Sequence Similarity Clusters for the Entities in PDB 2R4S

Entity #1 | Chains: A
Beta-2 adrenergic receptor protein, length: 342 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 40344
95 % 2 3 24859 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.4
PDBFlex
90 % 2 4 16107
70 % 10 15 4708
50 % 102 134 294
40 % 110 143 291
30 % 110 145 301
Entity #2 | Chains: L
antibody for beta2 adrenoceptor, light chain protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 28405
95 % 3 4 17023 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.3
PDBFlex
90 % 26 27 2155
70 % 2203 2553 1
50 % 4475 5180 1
40 % 5020 5834 1
30 % 6268 7269 1
Entity #3 | Chains: H
antibody for beta2 adrenoceptor, heavy chain protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 29051
95 % 2 3 24860 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.3
PDBFlex
90 % 2 3 24015
70 % 2168 2511 2
50 % 4476 5180 1
40 % 5021 5834 1
30 % 6269 7269 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 5IU4 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
2 4EIY 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
3 5NM4 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
4 5IU7 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
5 5OLZ 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
6 5K2C 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
7 5K2D 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
8 5OLG 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
9 5NM2 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
10 5OLV 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
11 5IU8 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
12 5MZJ 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
13 5OM4 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
14 5WIU 1 A D(4) dopamine receptor, soluble cytochrome b562 chimera 9606
15 5C1M 1 A Mu-type opioid receptor 10090
16 5OM1 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
17 5IUB 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
18 4BVN 1 A BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. 9103
19 5MZP 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
20 5WIV 1 A D(4) dopamine receptor, soluble cytochrome b562 chimera 9606
21 5NLX 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
22 5TZR 1 A Free fatty acid receptor 1,Endolysin,Free fatty acid receptor 1 10665 3.2.1.17 | Details
23 5IUA 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
24 5X93 1 A Endothelin B receptor,Endolysin,Endothelin B receptor Chimera protein of Residues 66-303 from P24530, linker, Residues 61-161 from P00720, Residues 311-407 from P24530. 10665 3.2.1.17 | Details
25 5UIW 1 A C-C chemokine receptor type 5,Rubredoxin chimera Rubredoxin fusion sequence P00268; in between CCR5 residue 223 and 227 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 9606
26 3VW7 1 A Proteinase-activated receptor 1, Lysozyme Chimera protein of residues 86-395 form Proteinase-activated receptor 1 (P25116, PAR1_HUMAN), Lyzosyme from Enterobacteria phage T4 (P00720, LYS_BPT4) and residues 303-395 from Proteinase-activated receptor 1 (P25116, PAR1_HUMAN) 10665 3.2.1.17 | Details
27 4AMJ 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 33-243,272-368 9103
28 4PHU 1 A Free fatty acid receptor 1,Lysozyme Chimera UNP O14842 residues 2-213, UNP P00720 residues 2-161, UNP O14842 residues 214-300 10665 3.2.1.17 | Details
