
352 5I1H 1 L FAB LIGHT CHAIN 9606
353 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
354 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
355 5I1J 1 L FAB LIGHT CHAIN 9606
356 3IDX 3 L Fab b13 light chain 9606
357 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
358 6AO0 1 L CAT192 Fab Light chain 9606
359 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
360 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
361 4K94 1 L Fab19 heavy chain 9606
362 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
363 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
364 6B5L 2 L CIS43 Fab Light Chain 9606
365 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
366 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
367 5XAJ 2 B, L FabHM14c10 light chain 9606
368 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
369 5VEB 2 B, L anti-CDH6 Fab light chain 9606
370 5VZX 2 I, L Crenezumab Fab light chain 9606
371 6DWI 1 A, C, E, G, I, K, M, O 4462 Fab Light Chain 9606
372 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
373 3X3G 2 L Light chain of KMTR2 9606
374 5WAW 1 L fAb Light Chain 9606
375 5E08 2 L Fab Light Chain 9606
376 6AZ2 3 E, F Fab Light Chain 9606
377 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
378 5IBT 2 L UCA Light Chain 9606
379 6CA6 1 A, L PCT64_35S light chain 9606
380 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
381 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
382 1A4K 1 A, L ANTIBODY FAB FAB 10090
383 5MO9 2 L AB20 Fab light chain 10090
384 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
385 5XRQ 2 B, L Fab H3v-47 light chain 9606
386 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
387 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
388 4NGH 1 L FAB LIGHT CHAIN 9606
389 5WB9 3 L N60P23 Fab light chain 9606
390 4EDW 2 L tanezumab Fab light chain 9606
391 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
392 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
393 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
394 4NM4 1 L, M Antibody CR8043, Light Chain 9606
395 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
396 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
397 4D9R 2 D, L Fab light chain 9606
398 3U7W 2 L Light chain, Ig kappa chain C region 9606
399 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
400 4G7V 2 L fragment antibody light chain 9606
401 5W06 2 L M1587 FAB LIGHT CHAIN 10090
402 4HFW 1 A, L 6-26 Fab Light chain 9606
403 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
404 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
405 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
406 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
407 5JO4 2 B D80 Fab Light Chain 9606
408 5JO4 4 D G6 Fab Light Chain 9606
409 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
410 3INU 2 L, N KZ52 antibody fragment light chain 9606
411 5EU7 3 C, D FAB light chain 9606
412 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
413 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
414 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
415 6CDP 2 B vFP20.01 Fab light chain 10090
416 5X8M 3 C durvalumab light chain 9606
417 6AMJ 1 A, L CAT192 Fab light chain 9606
418 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
419 4HII 1 A, C Fab 023.102 light chain 9606
420 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
421 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
422 4DN3 1 L CNTO888 LIGHT CHAIN 9606
423 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
424 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
425 5WNB 2 L, M mAb 3D3 Fab light chain 9606
426 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
427 3EYV 1 A, L hu3S193 Fab, light chain 10090
428 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
429 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
430 3PP3 2 K, L GA101 Fab light chain 10090
431 5IJK 3 C, D 1E03 Fab fragment light chain 9606
432 3BDY 2 L Fab Fragment -Light Chain 9606
433 5I8E 2 B, D VRC34.01 Fab light chain 9606
434 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
435 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
436 5UIX 2 L DH576 Fab light chain 9606
437 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
438 4HWB 3 L Fab light chain 9606
439 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
440 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
441 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
442 2HFG 1 L CB3s Fab light chain (kappa) 9606
