Sequence Similarity Clusters for the Entities in PDB 1TJH

Entity #1 | Chains: L
anti-HIV-1 antibody 2F5 Light Chain protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 7 10921
95 % 3 41 1331 Flexibility: Low
Max RMSD: 4.4, Avg RMSD: 0.7
PDBFlex
90 % 225 788 2
70 % 706 2474 1
50 % 1447 5011 1
40 % 1447 5011 1
30 % 1650 5941 1
Entity #2 | Chains: H
anti-HIV-1 antibody 2F5 Heavy Chain protein, length: 237 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 21462
95 % 3 41 1328 Flexibility: Low
Max RMSD: 1.8, Avg RMSD: 0.6
PDBFlex
90 % 3 41 1353
70 % 698 2424 2
50 % 1448 5011 1
40 % 1448 5011 1
30 % 1651 5941 1
Entity #3 | Chains: P
Envelope glycoprotein GP41 protein, length: 13 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 4XCF 1 L 4E10 Fab light chain 9606
4 5X08 2 L Fab 4E10 Light chain 9606
5 4XAW 1 L 4E10 Fab light chain 9606
6 5UCB 2 L Fab Light Chain 9606
7 2VXV 2 L HUMAN IGG ABT-325 9606
8 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
9 5I8C 2 B VRC34.01 Fab light chain 9606
10 5WK2 1 L M116 LIGHT CHAIN 9606
11 3PP4 2 L GA101 Fab light chain 10090
12 4PTU 1 A Antibody pn132p2C05, light chain 9606
13 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
14 4XC3 1 L 4E10 Fab light chain 9606
15 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
16 5VSI 2 L CH1/Ckappa Fab light chain 9606
17 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
18 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
19 4NWU 2 L APE1551 Ab Fab light chain 9606
20 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
21 5EWI 2 L VRC38.01 Light Chain 9606
22 5E2W 1 L AT8 LIGHT CHAIN 10090
23 5E2V 1 L AT8 LIGHT CHAIN 10090
24 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
25 5OB5 3 L fAb Light chain 9606
26 3QQ9 1 C, L 101F LIGHT CHAIN 10090
27 5I1K 1 L FAB LIGHT CHAIN 9606
28 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
29 5V7U 1 L CBTAU-22.1 Fab light chain 9606
30 5UEA 3 B, L Fab Light Chain 9606
31 5NMV 1 L Fab light chain 10088
32 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
33 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
34 3QRG 1 L Fab light chain 9606
35 3NCJ 1 L Fab15 Mut8 light chain 9606
36 5W05 1 L M59 FAB LIGHT CHAIN 10090
37 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
38 1UM5 1 L Antibody 21H3 L chain 10090
39 4NWT 1 L APE1531 Ab Fab light chain 9606
40 3NA9 1 L Fab15 light chain 9606
41 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
42 4LRI 1 A, B MSL-109 Light Chain 9606
43 4JN2 1 A, L anti dabigatran Fab 10090
44 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
45 5U6A 1 A Light Chain 9606
46 4HHA 1 A Fab KE5 Fab fragment KE5 9606
47 5UEK 3 L Fab 12E Light Chain 9606
48 3NAA 1 L Fab15 Mut5 light chain 9606
49 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
50 5IK3 2 B, D 1E03 Fab fragment light chain 9606
51 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
52 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
53 5IT2 2 L light chain 9606
54 6BQB 1 L MGG4 Fab light chain 9606
55 4PUB 2 L DX-2930 LIGHT CHAIN 9606
56 6B14 2 L Light chain of Fab BL3-6S97N 10090
57 5XHG 1 A, C polypeptide(L) 562
58 3OAZ 2 K, L Fab 2G12, light chain 9606
59 4YGV 2 B, L aDabi-Fab2a light chain 9606
60 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
61 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
62 3EO0 1 A, C GC-1008 Fab Light Chain 10090
63 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
64 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
65 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
66 4JHA 2 L D25 light chain 9606
67 4PTT 1 A Antibody pn132p2C05, light chain 9606
68 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
69 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
70 4DGV 2 L HCV1 Light Chain 9606
71 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
72 3IU4 2 L chP3 Fab light chain 10090
73 3P0Y 3 L Fab DL11 light chain 9606
74 6ANA 3 L LL2 Fab Light Chain 10090
75 5IBU 1 B, L 6652 Light Chain 9606
76 6AOD 1 A FXIa Antibody FAB Light Chain 9606
77 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
78 6ELE 2 B, L fAB light chain 9606
79 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
80 3NAC 1 L Fab15 Mut7 light chain 9606
81 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
