Sequence Similarity Clusters for the Entities in PDB 2R4S

Entity #1 | Chains: A
Beta-2 adrenergic receptor protein, length: 342 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 42066
95 % 2 3 25974 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.4
PDBFlex
90 % 2 4 16866
70 % 10 15 4937
50 % 122 156 249
40 % 134 169 258
30 % 135 172 269
Entity #2 | Chains: L
antibody for beta2 adrenoceptor, light chain protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 29685
95 % 3 4 17871 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.3
PDBFlex
90 % 28 30 2011
70 % 2313 2696 1
50 % 4702 5473 1
40 % 5276 6175 1
30 % 6548 7653 1
Entity #3 | Chains: H
antibody for beta2 adrenoceptor, heavy chain protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 29686
95 % 2 3 25975 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.3
PDBFlex
90 % 2 3 25049
70 % 2280 2655 2
50 % 4703 5473 1
40 % 5277 6175 1
30 % 6549 7653 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 5IU4 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
2 4EIY 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
3 5NM4 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
4 5IU7 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
5 5OLZ 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
6 5K2C 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
7 5K2D 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
8 5OLG 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
9 5NM2 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
10 5OLV 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
11 5IU8 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
12 5MZJ 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
13 5OM4 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
14 6IGK 1 A Endothelin receptor type B,Endolysin,Endothelin receptor type B Chimera protein of Endothelin receptor type B inserted with Endolysin between residues 303 and 311. 10665 3.2.1.17 | Details
15 5WIU 1 A D(4) dopamine receptor, soluble cytochrome b562 chimera 9606
16 5C1M 1 A Mu-type opioid receptor 10090
17 5OM1 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
18 5IUB 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
19 4BVN 1 A BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. 9103
20 5MZP 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
21 5WIV 1 A D(4) dopamine receptor, soluble cytochrome b562 chimera 9606
22 5NLX 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
23 5TZR 1 A Free fatty acid receptor 1,Endolysin,Free fatty acid receptor 1 10665 3.2.1.17 | Details
24 5IUA 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
25 5X93 1 A Endothelin B receptor,Endolysin,Endothelin B receptor Chimera protein of Residues 66-303 from P24530, linker, Residues 61-161 from P00720, Residues 311-407 from P24530. 10665 3.2.1.17 | Details
26 5UIW 1 A C-C chemokine receptor type 5,Rubredoxin chimera Rubredoxin fusion sequence P00268; in between CCR5 residue 223 and 227 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 9606
27 3VW7 1 A Proteinase-activated receptor 1, Lysozyme Chimera protein of residues 86-395 form Proteinase-activated receptor 1 (P25116, PAR1_HUMAN), Lyzosyme from Enterobacteria phage T4 (P00720, LYS_BPT4) and residues 303-395 from Proteinase-activated receptor 1 (P25116, PAR1_HUMAN) 10665 3.2.1.17 | Details
