Sequence Similarity Clusters for the Entities in PDB 3CCS

Entity #1 | Chains: A
50S ribosomal protein L2P protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 47 994
95 % 39 68 763 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 790
70 % 39 68 843
50 % 39 192 210
40 % 39 192 233
30 % 39 192 247
Entity #10 | Chains: J
50S ribosomal protein L13P protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 539
95 % 39 74 669 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 685
70 % 39 74 731
50 % 39 74 792
40 % 40 78 787
30 % 40 78 787
Entity #11 | Chains: K
50S ribosomal protein L14P protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 613
95 % 39 68 749 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 68 777
70 % 39 68 827
50 % 39 202 201
40 % 54 605 22
30 % 54 605 39
Entity #12 | Chains: L
50S ribosomal protein L15P protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 544
95 % 39 74 678 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 700
70 % 39 74 747
50 % 39 74 800
40 % 39 199 224
30 % 39 199 240
Entity #13 | Chains: M
50S ribosomal protein L15e protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 20 2934
95 % 36 47 1201 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 36 47 1222
70 % 39 68 828
50 % 39 201 204
40 % 39 201 222
30 % 39 201 238
Entity #14 | Chains: N
50S ribosomal protein L18P protein, length: 187 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 536
95 % 39 74 664 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 39 74 688
70 % 39 74 735
50 % 39 76 771
40 % 39 76 803
30 % 39 79 775
Entity #15 | Chains: O
50S ribosomal protein L18e protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 624
95 % 39 68 765 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 793
70 % 39 68 845
50 % 39 70 851
40 % 39 70 882
30 % 39 70 872
Entity #16 | Chains: P
50S ribosomal protein L19e protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 993
95 % 39 68 769 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 797
70 % 39 68 847
50 % 39 68 893
40 % 39 72 848
30 % 39 72 855
Entity #17 | Chains: Q
50S ribosomal protein L21e protein, length: 96 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 614
95 % 39 68 750 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 778
70 % 39 68 829
50 % 39 70 861
40 % 39 70 892
30 % 39 71 867
Entity #18 | Chains: R
50S ribosomal protein L22P protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 637
95 % 39 68 756 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 784
70 % 39 68 835
50 % 39 68 882
40 % 39 68 907
30 % 39 199 241
Entity #19 | Chains: S
50S ribosomal protein L23P protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 548
95 % 39 74 679 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 39 74 703
70 % 39 74 752
50 % 39 77 759
40 % 53 466 46
30 % 53 466 64
Entity #2 | Chains: B
50S ribosomal protein L3P protein, length: 338 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 640
95 % 39 74 676 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 39 74 698
70 % 39 74 745
50 % 39 74 799
40 % 39 207 214
30 % 39 207 232
Entity #20 | Chains: T
50S ribosomal protein L24P protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 540
95 % 39 74 671 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 693
70 % 39 74 741
50 % 39 208 195
40 % 39 209 213
30 % 39 209 231
Entity #21 | Chains: U
50S ribosomal protein L24e protein, length: 67 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 70 587
95 % 37 70 726 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 37 70 754
70 % 37 70 797
50 % 37 70 852
40 % 37 70 875
30 % 37 70 874
Entity #22 | Chains: V
50S ribosomal protein L29P protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 541
95 % 39 74 672 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 694
70 % 39 74 742
50 % 39 74 796
40 % 53 426 54
30 % 53 452 67
Entity #23 | Chains: W
50S ribosomal protein L30P protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 618
95 % 39 68 757 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 785
70 % 39 68 836
50 % 39 68 883
40 % 39 70 880
30 % 39 71 866
Entity #24 | Chains: X
50S ribosomal protein L31e protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 625
95 % 39 68 766 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 794
70 % 39 68 846
50 % 39 68 891
40 % 39 68 915
30 % 39 70 878
Entity #25 | Chains: Y
50S ribosomal protein L32e protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 63 687