82 4YHO 2 L aDabi-Fab3 light chain 9606
83 4DGY 2 L HCV1 Light Chain 9606
84 3MXW 2 L 5E1 light chain 9606
85 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
86 3EO9 1 L Efalizumab Fab fragment, light chain 9606
87 5WUV 1 L light chain 9606
88 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
89 6B0G 1 C 1245 Antibody, Light Chain 9606
90 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
91 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
92 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
93 5TL5 1 L M2177 LIGHT CHAIN 10090
94 2FX7 1 L Fab 4E10 Light Chain 9606
95 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
96 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
97 5XKU 2 B HNIgGA6 light chain 9606
98 5I18 1 L FAB LIGHT CHAIN 9606
99 4JN1 2 L anti-dabigatran Fab1, light chain 10090
100 3SOB 1 L antibody light chain 9606
101 6B5M 2 L CIS43 Fab Light chain 9606
102 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
103 5DR5 2 L AbD09097 Fab light chain 9606
104 4KQ3 1 L CNTO3186 light chain Fab 9606
105 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
106 4I77 2 L Lebrikizumab light chain Fab 9606
107 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
108 4HJG 1 A Trastuzumab light chain 9606
109 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
110 3FN0 1 L Fab Z13e1 light chain 9606
111 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
112 4YHI 2 B, L aDabi-Fab2a light chain 9606
113 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
114 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
115 6ELJ 2 B, L fAB light chain 9606
116 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
117 4MAU 1 L C2244 light chain SEE REMARK 999 10090
118 1OP3 1 K, L FAB 2G12, light chain light chain 9606
119 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
120 4LKX 2 B Fab fragment light chain 9606
121 5JW5 2 B, L MEDI8852 Light chain 9606
122 3QWO 1 B, L motavizumab light chain 10090
123 4IOI 1 A Trastuzumab light chain 9606
124 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
125 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
126 5VAG 2 B Light chain of antibody m826 9606
127 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
128 5I16 1 A, L FAB LIGHT CHAIN 9606
129 5F9O 3 L CH235.09 Light chain 9606
130 1UM4 1 L Antibody 21H3 L chain 10090
131 4RBP 1 K, L Fab 2G12 light chain 9606
132 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
133 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
134 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
135 5GGQ 1 L nivolumab light chain 9606
136 6B5N 2 L CIS43 Fab Light chain 9606
137 3OAY 1 K, L Fab 2G12, light chain 9606
138 6AND 3 L Pinatuzumab Fab light chain 9606
139 5K9J 2 L 56.a.09 light chain 9606
140 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
141 5TF1 2 L O2-CC Fab Light Chain 9606
142 3TCL 2 B, L CH04 Light Chain Fab 9606
143 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
144 5F7E 2 L Fab light chain 9606
145 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
146 5FHA 2 L Antibody 114 Fab light chain 9606
147 5UMN 3 D, F Antibody C05, light chain 9606
148 4X7S 2 L Ig kappa chain C region residues 23-236 9606
149 1UM6 1 L antibody 21h3, L chain 10090
150 4X0K 2 B, L Fab fragment light chain 9606
151 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
152 5E8E 1 A IGA FAB LIGHT CHAIN 9606
153 6ELL 2 B, L fAB light chain 9606
154 2HFF 1 A, L CB2 Fab, light chain 9606
155 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
156 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
157 5GGS 2 B, D light chain 9606
158 5I1L 1 A, L FAB LIGHT CHAIN 9606
159 5GGV 1 L light chain 9606
160 3L5X 1 L H2L6 LIGHT CHAIN 9606
161 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
162 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
163 2R8S 2 L Fab light chain 10090
164 4HKZ 1 A Trastuzumab light chain 9606
165 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
166 3SO3 2 B A11 FAB light chain 9606
167 3IDG 1 A 2F5 Fab light chain 9606
168 3OAU 2 L Fab 2G12, light chain 9606
169 4WY7 2 L Fab 4E10Light chain 9606
170 4ZYK 2 B, L AM14 light chain 9606
171 5E94 1 A, C Antibody Fab fragment light chain 10090
172 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
173 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