443 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
444 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
445 4JQI 3 L Fab30 light chain 10090
446 6B0H 3 A, C 1262 antibody, light chain 9606
447 3SKJ 1 L, M Antibody, light chain 9606
448 3U30 2 B, E Light chain Fab 9606
449 6B0A 2 L 1269 antibody, light chain 9606
450 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
451 3U0T 1 A, C ponezumab LC Fab 9606
452 5HYS 2 B, D, F, L Uncharacterized protein 9606
453 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
454 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
455 5I15 1 L FAB LIGHT CHAIN 9606
456 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
457 5I1E 1 L FAB LIGHT CHAIN 9606
458 2NYY 2 C CR1 monoclonal antibody light chain 9606
459 2GCY 1 A huC25 fab fragment light chain 10090
460 4JLR 2 B, L Motavizumab Fab light chain 9606
461 2QQK 3 L Antibody Light Chain 9606
462 4J1U 1 A, C, E antibody 93F3 Light chain 10090
463 5N4G 2 L LIGHT CHAIN 9606
464 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
465 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
466 5SX5 1 K, L Panitumumab Fab Light Chain 9606
467 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
468 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
469 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
470 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
471 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
472 5BK2 3 D, L sAB Light Chain 9606
473 1TZH 2 A, L Fab YADS1 Light Chain 10090
474 5O1R 3 L, M Uncharacterized protein 9606
475 6CMI 2 C m102.3 light chain 9606
476 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
477 4JZJ 3 B, L Fab Light Chain 10090
478 5BMF 2 L Fab fragment light chain 9606
479 5BO1 3 L, M Fab light chain 9606
480 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
481 4M6O 1 L CNTO7309 light chain 9606
482 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
483 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
484 5LSP 3 L, T 107_A07 Fab light chain 9606
485 4DVR 2 L Fab 48d Light chain 9606
486 3EYQ 1 C M2J5 Fab 9606
487 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
488 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
489 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
490 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
491 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
492 4XXD 1 A, D Fab Light Chain 9606
493 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
494 6H06 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF HCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
495 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
496 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
497 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
498 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
499 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
500 3DVG 1 A Human IgG1 fab fragment light chain 9606
501 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
502 2AGJ 1 L Yvo Fab, Light Chain 9606
503 4JKP 3 L Light chain of antibody 45-46M2 9606
504 3EYO 1 A, C 8f9 Fab 9606
505 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
506 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
507 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
508 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
509 4DN4 1 L CNTO888 LIGHT CHAIN 9606
510 5TRP 2 L DH272 Fab light chain 9606
511 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
512 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
513 2FJG 2 A, L Fab light chain 9606
514 4DKF 3 L, M FAb2 Light Chain 9606
515 5TLK 1 A, E M2177 LIGHT CHAIN 10090
516 5TLK 3 C, G H2191 LIGHT CHAIN 10090
517 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
518 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
519 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
520 3EFD 1 L FabL 10090
521 4LF3 1 A, D Fab heavy chain 10090
522 5K59 4 F, L Fab light chain 9606
523 6BFQ 2 B, D, F, L Fab Light Chain 9606
524 5WI9 2 E, L 39F7 Fab light chain 9606
525 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
526 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
527 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
528 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
529 4LEO 2 B RG7116 Fab light chain 10090
530 4G7Y 2 L Fragment antibody light chain 9606
531 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
532 4PY8 4 J antibody 3.1 light chain Fab 9606
533 3SDY 4 L Antibody CR8020, Light Chain 9606