29 5VRA 1 A Adenosine receptor A2a,Soluble cytochrome b562 chimera UNP P29274 residues 2-208 and 219-316 linked by UNP P0ABE7 residues 23-128 9606
30 5K2B 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
31 5K2A 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
32 2RH1 1 A beta-2-adrenergic receptor/T4-lysozyme chimera 10665 3.2.1.17 | Details
33 5A8E 1 A BETA1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. 9103
34 4PXZ 1 A P2Y purinoceptor 12, Soluble cytochrome b562 Chimera protein of N-terminal residues 2-223 from P2Y12R (P2Y12_HUMAN), Soluble cytochrome b562 (C562_ECOLX), and C-terminal residues 224-342 from P2Y12R (P2Y12_HUMAN). 9606
35 5D5A 1 A Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor 10665 3.2.1.17 | Details
36 3EML 1 A Human Adenosine A2A receptor/T4 lysozyme chimera 10665 3.2.1.17 | Details
37 5OLH 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
38 6AQF 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a UNP P29274 residues 2-208 and 219-316 linked via UNP P0ABE7 residues 23-128,UNP P29274 residues 2-208 and 219-316 linked via UNP P0ABE7 residues 23-128,UNP P29274 residues 2-208 and 219-316 linked via UNP P0ABE7 residues 23-128 9606
39 2Y00 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
40 5WF5 1 A Human A2a adenosine receptor T4L chimera D52N mutation 10665 3.2.1.17 | Details
41 5N2R 1 A Adenosine receptor A2a,Soluble cytochrome b562,ADENOSINE RECEPTOR A2A SOLUBLE CYTOCHROME B562 ADENOSINE RECEPTOR A2A,Adenosine receptor A2a 9606
42 3VG9 1 A Adenosine receptor A2a UNP residues 1-316 9606
43 4NTJ 1 A P2Y purinoceptor 12,Soluble cytochrome b562,P2Y purinoceptor 12 Chimera protein of N-terminal residues 2-223 from P2Y12R (P2Y12_HUMAN), Soluble cytochrome b562 (C562_ECOLX), and C-terminal residues 224-342 from P2Y12R (P2Y12_HUMAN). 9606
44 3ODU 1 A, B C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-229, LYSOZYME residues 1002-1161, CXCR4 residues 230-319 10665 3.2.1.17 | Details
45 5DSG 1 A, B Muscarinic acetylcholine receptor M4,Endolysin,Endolysin,Muscarinic acetylcholine receptor M4 10665 3.2.1.17 | Details
46 2Y01 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
47 2VT4 1 A, B, C, D BETA1 ADRENERGIC RECEPTOR RESIDUES 33-243,272-276,279-367 9103
48 2Y02 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
49 4MBS 1 A, B Chimera protein of C-C chemokine receptor type 5 and Rubredoxin Rubredoxin inserted into CCR5 between residue 223 and 227 9606
50 2YDV 1 A ADENOSINE RECEPTOR A2A RESIDUES 1-317 9606
51 5GLI 1 A Endothelin Receptor Subtype-B 9606 3.2.1.17 | Details
52 3QAK 1 A Adenosine receptor A2a,lysozyme chimera 10665 3.2.1.17 | Details
53 4IAR 1 A Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 9606
54 4UG2 1 A, B THERMOSTABILISED HUMAN A2A RECEPTOR THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 316 OF THE A2A SEQUENCE, BUT HAS AN 9 RESIDUE SEQUENCE THAT INCLUDES A LINKER AND THE TEV CLEAVAGE SEQUENCE (AAAENLYFQ) AT THE C-TERMINUS 9606
55 3ZPR 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-368 9103
56 4IB4 1 A Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 9606
57 5X7D 1 A Chimera protein of Beta-2 adrenergic receptor and Lysozyme UNP P07550 residues 1-230, UNP D9IEF7 residues 2-162, UNP P07550 residues 264-365 10665 3.2.1.17 | Details