95 % 36 63 846 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 63 877
70 % 36 63 913
50 % 36 63 960
40 % 36 63 981
30 % 36 63 969
Entity #26 | Chains: Z
50S ribosomal protein L37Ae protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 11 17 3683
95 % 11 17 4038 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 11 17 4091
70 % 11 17 4011
50 % 11 17 3902
40 % 11 17 3709
30 % 11 17 3395
Entity #27 | Chains: 1
50S ribosomal protein L37e protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 626
95 % 39 68 751 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 779
70 % 39 68 830
50 % 39 69 863
40 % 39 69 894
30 % 39 69 883
Entity #28 | Chains: 2
50S ribosomal protein L39e protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 639
95 % 39 68 759 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 787
70 % 39 68 839
50 % 39 194 208
40 % 39 194 230
30 % 39 194 245
Entity #29 | Chains: 3
50S ribosomal protein L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 612
95 % 39 68 748 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 776
70 % 39 68 826
50 % 39 68 876
40 % 39 189 236
30 % 39 189 252
Entity #3 | Chains: C
50S ribosomal protein L4P protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 15 23 2552
95 % 39 74 668 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 74 691
70 % 39 74 737
50 % 39 74 791
40 % 39 76 806
30 % 40 78 785
Entity #30 | Chains: 0
23S RIBOSOMAL RNA rna, length: 2923 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #31 | Chains: 9
5S RIBOSOMAL RNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
50S ribosomal protein L5P protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 542
95 % 39 74 674 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 39 74 697
70 % 39 74 744
50 % 39 74 798
40 % 40 201 221
30 % 40 201 236
Entity #5 | Chains: E
50S ribosomal protein L6P protein, length: 178 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 622
95 % 39 68 764 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 791
70 % 39 68 823
50 % 39 68 888
40 % 39 199 225
30 % 54 594 40
Entity #6 | Chains: F
50S ribosomal protein L7Ae protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 978
95 % 36 47 1193 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 39 68 774
70 % 39 68 824
50 % 56 107 400
40 % 63 128 319
30 % 77 274 155
Entity #7 | Chains: G
50S ribosomal protein L10E protein, length: 348 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 64 666
95 % 37 64 814 Flexibility: No
Max RMSD: 3.2, Avg RMSD: 0.4
PDBFlex
90 % 37 64 846
70 % 37 64 890
50 % 37 64 939
40 % 37 64 957
30 % 37 64 947
Entity #8 | Chains: H
50S ribosomal protein L10e protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 987
95 % 36 47 1196 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 47 1218
70 % 36 47 1244
50 % 39 74 793
40 % 39 79 766
30 % 39 79 779
Entity #9 | Chains: I
50S ribosomal protein L11P protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 42 1124
95 % 33 42 1347 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.6
PDBFlex
90 % 33 42 1369
70 % 33 42 1388
50 % 34 46 1259
40 % 34 46 1253
30 % 34 89 650

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 5OBM 5 L3, l3 60S ribosomal protein L3 4932
79 4U53 40 L3, l3 60S ribosomal protein L3 4932
80 5ON6 5 CE, k 60S ribosomal protein L3 4932
81 1Q86 5 D 50S ribosomal protein L3P 2238
82 4U50 40 L3, l3 60S ribosomal protein L3 4932
83 5NDV 5 L3, l3 60S ribosomal protein L3 4932
84 5LYB 40 L3, l3 60S ribosomal protein L3 4932
85 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
86 3G4S 3 B 50S ribosomal protein L3P 2238
87 3CCJ 2 B 50S ribosomal protein L3P 2238
88 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
89 4U56 40 L3, l3 60S ribosomal protein L3 4932
90 2QA4 4 B 50S ribosomal protein L3P 2238
91 5TGA 40 L3, l3 60S ribosomal protein L3 4932
92 5MEI 5 CE, k 60S ribosomal protein L3 4932
93 1Q7Y 5 D 50S ribosomal protein L3P 2238
94 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
95 4U4O 40 L3, l3 60S ribosomal protein L3 4932
96 5DGV 40 L3, l3 60S ribosomal protein L3 4932
97 5DGE 40 L3, l3 60S ribosomal protein L3 4932
98 5NDW 28 L3, l3 60S ribosomal protein L3 4932
99 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
100 5NDG 40 L3, l3 60S ribosomal protein L3 4932
101 5FCI 40 L3, l3 60S ribosomal protein L3 4932
102 5DC3 40 L3, l3 60S ribosomal protein L3 4932
