Sequence Similarity Clusters for the Entities in PDB 3CCS

Entity #1 | Chains: A
50S ribosomal protein L2P protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 47 980
95 % 39 68 747 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 771
70 % 39 68 819
50 % 39 189 208
40 % 39 189 231
30 % 39 189 248
Entity #10 | Chains: J
50S ribosomal protein L13P protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 521
95 % 39 74 651 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 670
70 % 39 74 714
50 % 39 74 782
40 % 40 78 780
30 % 40 78 776
Entity #11 | Chains: K
50S ribosomal protein L14P protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 595
95 % 39 68 732 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 68 757
70 % 39 68 804
50 % 39 199 202
40 % 54 591 21
30 % 54 591 37
Entity #12 | Chains: L
50S ribosomal protein L15P protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 526
95 % 39 74 660 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 683
70 % 39 74 727
50 % 39 74 790
40 % 39 196 223
30 % 39 196 239
Entity #13 | Chains: M
50S ribosomal protein L15e protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 20 2888
95 % 36 47 1182 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 36 47 1203
70 % 39 68 805
50 % 39 198 205
40 % 39 198 222
30 % 39 198 238
Entity #14 | Chains: N
50S ribosomal protein L18P protein, length: 187 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 518
95 % 39 74 646 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 39 74 671
70 % 39 74 715
50 % 39 76 761
40 % 39 76 793
30 % 39 79 760
Entity #15 | Chains: O
50S ribosomal protein L18e protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 608
95 % 39 68 749 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 774
70 % 39 68 821
50 % 39 70 841
40 % 39 70 874
30 % 39 70 860
Entity #16 | Chains: P
50S ribosomal protein L19e protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 979
95 % 39 68 752 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 777
70 % 39 68 824
50 % 39 68 880
40 % 39 72 839
30 % 39 72 840
Entity #17 | Chains: Q
50S ribosomal protein L21e protein, length: 96 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 596
95 % 39 68 733 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 758
70 % 39 68 806
50 % 39 70 850
40 % 39 70 881
30 % 39 71 854
Entity #18 | Chains: R
50S ribosomal protein L22P protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 625
95 % 39 68 740 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 764
70 % 39 68 813
50 % 39 68 869
40 % 39 68 896
30 % 39 196 240
Entity #19 | Chains: S
50S ribosomal protein L23P protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 531
95 % 39 74 662 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 39 74 685
70 % 39 74 731
50 % 39 77 751
40 % 53 455 46
30 % 53 455 63
Entity #2 | Chains: B
50S ribosomal protein L3P protein, length: 338 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 627
95 % 39 74 658 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 39 74 681
70 % 39 74 725
50 % 39 74 789
40 % 39 204 214
30 % 39 204 231
Entity #20 | Chains: T
50S ribosomal protein L24P protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 522
95 % 39 74 653 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 676
70 % 39 74 721
50 % 39 205 197
40 % 39 206 212
30 % 39 206 230
Entity #21 | Chains: U
50S ribosomal protein L24e protein, length: 67 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 70 568
95 % 37 70 703 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 37 70 728
70 % 37 70 774
50 % 37 70 842
40 % 37 70 868
30 % 37 70 862
Entity #22 | Chains: V
50S ribosomal protein L29P protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 523
95 % 39 74 654 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 677
70 % 39 74 722
50 % 39 74 786
40 % 53 415 52
30 % 53 441 66
Entity #23 | Chains: W
50S ribosomal protein L30P protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 602
95 % 39 68 741 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 765
70 % 39 68 814
50 % 39 68 870
40 % 39 70 872
30 % 39 71 853
Entity #24 | Chains: X
50S ribosomal protein L31e protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 609
95 % 39 68 750 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 775
70 % 39 68 822
50 % 39 68 878
40 % 39 68 902
30 % 39 70 867
Entity #25 | Chains: Y