28 4AMJ 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 33-243,272-368 9103
29 4PHU 1 A Free fatty acid receptor 1,Lysozyme Chimera UNP O14842 residues 2-213, UNP P00720 residues 2-161, UNP O14842 residues 214-300 10665 3.2.1.17 | Details
30 5VRA 1 A Adenosine receptor A2a,Soluble cytochrome b562 chimera UNP P29274 residues 2-208 and 219-316 linked by UNP P0ABE7 residues 23-128 9606
31 5K2B 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
32 5K2A 1 A Adenosine receptor A2a/Soluble cytochrome b562 chimera 9606
33 2RH1 1 A beta-2-adrenergic receptor/T4-lysozyme chimera 10665 3.2.1.17 | Details
34 5ZKC 1 A Muscarinic acetylcholine receptor M2,Apo-cytochrome b562,Muscarinic acetylcholine receptor M2 UNP residues 10-217,UNP residues 377-466 9606
35 5A8E 1 A BETA1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. 9103
36 6M9T 1 A Prostaglandin E2 receptor EP3 subtype, Endolysin chimera EP3 UNP residues 2-259,273-353 with intervening lysozyme 10665 3.2.1.17 | Details
37 4PXZ 1 A P2Y purinoceptor 12, Soluble cytochrome b562 Chimera protein of N-terminal residues 2-223 from P2Y12R (P2Y12_HUMAN), Soluble cytochrome b562 (C562_ECOLX), and C-terminal residues 224-342 from P2Y12R (P2Y12_HUMAN). 9606
38 5D5A 1 A Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor 10665 3.2.1.17 | Details
39 3EML 1 A Human Adenosine A2A receptor/T4 lysozyme chimera 10665 3.2.1.17 | Details
40 5OLH 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
41 6AQF 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a UNP P29274 residues 2-208 and 219-316 linked via UNP P0ABE7 residues 23-128,UNP P29274 residues 2-208 and 219-316 linked via UNP P0ABE7 residues 23-128,UNP P29274 residues 2-208 and 219-316 linked via UNP P0ABE7 residues 23-128 9606
42 2Y00 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
43 5WF5 1 A Human A2a adenosine receptor T4L chimera D52N mutation 10665 3.2.1.17 | Details
44 5N2R 1 A Adenosine receptor A2a,Soluble cytochrome b562,ADENOSINE RECEPTOR A2A SOLUBLE CYTOCHROME B562 ADENOSINE RECEPTOR A2A,Adenosine receptor A2a 9606
45 3VG9 1 A Adenosine receptor A2a UNP residues 1-316 9606
46 6IGL 1 A Endothelin receptor type B,Endolysin,Endothelin receptor type B Chimera protein of Endothelin receptor type B inserted with Endolysin between residues 303 and 311. 10665 3.2.1.17 | Details
47 5YC8 1 A Muscarinic acetylcholine receptor M2,Redesigned apo-cytochrome b562,Muscarinic acetylcholine receptor M2 UNP residues 10-214,UNP residues 377-466 9606
48 4NTJ 1 A P2Y purinoceptor 12,Soluble cytochrome b562,P2Y purinoceptor 12 Chimera protein of N-terminal residues 2-223 from P2Y12R (P2Y12_HUMAN), Soluble cytochrome b562 (C562_ECOLX), and C-terminal residues 224-342 from P2Y12R (P2Y12_HUMAN). 9606
49 3ODU 1 A, B C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-229, LYSOZYME residues 1002-1161, CXCR4 residues 230-319 10665 3.2.1.17 | Details
50 5DSG 1 A, B Muscarinic acetylcholine receptor M4,Endolysin,Endolysin,Muscarinic acetylcholine receptor M4 10665 3.2.1.17 | Details
51 2Y01 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
52 2VT4 1 A, B, C, D BETA1 ADRENERGIC RECEPTOR RESIDUES 33-243,272-276,279-367 9103
53 2Y02 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
54 6H7N 2 A, B Beta-1 adrenergic receptor 9103
55 4MBS 1 A, B Chimera protein of C-C chemokine receptor type 5 and Rubredoxin Rubredoxin inserted into CCR5 between residue 223 and 227 9606
