Sequence Similarity Clusters for the Entities in PDB 3CCS

Entity #1 | Chains: A
50S ribosomal protein L2P protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 43 1202
95 % 39 68 814 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 845
70 % 39 68 896
50 % 39 213 209
40 % 39 213 230
30 % 39 213 245
Entity #10 | Chains: J
50S ribosomal protein L13P protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 592
95 % 39 74 716 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 744
70 % 39 74 787
50 % 39 74 850
40 % 40 78 833
30 % 40 78 833
Entity #11 | Chains: K
50S ribosomal protein L14P protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 660
95 % 39 68 800 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 68 831
70 % 39 68 879
50 % 39 224 205
40 % 54 665 24
30 % 54 665 38
Entity #12 | Chains: L
50S ribosomal protein L15P protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 596
95 % 39 74 731 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 759
70 % 39 74 801
50 % 39 74 859
40 % 39 220 225
30 % 39 220 242
Entity #13 | Chains: M
50S ribosomal protein L15e protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 20 3148
95 % 36 47 1287 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 36 47 1312
70 % 39 68 880
50 % 39 222 206
40 % 39 222 224
30 % 39 222 240
Entity #14 | Chains: N
50S ribosomal protein L18P protein, length: 187 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 587
95 % 39 74 718 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 39 74 746
70 % 39 74 789
50 % 39 76 820
40 % 39 76 852
30 % 39 79 820
Entity #15 | Chains: O
50S ribosomal protein L18e protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 671
95 % 39 68 815 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 846
70 % 39 68 898
50 % 39 70 901
40 % 39 70 929
30 % 39 70 917
Entity #16 | Chains: P
50S ribosomal protein L19e protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1071
95 % 39 68 819 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 39 68 850
70 % 39 68 901
50 % 39 68 946
40 % 39 72 903
30 % 39 72 904
Entity #17 | Chains: Q
50S ribosomal protein L21e protein, length: 96 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 665
95 % 39 68 806 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 837
70 % 39 68 888
50 % 39 70 911
40 % 39 70 943
30 % 39 71 911
Entity #18 | Chains: R
50S ribosomal protein L22P protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 682
95 % 39 68 804 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 835
70 % 39 68 886
50 % 39 68 935
40 % 39 68 963
30 % 39 220 241
Entity #19 | Chains: S
50S ribosomal protein L23P protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 599
95 % 39 74 732 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 39 74 762
70 % 39 74 807
50 % 39 77 810
40 % 53 505 38
30 % 53 505 60
Entity #2 | Chains: B
50S ribosomal protein L3P protein, length: 338 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 684
95 % 39 74 728 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 39 74 756
70 % 39 74 798
50 % 39 74 858
40 % 39 229 212
30 % 39 229 231
Entity #20 | Chains: T
50S ribosomal protein L24P protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 593
95 % 39 74 724 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 74 752
70 % 39 74 795
50 % 39 229 203
40 % 39 230 211
30 % 39 230 230
Entity #21 | Chains: U
50S ribosomal protein L24e protein, length: 67 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 70 630
95 % 37 70 773 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 37 70 803
70 % 37 70 847
50 % 37 70 902
40 % 37 70 930
30 % 37 70 918
Entity #22 | Chains: V
50S ribosomal protein L29P protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 594
95 % 39 74 725 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 39 74 753
70 % 39 74 796
50 % 39 74 853
40 % 53 459 59
30 % 53 485 72
Entity #23 | Chains: W
50S ribosomal protein L30P protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 664
95 % 39 68 805 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 836
70 % 39 68 887
50 % 39 68 936
40 % 39 70 934
30 % 39 71 910
Entity #24 | Chains: X
50S ribosomal protein L31e protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 661
95 % 39 68 816 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 847
70 % 39 68 899
50 % 39 68 944
40 % 39 68 970
30 % 39 70 926
Entity #25 | Chains: Y
50S ribosomal protein L32e protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 63 735
95 % 36 63 904 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 63 933
70 % 36 63 974
50 % 36 63 1025
40 % 36 63 1042
30 % 36 63 1019
Entity #26 | Chains: Z
50S ribosomal protein L37Ae protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 11 17 3974