58 5ZKQ 1 A, B Platelet-activating factor receptor,Endolysin,Endolysin,Platelet-activating factor receptor 10665 3.2.1.17 | Details
59 5CXV 1 A Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 10665 3.2.1.17 | Details
60 3ZPQ 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-368 9103
61 5TVN 1 A Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 9606
62 5ZKP 1 A Platelet-activating factor receptor,Flavodoxin,Platelet-activating factor receptor The fusion protein of Platelet-activating factor receptor (UNP residues 2-216), Flavodoxin (UNP residues 2-148), Platelet-activating factor receptor (UNP residues 224-316), and tags 9606
63 3NY9 1 A Beta-2 adrenergic receptor, Lysozyme Chimeric protein of Beta-2 Adrenoreceptor 1-230, Lysozyme 2-161, Beta-2 adrenergic receptor 263-348 10665 3.2.1.17 | Details
64 5KW2 1 A Free fatty acid receptor 1,Lysozyme,Free fatty acid receptor 1 10665 3.2.1.17 | Details
65 2Y03 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
66 4GRV 1 A Neurotensin receptor type 1, lysozyme chimera see remark 999 10665 3.2.1.17 | Details
67 4NC3 1 A Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 BRIL 9606
68 3OE0 1 A C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-319 10665 3.2.1.17 | Details
69 3D4S 1 A Beta-2 adrenergic receptor/T4-lysozyme chimera 10665 3.2.1.17 | Details
70 3V2Y 1 A Sphingosine 1-phosphate receptor 1, Lysozyme chimera (E.C.3.2.1.17) 10665 3.2.1.17 | Details
71 4U15 1 A, B Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3 UNP P08483 residues 57-259, 482-563, UNP D9IEF7 residues 61-161 10665 3.2.1.17 | Details
72 4UHR 1 A THERMOSTABILISED HUMAN A2A RECEPTOR THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 316 OF THE A2A SEQUENCE, BUT HAS AN 9 RESIDUE SEQUENCE THAT INCLUDES A LINKER AND THE TEV CLEAVAGE SEQUENCE (AAAENLYFQ) AT THE C-TERMINUS 9606
73 3VGA 1 A Adenosine receptor A2a UNP residues 1-316 9606
74 3NY8 1 A Beta-2 adrenergic receptor, Lysozyme Chimeric protein of Beta-2 Adrenoreceptor 1-230, Lysozyme 2-161, Beta-2 adrenergic receptor 263-348 10665 3.2.1.17 | Details
75 4DKL 1 A Mu-type opioid receptor, lysozyme chimera SEE REMARK 999 10665 3.2.1.17 | Details
76 6CM4 1 A D(2) dopamine receptor, endolysin chimera 10665 3.2.1.17 | Details
77 5T1A 1 A Chimera protein of CC chemokine receptor type 2 isoform B and T4-lysozyme,Lysozyme UNP P41597-2 residues 2-328 with UNP P00720 residues 2-161 inserted after residues 233 10665 3.2.1.17 | Details
78 4IAQ 1 A Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 9606
79 5JTB 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a UNP Residues 2-208,UNP Residues 23-217,UNP Residues 219-316,UNP Residues 2-208,UNP Residues 23-217,UNP Residues 219-316,UNP Residues 2-208,UNP Residues 23-217,UNP Residues 219-316 9606
80 5GLH 1 A Endothelin Receptor Subtype-B 9606 3.2.1.17 | Details
81 5OLO 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
82 4DJH 1 A, B Kappa-type opioid receptor, Lysozyme UNP P41145 residues 43-261, UNP P00720 residues 2-161, UNP P41145 residues 362-358 10665 3.2.1.17 | Details
83 6BQH 1 A 5-hydroxytryptamine receptor 2C,Soluble cytochrome b562 9606
84 4BUO 1 A, B NEUROTENSIN RECEPTOR TYPE 1 THERMOSTABLE MUTANT WITH INTRACELLULAR LOOP 3 DELETION B (E273-T290) RESIDUES 50-272 AND 291-390 10116
85 5ZBH 1 A Neuropeptide Y receptor type 1,T4 Lysozyme,Neuropeptide Y receptor type 1 UNP residues 2-241,UNP residues 2-161,UNP residues 250-358 10665 3.2.1.17 | Details