56 2YDV 1 A ADENOSINE RECEPTOR A2A RESIDUES 1-317 9606
57 5GLI 1 A Endothelin Receptor Subtype-B 9606 3.2.1.17 | Details
58 3QAK 1 A Adenosine receptor A2a,lysozyme chimera 10665 3.2.1.17 | Details
59 4IAR 1 A Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 9606
60 5VBL 2 B Apelin receptor,Rubredoxin,Apelin receptor Chimera UNP residues 7-229, UNP residues 1-54, UNP residues 243-330 9606
61 4UG2 1 A, B THERMOSTABILISED HUMAN A2A RECEPTOR THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 316 OF THE A2A SEQUENCE, BUT HAS AN 9 RESIDUE SEQUENCE THAT INCLUDES A LINKER AND THE TEV CLEAVAGE SEQUENCE (AAAENLYFQ) AT THE C-TERMINUS 9606
62 3ZPR 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-368 9103
63 4IB4 1 A Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 9606
64 5X7D 1 A Chimera protein of Beta-2 adrenergic receptor and Lysozyme UNP P07550 residues 1-230, UNP D9IEF7 residues 2-162, UNP P07550 residues 264-365 10665 3.2.1.17 | Details
65 6AKX 1 A, B C-C chemokine receptor type 5,Rubredoxin,C-C chemokine receptor type 5 Chimera protein of C-C chemokine receptor type 5 and Rubredoxin. Rubredoxin was inserted into CCR5 between residue 223 and 227. 9606
66 5ZKQ 1 A, B Platelet-activating factor receptor,Endolysin,Endolysin,Platelet-activating factor receptor 10665 3.2.1.17 | Details
67 5ZK3 1 A Muscarinic acetylcholine receptor M2,Apo-cytochrome b562,Muscarinic acetylcholine receptor M2 UNP residues 10-217,UNP residues 377-466 9606
68 5CXV 1 A Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 10665 3.2.1.17 | Details
69 3ZPQ 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-368 9103
70 5TVN 1 A Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 9606
71 5ZKP 1 A Platelet-activating factor receptor,Flavodoxin,Platelet-activating factor receptor The fusion protein of Platelet-activating factor receptor (UNP residues 2-216), Flavodoxin (UNP residues 2-148), Platelet-activating factor receptor (UNP residues 224-316), and tags 9606
72 3NY9 1 A Beta-2 adrenergic receptor, Lysozyme Chimeric protein of Beta-2 Adrenoreceptor 1-230, Lysozyme 2-161, Beta-2 adrenergic receptor 263-348 10665 3.2.1.17 | Details
73 5KW2 1 A Free fatty acid receptor 1,Lysozyme,Free fatty acid receptor 1 10665 3.2.1.17 | Details
74 2Y03 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
75 4GRV 1 A Neurotensin receptor type 1, lysozyme chimera see remark 999 10665 3.2.1.17 | Details
76 4NC3 1 A Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 BRIL 9606
77 6H7L 2 A, B Beta-1 adrenergic receptor 9103
78 3OE0 1 A C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-319 10665 3.2.1.17 | Details
79 3D4S 1 A Beta-2 adrenergic receptor/T4-lysozyme chimera 10665 3.2.1.17 | Details
80 6H7K 2 A, B Beta-1 adrenergic receptor 9103
81 3V2Y 1 A Sphingosine 1-phosphate receptor 1, Lysozyme chimera (E.C.3.2.1.17) 10665 3.2.1.17 | Details
82 4U15 1 A, B Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3 UNP P08483 residues 57-259, 482-563, UNP D9IEF7 residues 61-161 10665 3.2.1.17 | Details
83 4UHR 1 A THERMOSTABILISED HUMAN A2A RECEPTOR THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 316 OF THE A2A SEQUENCE, BUT HAS AN 9 RESIDUE SEQUENCE THAT INCLUDES A LINKER AND THE TEV CLEAVAGE SEQUENCE (AAAENLYFQ) AT THE C-TERMINUS 9606
84 3VGA 1 A Adenosine receptor A2a UNP residues 1-316 9606