95 % 11 17 4343 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 11 17 4376
70 % 11 17 4264
50 % 11 17 4098
40 % 11 17 3894
30 % 11 17 3552
Entity #27 | Chains: 1
50S ribosomal protein L37e protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 672
95 % 39 68 801 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 832
70 % 39 68 881
50 % 39 69 912
40 % 39 69 945
30 % 39 69 931
Entity #28 | Chains: 2
50S ribosomal protein L39e protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 38 67 683
95 % 39 68 808 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 39 68 839
70 % 39 68 891
50 % 39 215 208
40 % 39 215 229
30 % 39 215 244
Entity #29 | Chains: 3
50S ribosomal protein L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 658
95 % 39 68 798 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 39 68 829
70 % 39 68 877
50 % 39 68 928
40 % 39 210 234
30 % 39 210 249
Entity #3 | Chains: C
50S ribosomal protein L4P protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 15 23 2707
95 % 39 74 719 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 39 74 747
70 % 39 74 790
50 % 39 74 845
40 % 39 76 847
30 % 40 78 831
Entity #30 | Chains: 0
23S RIBOSOMAL RNA rna, length: 2923 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #31 | Chains: 9
5S RIBOSOMAL RNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
50S ribosomal protein L5P protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 74 595
95 % 39 74 726 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 39 74 755
70 % 39 74 797
50 % 39 74 857
40 % 40 222 219
30 % 40 222 238
Entity #5 | Chains: E
50S ribosomal protein L6P protein, length: 178 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 39 68 668
95 % 39 68 812 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 39 68 843
70 % 39 68 875
50 % 39 68 941
40 % 39 221 222
30 % 54 652 42
Entity #6 | Chains: F
50S ribosomal protein L7Ae protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1051
95 % 36 47 1272 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 39 68 828
70 % 39 68 876
50 % 56 108 418
40 % 63 133 348
30 % 77 300 160
Entity #7 | Chains: G
50S ribosomal protein L10E protein, length: 348 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 37 64 712
95 % 37 64 867 Flexibility: No
Max RMSD: 3.2, Avg RMSD: 0.4
PDBFlex
90 % 37 64 899
70 % 37 64 944
50 % 37 64 1000
40 % 37 64 1018
30 % 37 64 1000
Entity #8 | Chains: H
50S ribosomal protein L10e protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 36 47 1065
95 % 36 47 1279 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 36 47 1305
70 % 36 47 1333
50 % 39 74 851
40 % 39 79 812
30 % 39 79 821
Entity #9 | Chains: I
50S ribosomal protein L11P protein, length: 162 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 42 1228
95 % 33 42 1461 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.6
PDBFlex
90 % 33 42 1481
70 % 33 42 1496
50 % 34 46 1341
40 % 34 46 1331
30 % 34 99 638

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 6HHQ 5 CE, k 60S ribosomal protein L3 4932
79 5OBM 5 L3, l3 60S ribosomal protein L3 4932
80 4U53 40 L3, l3 60S ribosomal protein L3 4932
81 5ON6 5 CE, k 60S ribosomal protein L3 4932
82 1Q86 5 D 50S ribosomal protein L3P 2238
83 4U50 40 L3, l3 60S ribosomal protein L3 4932
84 5NDV 5 L3, l3 60S ribosomal protein L3 4932
85 5LYB 40 L3, l3 60S ribosomal protein L3 4932
86 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
87 3G4S 3 B 50S ribosomal protein L3P 2238
88 3CCJ 2 B 50S ribosomal protein L3P 2238
89 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
90 4U56 40 L3, l3 60S ribosomal protein L3 4932
91 2QA4 4 B 50S ribosomal protein L3P 2238
92 5TGA 40 L3, l3 60S ribosomal protein L3 4932
93 5MEI 5 CE, k 60S ribosomal protein L3 4932
94 1Q7Y 5 D 50S ribosomal protein L3P 2238
95 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
96 4U4O 40 L3, l3 60S ribosomal protein L3 4932
97 5DGV 40 L3, l3 60S ribosomal protein L3 4932
98 5DGE 40 L3, l3 60S ribosomal protein L3 4932
99 5NDW 28 L3, l3 60S ribosomal protein L3 4932
100 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
101 5NDG 40 L3, l3 60S ribosomal protein L3 4932
102 5FCI 40 L3, l3 60S ribosomal protein L3 4932
103 5DC3 40 L3, l3 60S ribosomal protein L3 4932
104 5DGF 40 L3, l3 60S ribosomal protein L3 4932
105 5TGM 40 L3, l3 60S ribosomal protein L3 4932
106 4V7R 34 BC, DC 60S ribosomal protein L3 4932
107 4V4P 5 AE 50S ribosomal protein L3 274
108 4V4R 29 BE 50S ribosomal protein L3 274
109 4V4S 29 BE 50S ribosomal protein L3 274
110 4V4T 28 BE 50S ribosomal protein L3 274
111 6QKL 2 A 60S ribosomal protein L3 44689
112 6Q8Y 38 BA 60S ribosomal protein L3 4932
113 6N8J 5 B 60S ribosomal protein L3 4932
114 6N8K 5 B 60S ribosomal protein L3 4932
