Sequence Similarity Clusters for the Entities in PDB 3CCS

Entity #1 | Chains: A
50S ribosomal protein L2P protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 43 1188
95 % 39 68 807 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 838
70 % 39 68 887
50 % 39 206 210
40 % 39 206 230
30 % 39 206 247
Entity #10 | Chains: J
50S ribosomal protein L13P protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 583
95 % 39 74 714 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 734
70 % 39 74 778
50 % 39 74 841
40 % 40 78 829
30 % 40 78 826
Entity #11 | Chains: K
50S ribosomal protein L14P protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 650
95 % 39 68 794 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 68 825
70 % 39 68 871
50 % 39 216 204
40 % 54 649 24
30 % 54 649 40
Entity #12 | Chains: L
50S ribosomal protein L15P protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 588
95 % 39 74 723 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 750
70 % 39 74 792
50 % 39 74 850
40 % 39 213 223
30 % 39 213 242
Entity #13 | Chains: M
50S ribosomal protein L15e protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 20 3122
95 % 36 47 1279 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 36 47 1303
70 % 39 68 872
50 % 39 215 205
40 % 39 215 222
30 % 39 215 240
Entity #14 | Chains: N
50S ribosomal protein L18P protein, length: 187 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 579
95 % 39 74 709 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 39 74 738
70 % 39 74 781
50 % 39 76 815
40 % 39 76 844
30 % 39 79 811
Entity #15 | Chains: O
50S ribosomal protein L18e protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 661
95 % 39 68 808 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 839
70 % 39 68 889
50 % 39 70 893
40 % 39 70 924
30 % 39 70 912
Entity #16 | Chains: P
50S ribosomal protein L19e protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1064
95 % 39 68 813 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 844
70 % 39 68 893
50 % 39 68 940
40 % 39 72 895
30 % 39 72 898
Entity #17 | Chains: Q
50S ribosomal protein L21e protein, length: 96 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 651
95 % 39 68 795 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 826
70 % 39 68 873
50 % 39 70 905
40 % 39 70 939
30 % 39 71 907
Entity #18 | Chains: R
50S ribosomal protein L22P protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 674
95 % 39 68 798 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 829
70 % 39 68 878
50 % 39 68 930
40 % 39 68 961
30 % 39 213 241
Entity #19 | Chains: S
50S ribosomal protein L23P protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 591
95 % 39 74 724 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 39 74 753
70 % 39 74 797
50 % 39 77 805
40 % 53 497 39
30 % 53 497 59
Entity #2 | Chains: B
50S ribosomal protein L3P protein, length: 338 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 677
95 % 39 74 720 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 39 74 747
70 % 39 74 789
50 % 39 74 849
40 % 39 221 219
30 % 39 221 237
Entity #20 | Chains: T
50S ribosomal protein L24P protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 584
95 % 39 74 716 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 743
70 % 39 74 786
50 % 39 222 203
40 % 39 223 216
30 % 39 223 236
Entity #21 | Chains: U
50S ribosomal protein L24e protein, length: 67 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 70 622
95 % 37 70 765 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 37 70 797
70 % 37 70 839
50 % 37 70 895
40 % 37 70 925
30 % 37 70 913
Entity #22 | Chains: V
50S ribosomal protein L29P protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 585
95 % 39 74 717 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 744
70 % 39 74 787
50 % 39 74 844
40 % 53 452 58
30 % 53 478 70
Entity #23 | Chains: W
50S ribosomal protein L30P protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 655
95 % 39 68 799 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 830
70 % 39 68 879
50 % 39 68 931
40 % 39 70 929
30 % 39 71 906
Entity #24 | Chains: X
50S ribosomal protein L31e protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 652
95 % 39 68 809 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 840
70 % 39 68 890
50 % 39 68 938
40 % 39 68 968
30 % 39 70 921
Entity #25 | Chains: Y
50S ribosomal protein L32e protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 63 730
95 % 36 63 900 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 63 929
70 % 36 63 970
50 % 36 63 1016
40 % 36 63 1037