534 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
535 3IXT 1 B, L Motavizumab Fab light chain 10090
536 6FAX 1 L Lob 7.4 light chain 9606
537 4NP4 3 L, M bezlotoxumab light chain 9606
538 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
539 4XCE 1 B, D, L 4E10 Fab light chain 9606
540 5I1I 1 L FAB LIGHT CHAIN 9606
541 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
542 4ERS 1 L Fab light chain 9606
543 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
544 4MWF 2 B, L Fab AR3C light chain 9606
545 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
546 3SQO 3 L J16 Light chain 9606
547 4K3J 4 L Onartuzumab Fab light chain 10090
548 6CYF 2 C, E, L, T IgG1 antibody, kappa light chain 9606
549 4PS4 1 L M1295 LIGHT CHAIN 9606
550 5GGT 3 L IGK@ protein 9606
551 3HI1 2 A, L F105 Light Chain 9606
552 4PY7 2 B, J antibody 3.1 light chain Fab 9606
553 6AL5 2 L B43 LIGHT CHAIN 9606
554 4K8R 3 C Fab1, light chain 9606
555 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
556 5VOB 7 L Fab 8I21 light chain 9606
557 6CMG 2 B m102.3 light chain 9606
558 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
559 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
560 1TZI 1 A Fab YADS2 Light Chain 10090
561 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
562 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
563 4X7T 2 B, L Omalizumab-Fab Light chain 9606
564 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
565 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
566 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
567 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
568 5XMH 2 C, L YES8c light chain 9606
569 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
570 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
571 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
572 5I1G 1 L FAB LIGHT CHAIN 9606
573 2QQL 3 L Antibody Light Chain 9606
574 4XCC 1 L 4E10 Fab light chain 9606
575 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
576 5SX4 1 I, L Panitumumab Fab Light Chain 9606
577 3WD5 2 L Adalimumab Light Chain 9606
578 4NHC 1 L FAB LIGHT CHAIN 9606
579 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
580 5GZO 3 D, L Antibody light chain 9606
581 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
582 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
583 5GMQ 3 C MCA1 light chain 9606
584 6CA9 1 A, C PCT64_LMCA Fab light chain 9606
585 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
586 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
587 4HFU 4 L Fab 8M2 light chain 9606
588 5TRU 1 L, l Ipilimumab Fab light chain 9606
589 4FP8 3 L, M, N, O Antibody C05, light chain 9606
590 4YPG 1 A, L Sifalimumab light chain 9606
591 6CW2 4 B antibody light chain 9606
592 3BE1 3 L Fab Fragment-Light Chain 9606
593 2FJH 2 A, L Fab fragment light chain 9606
594 5XEZ 3 D, L Antibody, mAb1, light chain 9606
595 4K9E 1 L light chain 10090
596 3P0V 1 L, M Fab DL11 light chain 9606
597 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
598 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
599 5VIG 2 B, L Fab light chain 9606
600 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
601 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
602 4KVN 3 L Human IgG Light Chain 9606
603 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
604 5VYF 1 A, L Antibody light chain 10090
605 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
606 5WUX 2 B, D, L light 9606
607 3OB0 1 K, L Fab 2G12, light chain Fab 9606
608 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
609 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
610 6GK7 1 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-27.1(S31Y,T100I) FAB ANTIBODY FRAGMENT 9606
611 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
612 5DUM 2 L 65C6 Light Chain 9606
613 4I18 1 B, L antibody light chain Fab 10090
614 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
615 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
616 3IDY 3 C, L Fab b13 light chain 9606
617 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
618 3IVK 1 B, L Fab light chain man 10090
619 3KYK 2 L Light Chain Li33 IgG1 9606
620 5TGB 2 B, L 02-CB Fab Light Chain 9606
621 5I19 1 L FAB LIGHT CHAIN 9606
622 5TH9 1 L, M, N GS-5745 Fab light chain 9986
623 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
624 4IRZ 2 L Fab Natalizumab light chain 9606
625 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
626 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