174 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
175 4HIE 1 A Fab 023.102 9606
176 4LEX 1 L FAB HEAVY CHAIN 10090
177 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
178 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
179 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
180 5Y11 2 B MAb 4-5 light chain 9606
181 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
182 4KMT 1 L light chain O12/KAPPA Fab 9606
183 3NZH 1 L 5F6 LIGHT CHAIN 10090
184 1RHH 1 A, C Fab X5, light chain 9606
185 1TJG 1 L FAB 2F5 Light Chain 9606
186 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
187 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
188 4XTR 3 D, F Antibody Light chain 32630
189 1RZ7 1 L Fab 48d light chain 9606
190 1RZG 2 B, D Fab 412d heavy chain 9606
191 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
192 3PGF 3 L SAB Light Chain 9606
193 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
194 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
195 4YHL 2 L aDabi-Fab2b light chain 9606
196 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
197 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
198 2QQN 3 L Antibody light chain 9606
199 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
200 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
201 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
202 4YHM 2 L aDabi-Fab2b light chain 9606
203 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
204 3X3F 2 L Light chain of KMTR2 9606
205 2CMR 3 L D5 9606
206 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
207 5CZX 3 D, L 20358 Fab light chain 9606
208 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
209 3GRW 2 L Fab light chain 9606
210 6B3K 2 L Light chain of Fab BL3-6 10090
211 6C6Z 3 D, L Antibody CDC2-C2 light chain 9606
212 5I1D 1 A, L FAB LIGHT CHAIN 9606
213 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
214 6AYZ 2 C, D Fab Light Chain 9606
215 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
216 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
217 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
218 5DRX 2 B, L CLL240 BCR light chain 9606
219 4HIX 2 L Humanized 3D6 Fab light chain 10090
220 4LKC 1 A Fab fragment of PCSK9 antibody 9606
221 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
222 4KZD 2 L BL3-6 Fab antibody, light chain 10090
223 4HCR 2 L, N PF-547659 light chain 9606
224 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
225 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
226 4HIH 1 A, C Fab 023.102 9606
227 4YHK 2 L aDabi-Fab2a light chain 9606
228 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
229 3DRQ 1 A 2F5 Fab' light chain 9606
230 5IES 2 L VRC01cHuGL2 Fab light chain 9606
231 4UV7 3 L GC1118A 9606
232 5TKJ 2 B, E, H, K vFP1.01 chimeric mouse antibody light chain 10090
233 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
234 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
235 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
236 3D0V 1 A 2F5 Fab heavy chain 9606
237 3S34 1 L 1121B Fab light chain 10090
238 6AZX 2 B, D 663 antibody, light chain 9606
239 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
240 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
241 5E2T 1 L AT8 LIGHT CHAIN 10090
242 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
243 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
244 6EMJ 2 B, L fAb light chain 9606
245 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
246 2AJ3 1 A, C, E Fab m18, Light Chain 9606
247 3IDI 1 A 2F5 Fab light chain 9606
248 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
249 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
250 4NRX 3 B, E, L m66 Light Chain 9606
251 3O2D 1 L ibalizumab light chain 10090
252 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
253 5O14 3 D, L Fab 1A12 Light Chain 9606
254 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
255 5V7R 1 L CBTAU-7.1 Fab light chain 9606
256 6B5O 2 L CIS43 Fab Light chain 9606
257 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
258 2R0L 1 L antibody light chain 32630
259 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
260 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
261 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