30 % 36 63 1013
Entity #26 | Chains: Z
50S ribosomal protein L37Ae protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 11 17 3921
95 % 11 17 4284 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 11 17 4319
70 % 11 17 4221
50 % 11 17 4063
40 % 11 17 3866
30 % 11 17 3523
Entity #27 | Chains: 1
50S ribosomal protein L37e protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 662
95 % 39 68 796 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 827
70 % 39 68 874
50 % 39 69 907
40 % 39 69 942
30 % 39 69 926
Entity #28 | Chains: 2
50S ribosomal protein L39e protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 676
95 % 39 68 801 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 832
70 % 39 68 882
50 % 39 208 207
40 % 39 208 229
30 % 39 208 246
Entity #29 | Chains: 3
50S ribosomal protein L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 649
95 % 39 68 793 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 824
70 % 39 68 870
50 % 39 68 924
40 % 39 203 234
30 % 39 203 251
Entity #3 | Chains: C
50S ribosomal protein L4P protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 15 23 2676
95 % 39 74 708 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 74 737
70 % 39 74 780
50 % 39 74 837
40 % 39 76 843
30 % 40 78 824
Entity #30 | Chains: 0
23S RIBOSOMAL RNA rna, length: 2923 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #31 | Chains: 9
5S RIBOSOMAL RNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
50S ribosomal protein L5P protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 587
95 % 39 74 718 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 39 74 746
70 % 39 74 788
50 % 39 74 848
40 % 40 215 221
30 % 40 215 239
Entity #5 | Chains: E
50S ribosomal protein L6P protein, length: 178 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 658
95 % 39 68 805 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 836
70 % 39 68 868
50 % 39 68 935
40 % 39 213 224
30 % 54 638 41
Entity #6 | Chains: F
50S ribosomal protein L7Ae protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1045
95 % 36 47 1263 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 39 68 823
70 % 39 68 869
50 % 56 108 416
40 % 63 133 338
30 % 77 293 158
Entity #7 | Chains: G
50S ribosomal protein L10E protein, length: 348 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 64 706
95 % 37 64 862 Flexibility: No
Max RMSD: 3.2, Avg RMSD: 0.4
PDBFlex
90 % 37 64 895
70 % 37 64 940
50 % 37 64 991
40 % 37 64 1013
30 % 37 64 991
Entity #8 | Chains: H
50S ribosomal protein L10e protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1058
95 % 36 47 1270 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 47 1296
70 % 36 47 1323
50 % 39 74 842
40 % 39 79 809
30 % 39 79 815
Entity #9 | Chains: I
50S ribosomal protein L11P protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 42 1212
95 % 33 42 1447 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.6
PDBFlex
90 % 33 42 1469
70 % 33 42 1483
50 % 34 46 1337
40 % 34 46 1324
30 % 34 98 628

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 6HHQ 5 CE, k 60S ribosomal protein L3 4932
79 5OBM 5 L3, l3 60S ribosomal protein L3 4932
80 4U53 40 L3, l3 60S ribosomal protein L3 4932
81 5ON6 5 CE, k 60S ribosomal protein L3 4932
82 1Q86 5 D 50S ribosomal protein L3P 2238
83 4U50 40 L3, l3 60S ribosomal protein L3 4932
84 5NDV 5 L3, l3 60S ribosomal protein L3 4932
85 5LYB 40 L3, l3 60S ribosomal protein L3 4932
86 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
87 3G4S 3 B 50S ribosomal protein L3P 2238
88 3CCJ 2 B 50S ribosomal protein L3P 2238
89 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
90 4U56 40 L3, l3 60S ribosomal protein L3 4932
91 2QA4 4 B 50S ribosomal protein L3P 2238
92 5TGA 40 L3, l3 60S ribosomal protein L3 4932
93 5MEI 5 CE, k 60S ribosomal protein L3 4932
94 1Q7Y 5 D 50S ribosomal protein L3P 2238
95 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
96 4U4O 40 L3, l3 60S ribosomal protein L3 4932
97 5DGV 40 L3, l3 60S ribosomal protein L3 4932
98 5DGE 40 L3, l3 60S ribosomal protein L3 4932
99 5NDW 28 L3, l3 60S ribosomal protein L3 4932
100 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
101 5NDG 40 L3, l3 60S ribosomal protein L3 4932
102 5FCI 40 L3, l3 60S ribosomal protein L3 4932
103 5DC3 40 L3, l3 60S ribosomal protein L3 4932
104 5DGF 40 L3, l3 60S ribosomal protein L3 4932
105 5TGM 40 L3, l3 60S ribosomal protein L3 4932
106 4V7R 34 BC, DC 60S ribosomal protein L3 4932
107 4V4P 5 AE 50S ribosomal protein L3 274
108 4V4R 29 BE 50S ribosomal protein L3 274
109 4V4S 29 BE 50S ribosomal protein L3 274