627 6GK8 2 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-28.1(S32R;E35K) FAB ANTIBODY FRAGMENT 9606
628 5FEC 2 B, L germline 3BNC60 light chain 9606
629 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
630 2R56 2 L, M IgE Fab Fragment, light chain 9606
631 1ZA6 1 A, C, E, G IGG Light chain 9606
632 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
633 6FGB 3 L 1519.g57- Light chain 9606
634 4ZS6 1 D, L fab Light Chain 9606
635 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
636 6APB 3 L ADI-14359 Fab Light Chain 9606
637 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
638 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
639 5K9K 2 B, L 56.a.09 Light chain 9606
640 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
641 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
642 5W4L 6 C, E Antibody N12-i3 light chain 9606
643 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
644 6D01 2 B, D, F, H 1210 Antibody, Light chain 9606
645 5CZV 3 L Fab 20350 light chain 9606
646 5XF1 3 D, L Antibody mAb1 Light chain 9606
647 4P59 3 L MOR09825 Fab fragment light chain 9606
648 5XXY 2 L light chain of atezolizumab fab 9606
649 5CJO 3 L FAB light chain 10090
650 4LMQ 3 I, L Stromal cell-derived factor 1 9606
651 3N85 2 L Fab37 Light Chain 9606
652 6AMM 1 L CAT192 Fab Light chain 9606
653 3G6J 3 E, G Fab light chain 9606
654 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
655 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
656 6B9J 3 B, L Fab vv138 Light chain 9606
657 5O4G 2 A MF3958 FAB light chain 9606
658 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
659 4DKE 3 L, M FAb1.1 Light Chain 9606
660 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
661 5I17 1 A, L FAB LIGHT CHAIN 9606
662 5VIC 2 L Fab light chain 9606
663 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
664 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
665 4R8W 4 L Light chain of neutralizing antibody CT149 9606
666 5TPN 3 L hRSV0 light chain 9606
667 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
668 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
669 4NRY 1 B, L m66 Heavy Chain 9606
670 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
671 3S37 1 L 1121B Fab light chain 10090
672 5TZT 1 B, L Light Chain of Fab C47B161 9606
673 5XHF 1 A, C polypeptide (L chain) 10090
674 5VL7 4 L Fab33 light chain 9606
675 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
676 5JXE 2 C, F Pembrolizumab Fab light chain 9606
677 5KZC 3 D, G, L VRC01 Fab light chain 9606
678 5W42 4 L Fab H3v-47 light chain 9606
679 4JM2 3 C 17b Light chain Fab 9606
680 1S78 2 C, E Pertuzumab Fab light chain 10090
681 1OP5 1 K, L FAB 2G12, light chain light chain 9606
682 5BK0 1 A, C 663 Antibody, light chain 9606
683 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
684 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
685 5D1Z 1 A, H Y10 Light Chain 9606
686 5D1Z 3 C, E D4-10 Light Chain 9606
687 5GGR 2 B, L light chain 9606
688 5IBL 4 D, L 6639 Light Chain 9606
689 4XHJ 3 C, G Fab-RC light chain 9606
690 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
691 5O4O 1 A MF3178 FAB light chain 9606
692 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
693 4N90 3 E, G, I Fab light chain 9606
694 5BK5 2 A, C, E, G 663 germline antibody, light chain 9606
695 5VGJ 3 L VRC38.01 Fab Light Chain 9606
696 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
697 6B0E 1 A 1260 antibody, light chain 9606
698 5D1Q 1 A D2-06 Light Chain 9606
699 5D1Q 4 D P5 Light Chain 9606
700 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
701 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
702 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
703 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
704 5XHV 3 L, Q S40 light chain 9606
705 5UWE 2 L HUMAN ANTI-HIV ANTIBODY N12-I2 Fab LIGHT CHAIN 9606
706 4IOF 3 D, F Fab-bound IDE, light chain 10090
707 5FUO 3 L FAB LIGHT CHAIN 9606
708 5FEH 1 A, C, E PCT64_26 Fab light chain 9606
709 4JHW 2 L D25 light chain 9606
710 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
711 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
712 4M1C 3 D, F Fab-bound IDE, light chain 9606
713 5UQY 3 C, G, K, O MR78 Fab light chain 9606
714 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
715 3ULV 2 L Fab15 light chain 9606
716 5UG0 3 C 2897 light chain 9606
717 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
718 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