85 3NY8 1 A Beta-2 adrenergic receptor, Lysozyme Chimeric protein of Beta-2 Adrenoreceptor 1-230, Lysozyme 2-161, Beta-2 adrenergic receptor 263-348 10665 3.2.1.17 | Details
86 4DKL 1 A Mu-type opioid receptor, lysozyme chimera SEE REMARK 999 10665 3.2.1.17 | Details
87 6CM4 1 A D(2) dopamine receptor, endolysin chimera 10665 3.2.1.17 | Details
88 6D27 1 A Prostaglandin D2 receptor 2, Endolysin chimera CRTH2 (UNP residues 1-236), T4 ligase (UNP residues 2-12,61-161), CRTH2 (UNP residues 238-339) 10665 3.2.1.17 | Details
89 5T1A 1 A Chimera protein of CC chemokine receptor type 2 isoform B and T4-lysozyme,Lysozyme UNP P41597-2 residues 2-328 with UNP P00720 residues 2-161 inserted after residues 233 10665 3.2.1.17 | Details
90 4IAQ 1 A Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 9606
91 5JTB 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a UNP Residues 2-208,UNP Residues 23-217,UNP Residues 219-316,UNP Residues 2-208,UNP Residues 23-217,UNP Residues 219-316,UNP Residues 2-208,UNP Residues 23-217,UNP Residues 219-316 9606
92 5GLH 1 A Endothelin Receptor Subtype-B 9606 3.2.1.17 | Details
93 5OLO 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
94 4DJH 1 A, B Kappa-type opioid receptor, Lysozyme UNP P41145 residues 43-261, UNP P00720 residues 2-161, UNP P41145 residues 362-358 10665 3.2.1.17 | Details
95 6BQH 1 A 5-hydroxytryptamine receptor 2C,Soluble cytochrome b562 9606
96 6H7O 2 A, B Beta-1 adrenergic receptor 9103
97 4BUO 1 A, B NEUROTENSIN RECEPTOR TYPE 1 THERMOSTABLE MUTANT WITH INTRACELLULAR LOOP 3 DELETION B (E273-T290) RESIDUES 50-272 AND 291-390 10116
98 5ZBH 1 A Neuropeptide Y receptor type 1,T4 Lysozyme,Neuropeptide Y receptor type 1 UNP residues 2-241,UNP residues 2-161,UNP residues 250-358 10665 3.2.1.17 | Details
99 5ZKB 1 A Muscarinic acetylcholine receptor M2,Apo-cytochrome b562,Muscarinic acetylcholine receptor M2 UNP residues 10-217,UNP residues 377-466 9606
100 6DRY 1 A 5HT2B receptor, BRIL chimera 9606
101 3UON 1 A Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein UNP RESIDUES 1-217, UNP RESIDUES 2-161, UNP RESIDUES 377-466 10665 3.2.1.17 | Details
102 3RZE 1 A Histamine H1 receptor, Lysozyme chimera 10665 3.2.1.17 | Details
103 6D26 1 A Prostaglandin D2 receptor 2, Endolysin chimera CRTH2 (UNP residues 1-236), T4 ligase (UNP residues 2-12,61-161), CRTH2 (UNP residues 238-339) 10665 3.2.1.17 | Details
104 5TUD 1 A, D 5-hydroxytryptamine receptor 2B,Soluble cytochrome b562 chimera UNP P41595 residues 36-248 and 314-405 linked by UNP P0ABE7 residues 23-128 9606
105 2Y04 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-368 9103
106 3PBL 1 A, B D(3) dopamine receptor, Lysozyme chimera 10665 3.2.1.17 | Details
107 5ZK8 1 A Muscarinic acetylcholine receptor M2,Redesigned apo-cytochrome b562,Muscarinic acetylcholine receptor M2 UNP residues 10-217,UNP residues 377-466 9606
108 4PY0 1 A P2Y purinoceptor 12, Soluble cytochrome b562 Chimera protein of N-terminal residues 2-223 from P2Y12R (P2Y12_HUMAN), Soluble cytochrome b562 (C562_ECOLX), and C-terminal residues 224-342 from P2Y12R (P2Y12_HUMAN). 9606
109 6H7M 2 A, B Beta-1 adrenergic receptor 9103
110 6DRZ 1 A 5HT2B receptor, BRIL chimera 9606
111 5ZHP 1 A, B Muscarinic acetylcholine receptor M3,Endolysin,Endolysin,Muscarinic acetylcholine receptor M3 10665 3.2.1.17 | Details
