Sequence Similarity Clusters for the Entities in PDB 3CCS

Entity #1 | Chains: A
50S ribosomal protein L2P protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 43 1152
95 % 39 68 789 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 821
70 % 39 68 871
50 % 39 203 209
40 % 39 203 230
30 % 39 203 247
Entity #10 | Chains: J
50S ribosomal protein L13P protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 567
95 % 39 74 699 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 716
70 % 39 74 762
50 % 39 74 819
40 % 40 78 811
30 % 40 78 810
Entity #11 | Chains: K
50S ribosomal protein L14P protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 634
95 % 39 68 774 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 68 805
70 % 39 68 855
50 % 39 213 201
40 % 54 642 23
30 % 54 642 39
Entity #12 | Chains: L
50S ribosomal protein L15P protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 572
95 % 39 74 708 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 733
70 % 39 74 777
50 % 39 74 830
40 % 39 210 222
30 % 39 210 242
Entity #13 | Chains: M
50S ribosomal protein L15e protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 20 3057
95 % 36 47 1251 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 36 47 1278
70 % 39 68 856
50 % 39 212 202
40 % 39 212 221
30 % 39 212 240
Entity #14 | Chains: N
50S ribosomal protein L18P protein, length: 187 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 563
95 % 39 74 694 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 39 74 720
70 % 39 74 766
50 % 39 76 793
40 % 39 76 825
30 % 39 79 798
Entity #15 | Chains: O
50S ribosomal protein L18e protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 647
95 % 39 68 790 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 822
70 % 39 68 873
50 % 39 70 877
40 % 39 70 903
30 % 39 70 894
Entity #16 | Chains: P
50S ribosomal protein L19e protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1039
95 % 39 68 795 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 827
70 % 39 68 876
50 % 39 68 925
40 % 39 72 877
30 % 39 72 880
Entity #17 | Chains: Q
50S ribosomal protein L21e protein, length: 96 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 635
95 % 39 68 775 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 806
70 % 39 68 857
50 % 39 70 888
40 % 39 70 919
30 % 39 71 889
Entity #18 | Chains: R
50S ribosomal protein L22P protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 662
95 % 39 68 780 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 812
70 % 39 68 862
50 % 39 68 916
40 % 39 68 942
30 % 39 210 241
Entity #19 | Chains: S
50S ribosomal protein L23P protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 575
95 % 39 74 709 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 39 74 736
70 % 39 74 783
50 % 39 77 784
40 % 53 493 40
30 % 53 493 60
Entity #2 | Chains: B
50S ribosomal protein L3P protein, length: 338 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 665
95 % 39 74 706 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 39 74 731
70 % 39 74 775
50 % 39 74 829
40 % 39 218 216
30 % 39 218 236
Entity #20 | Chains: T
50S ribosomal protein L24P protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 568
95 % 39 74 701 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 726
70 % 39 74 771
50 % 39 219 200
40 % 39 220 214
30 % 39 220 235
Entity #21 | Chains: U
50S ribosomal protein L24e protein, length: 67 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 70 607
95 % 37 70 745 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 37 70 777
70 % 37 70 820
50 % 37 70 878
40 % 37 70 904
30 % 37 70 896
Entity #22 | Chains: V
50S ribosomal protein L29P protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 569
95 % 39 74 702 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 727
70 % 39 74 772
50 % 39 74 822
40 % 53 448 52
30 % 53 474 65
Entity #23 | Chains: W
50S ribosomal protein L30P protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 639
95 % 39 68 781 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 813
70 % 39 68 863
50 % 39 68 917
40 % 39 70 909
30 % 39 71 888
Entity #24 | Chains: X
50S ribosomal protein L31e protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 636
95 % 39 68 791 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 823
70 % 39 68 874
50 % 39 68 924
40 % 39 68 949
30 % 39 70 903
Entity #25 | Chains: Y
50S ribosomal protein L32e protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 63 717
95 % 36 63 877 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 63 907
70 % 36 63 947