719 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
720 5UOE 3 L, N, Q, T, W FAB light chain 9606
721 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
722 5D1X 1 A D4-30 Light Chain 9606
723 5D1X 4 D P5 Light Chain 9606
724 5JW3 4 L MEDI8852 light chain 9606
725 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
726 5UMI 2 B, L PA50 Fab Light chain 9606
727 6D11 2 B, D 1450 Antibody, Light chain 9606
728 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
729 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
730 3S36 1 L 1121B light chain 10090
731 5CWS 1 A, G sAB-158 Fab Light Chain 9606
732 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
733 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
734 2R0K 2 L antibody light chain of Fab58 9606
735 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
736 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
737 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
738 4G80 3 B, D, F, H fragment antibody light chain 9606
739 3JWO 3 L FAB 48D LIGHT CHAIN 9606
740 5CD5 3 D DRVIA7 Fab Light Chain 9606
741 3P11 2 L Fab DL11 light chain 9606
742 6EYO 3 L, M 8D6 Fab light chain 8D6 Fab light chain 9606
743 3F12 1 A, C M2J1 Fab 9606
744 3B2V 1 L IMC-11F8 FAB Light chain 9606
745 5IGX 3 L germline NIH45-46 light chain 9606
746 3ULU 2 L Fab15 light chain 9606
747 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
748 6ATT 3 L Antibody 39S Fab light chain Antibody, light chain 9606
749 5W1K 1 A, F, K, S CR1-28 Fab light chain 9606
750 5W1K 3 C, H, M, N CR1-10 Fab light chain 9606
751 4XI5 3 C Fab-94 light chain 9606
752 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
753 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
754 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
755 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
756 5W1M 1 A, C, E, G CR1-07 Fab light chain 9606
757 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
758 5K9O 2 B, L 31.b.09 Light Fv 9606
759 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
760 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
761 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
762 5JW4 6 R MEDI8852 light chain 9606
763 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
764 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
765 5VOC 7 L Fab 8I21 light chain 9606
766 5J3D 2 B, D, L 14N4 light chain 9606
767 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
768 5ESZ 2 B, L CH04 Light Chain 9606
769 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
770 3EFF 1 A, C FAB 10090
771 3PJS 1 A, C FAB light chain 10090
772 5O7P 2 A MF3178 FAB light chain 9606
773 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
774 4ZYP 5 E, G, I AM14 antibody light chain 9606
775 6B3M 4 D, J, N, P, U, W 70-1F02 Fab Light Chain 9606
776 5DWU 4 L Fab - Light Chain 9606
777 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
778 6EA7 4 L, N, R ADI-15878 Fab Light Chain 9606
779 5I8H 5 F, H VRC34.01 Fab light chain 9606
780 4RQS 2 C 17b Fab Light Chain 9606
781 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
782 4R4H 3 L Antibody 2.2c, Light chain 9606
783 6EA5 4 L, N, R ADI-15878 Fab Light Chain 9606
784 5VOD 7 L Fab 9I6 light chain 9606
785 5FHC 5 L Antibody 114 Fab light chain 9606
786 4XMN 6 L Antibody 87 light chain 32630
787 4XMM 8 L Antibody 57 light chain 9606
788 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
789 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
790 6E1K 2 C, E cat06 light chain 9606
791 6DJP 6 F 68 light chain Fab 10090
792 6CUF 2 4, L, l vFP1.01 Light chain 10090
793 6CMO 5 L Fab light chain 32630
794 6CDE 2 4, L, l vFP20.01 Light chain 9606
795 6CDI 8 4, L, l vFP16.02 Light Chain 9606
796 6BF7 3 D, F Fab H11-E light chain 10090
797 6BF9 3 D, F Fab H11-E light chain 10090
798 6B7Z 3 D, F FAB H11 light chain 10090
799 6B70 3 D, F FAB H11-E light chain 10090
800 5VN3 1 L, N, O 17b Fab light chain 9606
801 5GZR 4 L, N Z23 Fab light chain 9606
802 5THR 4 J, K, L 17b Fab VL domain 9606
803 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
804 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
805 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
806 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
807 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
808 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
809 2ESG 1 L, M Immunoglobulin A1 light chain 9606
810 1R70 1 A, C Human IgA2(m1) Light Chain 9606
811 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606