50S ribosomal protein L32e protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 63 680
95 % 36 63 834 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 63 863
70 % 36 63 901
50 % 36 63 949
40 % 36 63 969
30 % 36 63 954
Entity #26 | Chains: Z
50S ribosomal protein L37Ae protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 11 17 3619
95 % 11 17 3977 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 11 17 4029
70 % 11 17 3953
50 % 11 17 3856
40 % 11 17 3662
30 % 11 17 3353
Entity #27 | Chains: 1
50S ribosomal protein L37e protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 611
95 % 39 68 734 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 759
70 % 39 68 807
50 % 39 69 852
40 % 39 69 883
30 % 39 69 870
Entity #28 | Chains: 2
50S ribosomal protein L39e protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 624
95 % 39 68 739 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 763
70 % 39 68 812
50 % 39 191 207
40 % 39 191 228
30 % 39 191 245
Entity #29 | Chains: 3
50S ribosomal protein L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 594
95 % 39 68 731 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 756
70 % 39 68 803
50 % 39 68 864
40 % 39 186 235
30 % 39 186 250
Entity #3 | Chains: C
50S ribosomal protein L4P protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 15 23 2511
95 % 39 74 650 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 74 674
70 % 39 74 717
50 % 39 74 781
40 % 39 76 796
30 % 40 78 775
Entity #30 | Chains: 0
23S RIBOSOMAL RNA rna, length: 2923 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #31 | Chains: 9
5S RIBOSOMAL RNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
50S ribosomal protein L5P protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 524
95 % 39 74 656 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 39 74 680
70 % 39 74 724
50 % 39 74 788
40 % 40 198 220
30 % 40 198 236
Entity #5 | Chains: E
50S ribosomal protein L6P protein, length: 178 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 607
95 % 39 68 748 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 772
70 % 39 68 801
50 % 39 68 875
40 % 39 196 224
30 % 54 581 40
Entity #6 | Chains: F
50S ribosomal protein L7Ae protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 967
95 % 36 47 1177 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 39 68 755
70 % 39 68 802
50 % 56 107 392
40 % 63 128 309
30 % 77 271 153
Entity #7 | Chains: G
50S ribosomal protein L10E protein, length: 348 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 64 657
95 % 37 64 798 Flexibility: No
Max RMSD: 3.2, Avg RMSD: 0.4
PDBFlex
90 % 37 64 828
70 % 37 64 870
50 % 37 64 928
40 % 37 64 946
30 % 37 64 934
Entity #8 | Chains: H
50S ribosomal protein L10e protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 974
95 % 36 47 1179 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 47 1200
70 % 36 47 1227
50 % 39 74 783
40 % 39 79 754
30 % 39 79 764
Entity #9 | Chains: I
50S ribosomal protein L11P protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 42 1111
95 % 33 42 1328 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.6
PDBFlex
90 % 33 42 1352
70 % 33 42 1372
50 % 34 46 1247
40 % 34 46 1240
30 % 34 89 639

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 5OBM 5 L3, l3 60S ribosomal protein L3 4932
79 4U53 40 L3, l3 60S ribosomal protein L3 4932
80 5ON6 5 CE, k 60S ribosomal protein L3 4932
81 1Q86 5 D 50S ribosomal protein L3P 2238
82 4U50 40 L3, l3 60S ribosomal protein L3 4932
83 5NDV 5 L3, l3 60S ribosomal protein L3 4932
84 5LYB 40 L3, l3 60S ribosomal protein L3 4932
85 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
86 3G4S 3 B 50S ribosomal protein L3P 2238
87 3CCJ 2 B 50S ribosomal protein L3P 2238
88 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
89 4U56 40 L3, l3 60S ribosomal protein L3 4932
90 2QA4 4 B 50S ribosomal protein L3P 2238
91 5TGA 40 L3, l3 60S ribosomal protein L3 4932
92 5MEI 5 CE, k 60S ribosomal protein L3 4932
93 1Q7Y 5 D 50S ribosomal protein L3P 2238
94 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
95 4U4O 40 L3, l3 60S ribosomal protein L3 4932
96 5DGV 40 L3, l3 60S ribosomal protein L3 4932
97 5DGE 40 L3, l3 60S ribosomal protein L3 4932
98 5NDW 28 L3, l3 60S ribosomal protein L3 4932
99 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
100 5NDG 40 L3, l3 60S ribosomal protein L3 4932
101 5FCI 40 L3, l3 60S ribosomal protein L3 4932