112 5WF6 1 A Human A2a adenosine receptor T4L chimera S91A mutation 10665 3.2.1.17 | Details
113 3ZEV 1 A, B NEUROTENSIN RECEPTOR 1 TM86V THERMOSTABLE MUTANT 10116
114 5D6L 1 A Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor 10665 3.2.1.17 | Details
115 6DS0 1 A 5HT2B receptor, BRIL chimera 9606
116 2YDO 1 A ADENOSINE RECEPTOR A2A RESIDUES 1-317 9606
117 2YCW 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
118 6AKY 1 A C-C chemokine receptor type 5,Rubredoxin,C-C chemokine receptor type 5 Chimera protein of C-C chemokine receptor type 5 and Rubredoxin. Rubredoxin was inserted into CCR5 between residue 223 and 227. 9606
119 5XJM 1 A Type-2 angiotensin II receptor,Soluble cytochrome b562,Type-2 angiotensin II receptor UNP residues 35-242,UNP residues 246-346 9606
120 3NYA 1 A Beta-2 adrenergic receptor, Lysozyme Chimeric protein of Beta-2 Adrenoreceptor 1-230, Lysozyme 2-161, Beta-2 adrenergic receptor 263-348 10665 3.2.1.17 | Details
121 4Z35 1 A Lysophosphatidic acid receptor 1,Soluble cytochrome b562 9606
122 4Z34 1 A Lysophosphatidic acid receptor 1, Soluble cytochrome b562 unp residues 2-232; unp residues 23-64; unp residues 73-127; unp residues 248-326 9606
123 6DRX 1 A 5HT2B receptor, BRIL chimera 9606
124 2R4R 1 A Beta-2 adrenergic receptor 9606
125 3OE6 1 A C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-325 10665 3.2.1.17 | Details
126 5XSZ 1 A Lysophosphatidic acid receptor 6a,Endolysin,Lysophosphatidic acid receptor 6a Chimera protein of UNP residues 1-227 from Lysophosphatidic acid receptor 6a (Q08BG4), UNP residues 2-161 from Endolysin (P00720),UNP residues 233-312 from Lysophosphatidic acid receptor 6a (Q08BG4). 10665 3.2.1.17 | Details
127 4RWS 1 A C-X-C chemokine receptor type 4/Endolysin chimeric protein CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-319 10665 3.2.1.17 | Details
128 4Z36 1 A Lysophosphatidic acid receptor 1,Soluble cytochrome b562 unp residues 2-232; unp residues 23-64; unp residues 78-127; unp residues 249-327 9606
129 6H7J 2 A, B Beta-1 adrenergic receptor 9103
130 3V2W 1 A Sphingosine 1-phosphate receptor 1, Lysozyme chimera 10665 3.2.1.17 | Details
131 6BQG 1 A 5-hydroxytryptamine receptor 2C,Soluble cytochrome b562 9606
132 3OE8 1 A, B, C C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-229, LYSOZYME residues 1002-1161, CXCR4 residues 230-319 10665 3.2.1.17 | Details
133 3OE9 1 A, B C-X-C chemokine receptor type 4, Lysozyme Chimera CXCR4 residues 2-228, LYSOZYME residues 1002-1161, CXCR4 residues 231-319 10665 3.2.1.17 | Details
134 4AMI 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 33-243,272-368 9103
135 2R4S 1 A Beta-2 adrenergic receptor 9606
136 5UVI 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a 9606
137 2YCY 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
138 3KJ6 1 A Beta-2 adrenergic receptor 9606
139 5T04 1 A Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 unp residues 43-268; 2-161; 297-396,unp residues 43-268; 2-161; 297-396,unp residues 43-268; 2-161; 297-396 10665 3.2.1.17 | Details
140 3PDS 1 A Fusion protein Beta-2 adrenergic receptor/Lysozyme 10665 3.2.1.17 | Details
141 3P0G 1 A Beta-2 adrenergic receptor, Lysozyme BETA-2-ADRENERGIC RECEPTOR/T4-LYSOZYME CHIMERA UNP P07550 residues 1-230, 263-365, UNP P00720 residues 2-161 10665 3.2.1.17 | Details
142 5TZY 1 A Free fatty acid receptor 1,Endolysin,Free fatty acid receptor 1 10665 3.2.1.17 | Details