86 3UON 1 A Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein UNP RESIDUES 1-217, UNP RESIDUES 2-161, UNP RESIDUES 377-466 10665 3.2.1.17 | Details
87 3RZE 1 A Histamine H1 receptor, Lysozyme chimera 10665 3.2.1.17 | Details
88 5TUD 1 A, D 5-hydroxytryptamine receptor 2B,Soluble cytochrome b562 chimera UNP P41595 residues 36-248 and 314-405 linked by UNP P0ABE7 residues 23-128 9606
89 2Y04 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
90 3PBL 1 A, B D(3) dopamine receptor, Lysozyme chimera 10665 3.2.1.17 | Details
91 4PY0 1 A P2Y purinoceptor 12, Soluble cytochrome b562 Chimera protein of N-terminal residues 2-223 from P2Y12R (P2Y12_HUMAN), Soluble cytochrome b562 (C562_ECOLX), and C-terminal residues 224-342 from P2Y12R (P2Y12_HUMAN). 9606
92 5WF6 1 A Human A2a adenosine receptor T4L chimera S91A mutation 10665 3.2.1.17 | Details
93 3ZEV 1 A, B NEUROTENSIN RECEPTOR 1 TM86V THERMOSTABLE MUTANT 10116
94 5D6L 1 A Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor 10665 3.2.1.17 | Details
95 2YDO 1 A ADENOSINE RECEPTOR A2A RESIDUES 1-317 9606
96 2YCW 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
97 3NYA 1 A Beta-2 adrenergic receptor, Lysozyme Chimeric protein of Beta-2 Adrenoreceptor 1-230, Lysozyme 2-161, Beta-2 adrenergic receptor 263-348 10665 3.2.1.17 | Details
98 4Z35 1 A Lysophosphatidic acid receptor 1,Soluble cytochrome b562 9606
99 4Z34 1 A Lysophosphatidic acid receptor 1, Soluble cytochrome b562 unp residues 2-232; unp residues 23-64; unp residues 73-127; unp residues 248-326 9606
100 2R4R 1 A Beta-2 adrenergic receptor 9606
101 3OE6 1 A C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-325 10665 3.2.1.17 | Details
102 5XSZ 1 A Lysophosphatidic acid receptor 6a,Endolysin,Lysophosphatidic acid receptor 6a Chimera protein of UNP residues 1-227 from Lysophosphatidic acid receptor 6a (Q08BG4), UNP residues 2-161 from Endolysin (P00720),UNP residues 233-312 from Lysophosphatidic acid receptor 6a (Q08BG4). 10665 3.2.1.17 | Details
103 4RWS 1 A C-X-C chemokine receptor type 4/Endolysin chimeric protein CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-319 10665 3.2.1.17 | Details
104 4Z36 1 A Lysophosphatidic acid receptor 1,Soluble cytochrome b562 unp residues 2-232; unp residues 23-64; unp residues 78-127; unp residues 249-327 9606
105 3V2W 1 A Sphingosine 1-phosphate receptor 1, Lysozyme chimera 10665 3.2.1.17 | Details
106 6BQG 1 A 5-hydroxytryptamine receptor 2C,Soluble cytochrome b562 9606
107 3OE8 1 A, B, C C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-229, LYSOZYME residues 1002-1161, CXCR4 residues 230-319 10665 3.2.1.17 | Details
108 3OE9 1 A, B C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-319 10665 3.2.1.17 | Details
109 4AMI 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 33-243,272-368 9103
110 2R4S 1 A Beta-2 adrenergic receptor 9606
111 5UVI 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
112 2YCY 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
113 3KJ6 1 A Beta-2 adrenergic receptor 9606
114 5T04 1 A Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 unp residues 43-268; 2-161; 297-396,unp residues 43-268; 2-161; 297-396,unp residues 43-268; 2-161; 297-396 10665 3.2.1.17 | Details
115 3PDS 1 A Fusion protein Beta-2 adrenergic receptor/Lysozyme 10665 3.2.1.17 | Details