115 6N8L 5 B 60S ribosomal protein L3 4932
116 6N8M 6 E 60S ribosomal protein L3 4932
117 6N8N 9 E 60S ribosomal protein L3 4932
118 6N8O 10 E 60S ribosomal protein L3 4932
119 6I7O 5 BA, YA 60S ribosomal protein L3 4932
120 6MTB 8 B 60S ribosomal protein L3 9986
121 6MTC 6 B 60S ribosomal protein L3 9986
122 6MTD 5 B uL3 9986
123 6MTE 5 B uL3 9986
124 6HD7 9 F 60S ribosomal protein L3 4932
125 6HCQ 39 B3 uL3 9986
126 6HCJ 39 B3 uL3 9986
127 6HCM 41 B3 uL3 9986
128 6HCF 41 B3 uL3 9986
129 6GZ3 42 AB ribosomal protein uL3 9986
130 6GZ4 3 AB ribosomal protein uL3 9986
131 6GZ5 42 AB ribosomal protein uL3 9986
132 6GQV 7 B 60S ribosomal protein L3 4932
133 6GQ1 7 B 60S ribosomal protein L3 4932
134 6GQB 7 B 60S ribosomal protein L3 4932
135 6D9J 2 B uL3 9986
136 6D90 2 B uL3 9986
137 6FTG 2 B uL3 9986
138 6FTI 2 B uL3 9986
139 6FTJ 2 B uL3 9986
140 6FT6 3 B 60S ribosomal protein L3 4932
141 6FRK 10 B Ribosomal protein uL3 9986
142 5Z3G 6 F 60S ribosomal protein L3 4932
143 6C0F 5 B 60S ribosomal protein L3 4932
144 6EM1 16 B 60S ribosomal protein L3 4932
145 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
146 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
147 6ELZ 28 B 60S ribosomal protein L3 4932
148 6EK0 5 LB 60S ribosomal protein L3 9606
149 6AZ3 2 B ribosomal protein uL3 5661
150 5XY3 5 B Uncharacterized protein 5722
151 5XXB 5 B Ribosomal protein uL3 5811
152 5UMD 5 E 60S ribosomal protein L3 5833
153 5MC6 67 BA 60S ribosomal protein L3 4932
154 5H4P 5 B 60S ribosomal protein L3 4932
155 5M1J 42 B5 60S ribosomal protein L3 4932
156 5LZS 2 B uL3 9986
157 5LZT 2 B uL3 9986
158 5LZU 2 B uL3 9986
159 5LZV 2 B uL3 9986
160 5LZW 2 B uL3 9986
161 5LZX 2 B Ul3 9986
162 5LZY 2 B uL3 9986
163 5LZZ 2 B uL3 9986
164 5T62 6 E 60S ribosomal protein L3 4932
165 5T6R 5 E 60S ribosomal protein L3 4932
166 5T5H 29 f Ribosomal protein L13 5693
167 5T2A 30 d uL3 5661
168 5T2C 4 E 60S ribosomal protein L3 9606
169 5LKS 5 LB 60S ribosomal protein L3 9606
170 5JUO 7 G uL3 (yeast L3) 4932
171 5JUP 7 G uL3 (yeast L3) 4932
172 5JUS 7 G uL3 (yeast L3) 4932
173 5JUT 7 G uL3 (yeast L3) 4932
174 5JUU 7 G uL3 (yeast L3) 4932
175 5JCS 3 B 60S ribosomal protein L3 4932
176 5IT7 5 BB 60S ribosomal protein L3 28985
177 3JCT 2 B 60S ribosomal protein L3 4932
178 3JCS 10 B ribosomal protein L3 5661
179 5GAK 17 F 60S ribosomal protein L3 4932
180 5FL8 2 B 60S ribosomal protein L3 4932
181 5APN 5 B 60S ribosomal protein L3 4932
182 5APO 5 B 60S ribosomal protein L3 4932
183 3JBN 70 AE 60S ribosomal protein uL3 5833
184 3JBO 70 AE 60S ribosomal protein uL3 5833
185 3JBP 70 AE 60S ribosomal protein uL3 5833
186 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
187 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
188 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
189 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
190 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
191 3JAG 2 B uL3 9986
192 3JAH 2 B uL3 9986
193 3JAI 2 B uL3 9986
194 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
195 5AJ0 4 AB 60S ribosomal protein L3 9606
196 3J92 2 B uL3 9986
197 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
198 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
199 4V3P 80 LC Ribosomal protein L3 4565
200 3J7O 5 B Ribosomal protein uL3 9823
201 3J7P 5 B Ribosomal protein uL3 9823
202 3J7Q 5 B Ribosomal protein uL3 9823
203 3J7R 5 B Ribosomal protein uL3 9823
204 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
205 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
206 3J79 5 E 60S ribosomal protein uL3 5833
207 3J77 3 L3 60S ribosomal protein L3 4932
208 3J78 3 L3 60S ribosomal protein L3 4932
209 3J6X 6 L3 60S ribosomal protein L3 4932
210 3J6Y 6 L3 60S ribosomal protein L3 4932
211 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
212 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
213 4V7F 6 C 60S ribosomal protein L3 4932
214 4V7E 71 CB 60S ribosomal protein L3 4565
215 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
216 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
217 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
218 4V6W 63 CB 60S ribosomal protein L3 7227
219 4V6X 63 CB 60S ribosomal protein L3 9606
220 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
221 4V6U 33 BC 50S ribosomal protein L3P 2261
222 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
223 4ADX 12 B RPL3 145262
224 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
225 4V7H 27 BC 60S ribosomal protein L3 5541
226 4V5Z 54 Bb 60S Ribosomal protein L3 9612
227 4V4B 22 BC 60S ribosomal protein L3 4932
228 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
229 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274