50 % 36 63 995
40 % 36 63 1017
30 % 36 63 1001
Entity #26 | Chains: Z
50S ribosomal protein L37Ae protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 11 17 3848
95 % 11 17 4206 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 11 17 4245
70 % 11 17 4156
50 % 11 17 4020
40 % 11 17 3813
30 % 11 17 3475
Entity #27 | Chains: 1
50S ribosomal protein L37e protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 648
95 % 39 68 776 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 807
70 % 39 68 858
50 % 39 69 891
40 % 39 69 923
30 % 39 69 909
Entity #28 | Chains: 2
50S ribosomal protein L39e protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 663
95 % 39 68 784 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 816
70 % 39 68 867
50 % 39 205 207
40 % 39 205 226
30 % 39 205 246
Entity #29 | Chains: 3
50S ribosomal protein L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 633
95 % 39 68 773 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 804
70 % 39 68 854
50 % 39 68 909
40 % 39 200 234
30 % 39 200 250
Entity #3 | Chains: C
50S ribosomal protein L4P protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 15 23 2623
95 % 39 74 693 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 74 719
70 % 39 74 765
50 % 39 74 814
40 % 39 76 824
30 % 40 78 808
Entity #30 | Chains: 0
23S RIBOSOMAL RNA rna, length: 2923 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #31 | Chains: 9
5S RIBOSOMAL RNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
50S ribosomal protein L5P protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 571
95 % 39 74 704 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 39 74 730
70 % 39 74 774
50 % 39 74 828
40 % 40 212 220
30 % 40 212 238
Entity #5 | Chains: E
50S ribosomal protein L6P protein, length: 178 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 644
95 % 39 68 788 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 820
70 % 39 68 851
50 % 39 68 922
40 % 39 210 224
30 % 54 631 40
Entity #6 | Chains: F
50S ribosomal protein L7Ae protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1019
95 % 36 47 1236 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 39 68 803
70 % 39 68 852
50 % 56 108 404
40 % 63 133 322
30 % 77 290 155
Entity #7 | Chains: G
50S ribosomal protein L10E protein, length: 348 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 64 692
95 % 37 64 842 Flexibility: No
Max RMSD: 3.2, Avg RMSD: 0.4
PDBFlex
90 % 37 64 875
70 % 37 64 919
50 % 37 64 976
40 % 37 64 997
30 % 37 64 980
Entity #8 | Chains: H
50S ribosomal protein L10e protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1032
95 % 36 47 1243 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 47 1272
70 % 36 47 1301
50 % 39 74 815
40 % 39 79 790
30 % 39 79 797
Entity #9 | Chains: I
50S ribosomal protein L11P protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 42 1189
95 % 33 42 1417 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.6
PDBFlex
90 % 33 42 1442
70 % 33 42 1458
50 % 34 46 1314
40 % 34 46 1303
30 % 34 98 608

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 5OBM 5 L3, l3 60S ribosomal protein L3 4932
79 4U53 40 L3, l3 60S ribosomal protein L3 4932
80 5ON6 5 CE, k 60S ribosomal protein L3 4932
81 1Q86 5 D 50S ribosomal protein L3P 2238
82 4U50 40 L3, l3 60S ribosomal protein L3 4932
83 5NDV 5 L3, l3 60S ribosomal protein L3 4932
84 5LYB 40 L3, l3 60S ribosomal protein L3 4932
85 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
86 3G4S 3 B 50S ribosomal protein L3P 2238
87 3CCJ 2 B 50S ribosomal protein L3P 2238
88 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
89 4U56 40 L3, l3 60S ribosomal protein L3 4932
90 2QA4 4 B 50S ribosomal protein L3P 2238
91 5TGA 40 L3, l3 60S ribosomal protein L3 4932
92 5MEI 5 CE, k 60S ribosomal protein L3 4932
93 1Q7Y 5 D 50S ribosomal protein L3P 2238
94 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
95 4U4O 40 L3, l3 60S ribosomal protein L3 4932
96 5DGV 40 L3, l3 60S ribosomal protein L3 4932
97 5DGE 40 L3, l3 60S ribosomal protein L3 4932
98 5NDW 28 L3, l3 60S ribosomal protein L3 4932
99 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
100 5NDG 40 L3, l3 60S ribosomal protein L3 4932
101 5FCI 40 L3, l3 60S ribosomal protein L3 4932
102 5DC3 40 L3, l3 60S ribosomal protein L3 4932
103 5DGF 40 L3, l3 60S ribosomal protein L3 4932
104 5TGM 40 L3, l3 60S ribosomal protein L3 4932
105 4V7R 34 BC, DC 60S ribosomal protein L3 4932
106 4V4P 5 AE 50S ribosomal protein L3 274
107 4V4R 29 BE 50S ribosomal protein L3 274