143 4DAJ 1 A, B, C, D Muscarinic acetylcholine receptor M3, Lysozyme Chimeric Protein P08483 residues 57-259, 482-589, P00720 residues 1-161 10665 3.2.1.17 | Details
144 4EJ4 1 A Delta-type opioid receptor, Lysozyme chimera P32300 residues 36-244, 251-342 10665 3.2.1.17 | Details
145 4BV0 1 A, B NEUROTENSIN RECEPTOR TYPE 1 THERMOSTABLE MUTANT WITH INTRACELLULAR LOOP 3 DELETION B (T279-I295) RESIDUES 50-390 10116
146 2YCX 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
147 4MQS 1 A Muscarinic acetylcholine receptor M2 UNP residues 1-232, 373-466 9606
148 4U16 1 A, B Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3 UNP P08483 residues 57-259, 482-563, UNP D9IEF7 residues 61-161 10665 3.2.1.17 | Details
149 3PWH 1 A Adenosine receptor A2a residues 1-317 9606
150 5XPR 1 A Endothelin B receptor,Endolysin,Endothelin B receptor Chimera protein of Residues 66-303 from P24530, linker, Residues 61-161 from P00720, Residues 311-407 from P24530. 10665 3.2.1.17 | Details
151 5UEN 1 A, B Adenosine receptor A1,Soluble cytochrome b562,Adenosine receptor A1 UNP P30542 reisues 2-210, UNP P0ABE7 residues 23-127, UNP P30542 residues 228-31,UNP P30542 reisues 2-210, UNP P0ABE7 residues 23-127, UNP P30542 residues 228-31,UNP P30542 reisues 2-210, UNP P0ABE7 residues 23-127, UNP P30542 residues 228-31 9606
152 2YCZ 1 A, B BETA-1 ADRENERGIC RECEPTOR RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 AND 277-278 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED. RESIDUES 33-243,272-276,279-367 9103
153 5D5B 1 A Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor 10665 3.2.1.17 | Details
154 3UZC 1 A Adenosine A2A Receptor residues 1-317 9606
155 4MQT 1 A Muscarinic acetylcholine receptor M2 UNP residues 1-232,373-466 9606
156 3UZA 1 A Adenosine receptor A2a residues 1-317 9606
157 5G53 1 A, B ADENOSINE RECEPTOR A2A THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 308 OF THE A2A SEQUENCE, BUT HAS A 6 RESIDUE SEQUENCE THAT INCLUDES THE TEV CLEAVAGE SEQUENCE (ENLYFQ) AT THE C- TERMINUS 9606
158 5UIG 1 A Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a The protein is a chimera with BRIL inserted between L208 and E219 9606
159 4U14 1 A Muscarinic acetylcholine receptor M3,Endolysin,Muscarinic acetylcholine receptor M3 UNP P08483 residues 57-259, 482-563, P00720 residues 1-161 10665 3.2.1.17 | Details
160 3REY 1 A Adenosine receptor A2a residues 1-317 9606
161 5NJ6 1 A Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2 9606
162 5V54 1 A, B 5-hydroxytryptamine receptor 1B,OB-1 fused 5-HT1b receptor,5-hydroxytryptamine receptor 1B UNP residues 37-239,UNP residues 304-390 9606
163 4GBR 1 A Beta-2 adrenergic receptor UNP RESIDUES 29-365 9606
164 3RFM 1 A Adenosine receptor A2a residues 1-317 9606
165 4GPO 1 A, B Beta-1 adrenergic receptor RESIDUES 33-243,272-276,279-367 9103
166 4BWB 1 A, B NEUROTENSIN RECEPTOR TYPE 1 RESIDUES 50-390 10116
167 5F8U 1 A, B Beta-1 adrenergic receptor RESIDUES 33-243,272-276,279-367 9103
168 6MET 3 B C-C chemokine receptor type 5 residues 1-313 9606
169 6MEO 3 B C-C chemokine receptor type 5 residues 1-313 9606
170 6D9H 4 R Chimera protein of Muscarinic acetylcholine receptor M4 and Adenosine receptor A1 9606
171 6G79 4 S 5-hydroxytryptamine receptor 1B 9606
172 2LNL 1 A C-X-C chemokine receptor type 1 UNP residues 20-328 9606