102 5DC3 40 L3, l3 60S ribosomal protein L3 4932
103 5DGF 40 L3, l3 60S ribosomal protein L3 4932
104 5TGM 40 L3, l3 60S ribosomal protein L3 4932
105 4V7R 34 BC, DC 60S ribosomal protein L3 4932
106 4V4P 5 AE 50S ribosomal protein L3 274
107 4V4R 29 BE 50S ribosomal protein L3 274
108 4V4S 29 BE 50S ribosomal protein L3 274
109 4V4T 28 BE 50S ribosomal protein L3 274
110 6D9J 2 B uL3 9986
111 6D90 2 B uL3 9986
112 6FTG 2 B uL3 9986
113 6FTI 2 B uL3 9986
114 6FTJ 2 B uL3 9986
115 6FT6 3 B 60S ribosomal protein L3 4932
116 6FRK 10 B Ribosomal protein uL3 9986
117 5Z3G 6 F 60S ribosomal protein L3 4932
118 6C0F 5 B 60S ribosomal protein L3 4932
119 6EM1 16 B 60S ribosomal protein L3 4932
120 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
121 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
122 6ELZ 28 B 60S ribosomal protein L3 4932
123 6EK0 5 LB 60S ribosomal protein L3 9606
124 6AZ3 2 B ribosomal protein uL3 5661
125 5XY3 5 B Uncharacterized protein 5722
126 5XXB 5 B Ribosomal protein uL3 5811
127 5UMD 5 E 60S ribosomal protein L3 5833
128 5MC6 67 BA 60S ribosomal protein L3 4932
129 5H4P 5 B 60S ribosomal protein L3 4932
130 5M1J 42 B5 60S ribosomal protein L3 4932
131 5LZS 2 B Uncharacterized protein 9986
132 5LZT 2 B uL3 9986
133 5LZU 2 B uL3 9986
134 5LZV 2 B uL3 9986
135 5LZW 2 B uL3 9986
136 5LZX 2 B Ul3 9986
137 5LZY 2 B uL3 9986
138 5LZZ 2 B uL3 9986
139 5T62 6 E 60S ribosomal protein L3 4932
140 5T6R 5 E 60S ribosomal protein L3 4932
141 5T5H 29 f Ribosomal protein L13 5693
142 5T2A 30 d uL3 5661
143 5T2C 4 E 60S ribosomal protein L3 9606
144 5LKS 5 LB 60S ribosomal protein L3 9606
145 5JUO 7 G uL3 (yeast L3) 4932
146 5JUP 7 G uL3 (yeast L3) 4932
147 5JUS 7 G uL3 (yeast L3) 4932
148 5JUT 7 G uL3 (yeast L3) 4932
149 5JUU 7 G uL3 (yeast L3) 4932
150 5JCS 3 B 60S ribosomal protein L3 4932
151 5IT7 5 BB 60S ribosomal protein L3 28985
152 3JCT 2 B 60S ribosomal protein L3 4932
153 3JCS 10 B ribosomal protein L3 5661
154 5GAK 17 F 60S ribosomal protein L3 4932
155 5FL8 2 B 60S ribosomal protein L3 4932
156 5APN 5 B 60S ribosomal protein L3 4932
157 5APO 5 B 60S ribosomal protein L3 4932
158 3JBN 70 AE 60S ribosomal protein uL3 5833
159 3JBO 70 AE 60S ribosomal protein uL3 5833
160 3JBP 70 AE 60S ribosomal protein uL3 5833
161 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
162 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
163 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
164 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
165 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
166 3JAG 2 B uL3 9986
167 3JAH 2 B uL3 9986
168 3JAI 2 B uL3 9986
169 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
170 5AJ0 4 AB 60S ribosomal protein L3 9606
171 3J92 2 B uL3 9986
172 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
173 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
174 4V3P 80 LC Ribosomal protein L3 4565
175 3J7O 5 B Ribosomal protein uL3 9823
176 3J7P 5 B Ribosomal protein uL3 9823
177 3J7Q 5 B Ribosomal protein uL3 9823
178 3J7R 5 B Ribosomal protein uL3 9823
179 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
180 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
181 3J79 5 E 60S ribosomal protein uL3 5833
182 3J77 3 L3 60S ribosomal protein L3 4932
183 3J78 3 L3 60S ribosomal protein L3 4932
184 3J6X 6 L3 60S ribosomal protein L3 4932
185 3J6Y 6 L3 60S ribosomal protein L3 4932
186 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
187 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
188 4V7F 6 C 60S ribosomal protein L3 4932
189 4V7E 71 CB 60S ribosomal protein L3 4565
190 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
191 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
192 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
193 4V6W 63 CB 60S ribosomal protein L3 7227
194 4V6X 63 CB 60S ribosomal protein L3 9606
195 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
196 4V6U 33 BC 50S ribosomal protein L3P 2261
197 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
198 4ADX 12 B RPL3 145262
199 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
200 4V7H 27 BC 60S ribosomal protein L3 5541
201 4V5Z 54 Bb 60S Ribosomal protein L3 9612
202 4V4B 22 BC 60S ribosomal protein L3 4932
203 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
204 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274