108 4V4S 29 BE 50S ribosomal protein L3 274
109 4V4T 28 BE 50S ribosomal protein L3 274
110 6MTB 8 B 60S ribosomal protein L3 9986
111 6MTC 6 B 60S ribosomal protein L3 9986
112 6MTD 5 B uL3 9986
113 6MTE 5 B uL3 9986
114 6HCQ 39 B3 uL3 9986
115 6HCJ 39 B3 uL3 9986
116 6HCM 41 B3 uL3 9986
117 6HCF 41 B3 uL3 9986
118 6GZ3 42 AB ribosomal protein uL3 9986
119 6GZ4 3 AB ribosomal protein uL3 9986
120 6GZ5 42 AB ribosomal protein uL3 9986
121 6GQV 7 B 60S ribosomal protein L3 4932
122 6GQ1 7 B 60S ribosomal protein L3 4932
123 6GQB 7 B 60S ribosomal protein L3 4932
124 6D9J 2 B uL3 9986
125 6D90 2 B uL3 9986
126 6FTG 2 B uL3 9986
127 6FTI 2 B uL3 9986
128 6FTJ 2 B uL3 9986
129 6FT6 3 B 60S ribosomal protein L3 4932
130 6FRK 10 B Ribosomal protein uL3 9986
131 5Z3G 6 F 60S ribosomal protein L3 4932
132 6C0F 5 B 60S ribosomal protein L3 4932
133 6EM1 16 B 60S ribosomal protein L3 4932
134 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
135 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
136 6ELZ 28 B 60S ribosomal protein L3 4932
137 6EK0 5 LB 60S ribosomal protein L3 9606
138 6AZ3 2 B ribosomal protein uL3 5661
139 5XY3 5 B Uncharacterized protein 5722
140 5XXB 5 B Ribosomal protein uL3 5811
141 5UMD 5 E 60S ribosomal protein L3 5833
142 5MC6 67 BA 60S ribosomal protein L3 4932
143 5H4P 5 B 60S ribosomal protein L3 4932
144 5M1J 42 B5 60S ribosomal protein L3 4932
145 5LZS 2 B uL3 9986
146 5LZT 2 B uL3 9986
147 5LZU 2 B uL3 9986
148 5LZV 2 B uL3 9986
149 5LZW 2 B uL3 9986
150 5LZX 2 B Ul3 9986
151 5LZY 2 B uL3 9986
152 5LZZ 2 B uL3 9986
153 5T62 6 E 60S ribosomal protein L3 4932
154 5T6R 5 E 60S ribosomal protein L3 4932
155 5T5H 29 f Ribosomal protein L13 5693
156 5T2A 30 d uL3 5661
157 5T2C 4 E 60S ribosomal protein L3 9606
158 5LKS 5 LB 60S ribosomal protein L3 9606
159 5JUO 7 G uL3 (yeast L3) 4932
160 5JUP 7 G uL3 (yeast L3) 4932
161 5JUS 7 G uL3 (yeast L3) 4932
162 5JUT 7 G uL3 (yeast L3) 4932
163 5JUU 7 G uL3 (yeast L3) 4932
164 5JCS 3 B 60S ribosomal protein L3 4932
165 5IT7 5 BB 60S ribosomal protein L3 28985
166 3JCT 2 B 60S ribosomal protein L3 4932
167 3JCS 10 B ribosomal protein L3 5661
168 5GAK 17 F 60S ribosomal protein L3 4932
169 5FL8 2 B 60S ribosomal protein L3 4932
170 5APN 5 B 60S ribosomal protein L3 4932
171 5APO 5 B 60S ribosomal protein L3 4932
172 3JBN 70 AE 60S ribosomal protein uL3 5833
173 3JBO 70 AE 60S ribosomal protein uL3 5833
174 3JBP 70 AE 60S ribosomal protein uL3 5833
175 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
176 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
177 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
178 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
179 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
180 3JAG 2 B uL3 9986
181 3JAH 2 B uL3 9986
182 3JAI 2 B uL3 9986
183 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
184 5AJ0 4 AB 60S ribosomal protein L3 9606
185 3J92 2 B uL3 9986
186 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
187 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
188 4V3P 80 LC Ribosomal protein L3 4565
189 3J7O 5 B Ribosomal protein uL3 9823
190 3J7P 5 B Ribosomal protein uL3 9823
191 3J7Q 5 B Ribosomal protein uL3 9823
192 3J7R 5 B Ribosomal protein uL3 9823
193 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
194 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
195 3J79 5 E 60S ribosomal protein uL3 5833
196 3J77 3 L3 60S ribosomal protein L3 4932
197 3J78 3 L3 60S ribosomal protein L3 4932
198 3J6X 6 L3 60S ribosomal protein L3 4932
199 3J6Y 6 L3 60S ribosomal protein L3 4932
200 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
201 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
202 4V7F 6 C 60S ribosomal protein L3 4932
203 4V7E 71 CB 60S ribosomal protein L3 4565
204 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
205 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
206 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
207 4V6W 63 CB 60S ribosomal protein L3 7227
208 4V6X 63 CB 60S ribosomal protein L3 9606
209 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
210 4V6U 33 BC 50S ribosomal protein L3P 2261
211 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
212 4ADX 12 B RPL3 145262
213 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
214 4V7H 27 BC 60S ribosomal protein L3 5541
215 4V5Z 54 Bb 60S Ribosomal protein L3 9612
216 4V4B 22 BC 60S ribosomal protein L3 4932
217 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
218 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274