110 4V4T 28 BE 50S ribosomal protein L3 274
111 6I7O 5 BA, YA 60S ribosomal protein L3 4932
112 6MTB 8 B 60S ribosomal protein L3 9986
113 6MTC 6 B 60S ribosomal protein L3 9986
114 6MTD 5 B uL3 9986
115 6MTE 5 B uL3 9986
116 6HD7 9 F 60S ribosomal protein L3 4932
117 6HCQ 39 B3 uL3 9986
118 6HCJ 39 B3 uL3 9986
119 6HCM 41 B3 uL3 9986
120 6HCF 41 B3 uL3 9986
121 6GZ3 42 AB ribosomal protein uL3 9986
122 6GZ4 3 AB ribosomal protein uL3 9986
123 6GZ5 42 AB ribosomal protein uL3 9986
124 6GQV 7 B 60S ribosomal protein L3 4932
125 6GQ1 7 B 60S ribosomal protein L3 4932
126 6GQB 7 B 60S ribosomal protein L3 4932
127 6D9J 2 B uL3 9986
128 6D90 2 B uL3 9986
129 6FTG 2 B uL3 9986
130 6FTI 2 B uL3 9986
131 6FTJ 2 B uL3 9986
132 6FT6 3 B 60S ribosomal protein L3 4932
133 6FRK 10 B Ribosomal protein uL3 9986
134 5Z3G 6 F 60S ribosomal protein L3 4932
135 6C0F 5 B 60S ribosomal protein L3 4932
136 6EM1 16 B 60S ribosomal protein L3 4932
137 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
138 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
139 6ELZ 28 B 60S ribosomal protein L3 4932
140 6EK0 5 LB 60S ribosomal protein L3 9606
141 6AZ3 2 B ribosomal protein uL3 5661
142 5XY3 5 B Uncharacterized protein 5722
143 5XXB 5 B Ribosomal protein uL3 5811
144 5UMD 5 E 60S ribosomal protein L3 5833
145 5MC6 67 BA 60S ribosomal protein L3 4932
146 5H4P 5 B 60S ribosomal protein L3 4932
147 5M1J 42 B5 60S ribosomal protein L3 4932
148 5LZS 2 B uL3 9986
149 5LZT 2 B uL3 9986
150 5LZU 2 B uL3 9986
151 5LZV 2 B uL3 9986
152 5LZW 2 B uL3 9986
153 5LZX 2 B Ul3 9986
154 5LZY 2 B uL3 9986
155 5LZZ 2 B uL3 9986
156 5T62 6 E 60S ribosomal protein L3 4932
157 5T6R 5 E 60S ribosomal protein L3 4932
158 5T5H 29 f Ribosomal protein L13 5693
159 5T2A 30 d uL3 5661
160 5T2C 4 E 60S ribosomal protein L3 9606
161 5LKS 5 LB 60S ribosomal protein L3 9606
162 5JUO 7 G uL3 (yeast L3) 4932
163 5JUP 7 G uL3 (yeast L3) 4932
164 5JUS 7 G uL3 (yeast L3) 4932
165 5JUT 7 G uL3 (yeast L3) 4932
166 5JUU 7 G uL3 (yeast L3) 4932
167 5JCS 3 B 60S ribosomal protein L3 4932
168 5IT7 5 BB 60S ribosomal protein L3 28985
169 3JCT 2 B 60S ribosomal protein L3 4932
170 3JCS 10 B ribosomal protein L3 5661
171 5GAK 17 F 60S ribosomal protein L3 4932
172 5FL8 2 B 60S ribosomal protein L3 4932
173 5APN 5 B 60S ribosomal protein L3 4932
174 5APO 5 B 60S ribosomal protein L3 4932
175 3JBN 70 AE 60S ribosomal protein uL3 5833
176 3JBO 70 AE 60S ribosomal protein uL3 5833
177 3JBP 70 AE 60S ribosomal protein uL3 5833
178 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
179 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
180 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
181 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
182 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
183 3JAG 2 B uL3 9986
184 3JAH 2 B uL3 9986
185 3JAI 2 B uL3 9986
186 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
187 5AJ0 4 AB 60S ribosomal protein L3 9606
188 3J92 2 B uL3 9986
189 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
190 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
191 4V3P 80 LC Ribosomal protein L3 4565
192 3J7O 5 B Ribosomal protein uL3 9823
193 3J7P 5 B Ribosomal protein uL3 9823
194 3J7Q 5 B Ribosomal protein uL3 9823
195 3J7R 5 B Ribosomal protein uL3 9823
196 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
197 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
198 3J79 5 E 60S ribosomal protein uL3 5833
199 3J77 3 L3 60S ribosomal protein L3 4932
200 3J78 3 L3 60S ribosomal protein L3 4932
201 3J6X 6 L3 60S ribosomal protein L3 4932
202 3J6Y 6 L3 60S ribosomal protein L3 4932
203 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
204 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
205 4V7F 6 C 60S ribosomal protein L3 4932
206 4V7E 71 CB 60S ribosomal protein L3 4565
207 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
208 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
209 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
210 4V6W 63 CB 60S ribosomal protein L3 7227
211 4V6X 63 CB 60S ribosomal protein L3 9606
212 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
213 4V6U 33 BC 50S ribosomal protein L3P 2261
214 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
215 4ADX 12 B RPL3 145262
216 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
217 4V7H 27 BC 60S ribosomal protein L3 5541
218 4V5Z 54 Bb 60S Ribosomal protein L3 9612
219 4V4B 22 BC 60S ribosomal protein L3 4932
220 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
221 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274