103 5DGF 40 L3, l3 60S ribosomal protein L3 4932
104 5TGM 40 L3, l3 60S ribosomal protein L3 4932
105 4V7R 34 BC, DC 60S ribosomal protein L3 4932
106 4V4P 5 AE 50S ribosomal protein L3 274
107 4V4R 29 BE 50S ribosomal protein L3 274
108 4V4S 29 BE 50S ribosomal protein L3 274
109 4V4T 28 BE 50S ribosomal protein L3 274
110 6GQV 7 B 60S ribosomal protein L3 4932
111 6GQ1 7 B 60S ribosomal protein L3 4932
112 6GQB 7 B 60S ribosomal protein L3 4932
113 6D9J 2 B uL3 9986
114 6D90 2 B uL3 9986
115 6FTG 2 B uL3 9986
116 6FTI 2 B uL3 9986
117 6FTJ 2 B uL3 9986
118 6FT6 3 B 60S ribosomal protein L3 4932
119 6FRK 10 B Ribosomal protein uL3 9986
120 5Z3G 6 F 60S ribosomal protein L3 4932
121 6C0F 5 B 60S ribosomal protein L3 4932
122 6EM1 16 B 60S ribosomal protein L3 4932
123 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
124 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
125 6ELZ 28 B 60S ribosomal protein L3 4932
126 6EK0 5 LB 60S ribosomal protein L3 9606
127 6AZ3 2 B ribosomal protein uL3 5661
128 5XY3 5 B Uncharacterized protein 5722
129 5XXB 5 B Ribosomal protein uL3 5811
130 5UMD 5 E 60S ribosomal protein L3 5833
131 5MC6 67 BA 60S ribosomal protein L3 4932
132 5H4P 5 B 60S ribosomal protein L3 4932
133 5M1J 42 B5 60S ribosomal protein L3 4932
134 5LZS 2 B Uncharacterized protein 9986
135 5LZT 2 B uL3 9986
136 5LZU 2 B uL3 9986
137 5LZV 2 B uL3 9986
138 5LZW 2 B uL3 9986
139 5LZX 2 B Ul3 9986
140 5LZY 2 B uL3 9986
141 5LZZ 2 B uL3 9986
142 5T62 6 E 60S ribosomal protein L3 4932
143 5T6R 5 E 60S ribosomal protein L3 4932
144 5T5H 29 f Ribosomal protein L13 5693
145 5T2A 30 d uL3 5661
146 5T2C 4 E 60S ribosomal protein L3 9606
147 5LKS 5 LB 60S ribosomal protein L3 9606
148 5JUO 7 G uL3 (yeast L3) 4932
149 5JUP 7 G uL3 (yeast L3) 4932
150 5JUS 7 G uL3 (yeast L3) 4932
151 5JUT 7 G uL3 (yeast L3) 4932
152 5JUU 7 G uL3 (yeast L3) 4932
153 5JCS 3 B 60S ribosomal protein L3 4932
154 5IT7 5 BB 60S ribosomal protein L3 28985
155 3JCT 2 B 60S ribosomal protein L3 4932
156 3JCS 10 B ribosomal protein L3 5661
157 5GAK 17 F 60S ribosomal protein L3 4932
158 5FL8 2 B 60S ribosomal protein L3 4932
159 5APN 5 B 60S ribosomal protein L3 4932
160 5APO 5 B 60S ribosomal protein L3 4932
161 3JBN 70 AE 60S ribosomal protein uL3 5833
162 3JBO 70 AE 60S ribosomal protein uL3 5833
163 3JBP 70 AE 60S ribosomal protein uL3 5833
164 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
165 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
166 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
167 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
168 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
169 3JAG 2 B uL3 9986
170 3JAH 2 B uL3 9986
171 3JAI 2 B uL3 9986
172 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
173 5AJ0 4 AB 60S ribosomal protein L3 9606
174 3J92 2 B uL3 9986
175 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
176 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
177 4V3P 80 LC Ribosomal protein L3 4565
178 3J7O 5 B Ribosomal protein uL3 9823
179 3J7P 5 B Ribosomal protein uL3 9823
180 3J7Q 5 B Ribosomal protein uL3 9823
181 3J7R 5 B Ribosomal protein uL3 9823
182 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
183 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
184 3J79 5 E 60S ribosomal protein uL3 5833
185 3J77 3 L3 60S ribosomal protein L3 4932
186 3J78 3 L3 60S ribosomal protein L3 4932
187 3J6X 6 L3 60S ribosomal protein L3 4932
188 3J6Y 6 L3 60S ribosomal protein L3 4932
189 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
190 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
191 4V7F 6 C 60S ribosomal protein L3 4932
192 4V7E 71 CB 60S ribosomal protein L3 4565
193 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
194 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
195 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
196 4V6W 63 CB 60S ribosomal protein L3 7227
197 4V6X 63 CB 60S ribosomal protein L3 9606
198 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
199 4V6U 33 BC 50S ribosomal protein L3P 2261
200 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
201 4ADX 12 B RPL3 145262
202 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
203 4V7H 27 BC 60S ribosomal protein L3 5541
204 4V5Z 54 Bb 60S Ribosomal protein L3 9612
205 4V4B 22 BC 60S ribosomal protein L3 4932
206 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
207 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274