116 3P0G 1 A Beta-2 adrenergic receptor, Lysozyme BETA-2-ADRENERGIC RECEPTOR/T4-LYSOZYME CHIMERA UNP P07550 residues 1-230, 263-365, UNP P00720 residues 2-161 10665 3.2.1.17 | Details
117 5TZY 1 A Free fatty acid receptor 1,Endolysin,Free fatty acid receptor 1 10665 3.2.1.17 | Details
118 4DAJ 1 A, B, C, D Muscarinic acetylcholine receptor M3, Lysozyme Chimeric Protein P08483 residues 57-259, 482-589, P00720 residues 1-161 10665 3.2.1.17 | Details
119 4EJ4 1 A Delta-type opioid receptor, Lysozyme chimera P32300 residues 36-244, 251-342 10665 3.2.1.17 | Details
120 4BV0 1 A, B NEUROTENSIN RECEPTOR TYPE 1 THERMOSTABLE MUTANT WITH INTRACELLULAR LOOP 3 DELETION B (T279-I295) RESIDUES 50-390 10116
121 2YCX 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
122 4MQS 1 A Muscarinic acetylcholine receptor M2 UNP residues 1-232, 373-466 9606
123 4U16 1 A, B Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3 UNP P08483 residues 57-259, 482-563, UNP D9IEF7 residues 61-161 10665 3.2.1.17 | Details
124 3PWH 1 A Adenosine receptor A2a residues 1-317 9606
125 5XPR 1 A Endothelin B receptor,Endolysin,Endothelin B receptor Chimera protein of Residues 66-303 from P24530, linker, Residues 61-161 from P00720, Residues 311-407 from P24530. 10665 3.2.1.17 | Details
126 5UEN 1 A, B Adenosine receptor A1,Soluble cytochrome b562,Adenosine receptor A1 UNP P30542 reisues 2-210, UNP P0ABE7 residues 23-127, UNP P30542 residues 228-31,UNP P30542 reisues 2-210, UNP P0ABE7 residues 23-127, UNP P30542 residues 228-31,UNP P30542 reisues 2-210, UNP P0ABE7 residues 23-127, UNP P30542 residues 228-31 9606
127 2YCZ 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
128 5D5B 1 A Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor 10665 3.2.1.17 | Details
129 3UZC 1 A Adenosine A2A Receptor residues 1-317 9606
130 4MQT 1 A Muscarinic acetylcholine receptor M2 UNP residues 1-232,373-466 9606
131 3UZA 1 A Adenosine receptor A2a residues 1-317 9606
132 5G53 1 A, B ADENOSINE RECEPTOR A2A THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 308 OF THE A2A SEQUENCE, BUT HAS A 6 RESIDUE SEQUENCE THAT INCLUDES THE TEV CLEAVAGE SEQUENCE (ENLYFQ) AT THE C- TERMINUS 9606
133 5UIG 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a The protein is a chimera with BRIL inserted between L208 and E219 9606
134 4U14 1 A Muscarinic acetylcholine receptor M3,Endolysin,Muscarinic acetylcholine receptor M3 UNP P08483 residues 57-259, 482-563, P00720 residues 1-161 10665 3.2.1.17 | Details
135 3REY 1 A Adenosine receptor A2a residues 1-317 9606
136 5NJ6 1 A Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2 9606
137 5V54 1 A, B 5-hydroxytryptamine receptor 1B,OB-1 fused 5-HT1b receptor,5-hydroxytryptamine receptor 1B UNP residues 37-239,UNP residues 304-390 9606
138 4GBR 1 A Beta-2 adrenergic receptor UNP RESIDUES 29-365 9606
139 3RFM 1 A Adenosine receptor A2a residues 1-317 9606
140 4GPO 1 A, B Beta-1 adrenergic receptor RESIDUES 33-243,272-276,279-367 9103
141 4BWB 1 A, B NEUROTENSIN RECEPTOR TYPE 1 RESIDUES 50-390 10116
142 5F8U 1 A, B Beta-1 adrenergic receptor RESIDUES 33-243,272-276,279-367 9103
143 6D9H 4 R Chimera protein of Muscarinic acetylcholine receptor M4 and Adenosine receptor A1 9606
144 6G79 4 S 5-hydroxytryptamine receptor 1B 9606
145 2LNL 1 A C-X-C chemokine receptor type 1 UNP residues 20-328 9606