262 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
263 5NBI 2 L Design of antibodies 562
264 3Q1S 1 L Z13e1 Fab light chain 9606
265 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
266 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
267 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
268 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
269 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
270 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
271 3KR3 3 L antibody-Fab (light chain) 9606
272 5DK3 1 A, F Light Chain 9606
273 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
274 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
275 4YHN 2 B, L aDabi-Fab3 light chain 9606
276 5GGU 2 B, L light chain 9606
277 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
278 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
279 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
280 4D9Q 2 D, L Anti-Factor D, light chain 9606
281 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
282 5KW9 3 L IgA Light chain 9606
283 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
284 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
285 5DRW 2 B CLL183 BCR antibody light chain 9606
286 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
287 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
288 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
289 5MVZ 2 B, L Fab 4AB007 L-chain 9606
290 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
291 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
292 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
293 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
294 2FX9 1 L, M Fab 4E10 Light Chain 9606
295 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
296 6AXL 1 B, C Fab317 light chains 9606
297 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
298 1TZG 1 L, M Fab 4E10 light chain 9606
299 3W9D 2 B, D Antibody Fab light chain 9606
300 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
301 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
302 3BN9 2 C, E E2 Fab Light Chain 9606
303 4HWE 2 L Fab light chain light chain 9606
304 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
305 5TZ2 2 L C47B222 Fab Light Chain 9606
306 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
307 4OGX 3 L DX-2930 LIGHT CHAIN 9606
308 3W9E 3 B Antibody Fab light chain 9606
309 5TFS 2 L 02-K Fab Light chain 9606
310 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
311 5E2U 1 L AT8 LIGHT CHAIN 10090
312 1OM3 1 L, M FAB 2G12, light chain light chain 9606
313 4KZE 2 L BL3-6 Fab antibody, light chain 10090
314 5WT9 2 L Light Chain of Nivolumab 9606
315 4HIJ 1 A, C Fab 023.102 light chain 9606
316 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
317 4XVU 3 D, F, J, L Antibody light chain 32630
318 5B71 1 A, C SKY59 Fab light chain 9606
319 6BF4 3 C, L VRC-PG05 Fab light chain 9606
320 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
321 3EYF 1 A, C 8f9 Fab 9606
322 3NAB 1 L Fab15 Mut6 light chain 9606
323 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
324 3IDN 1 A 2F5 Fab light chain 9606
325 5I1C 1 L FAB LIGHT CHAIN 9606
326 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
327 5WNA 2 D, L mAb 3D3 Fab light chain 9606
328 1RZ8 1 A, C Fab 17b light chain 9606
329 4WV1 3 A, D Fab light chain 9606
330 6ANP 1 A, L CAT192 Fab Light chain 9606
331 5EII 2 B, L Fab Light Chain 9606
332 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
333 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
334 4FNL 2 L, M Antibody C05, Light Chain 9606
335 4UB0 2 L IgG1, light chain 9606
336 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
337 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
338 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
339 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
340 5I1H 1 L FAB LIGHT CHAIN 9606
341 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
342 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
343 5I1J 1 L FAB LIGHT CHAIN 9606
344 3IDX 3 L Fab b13 light chain 9606
345 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
346 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
347 3IDJ 1 A 2F5 Fab light chain 9606
348 3IDM 1 A 2F5 Fab light chain 9606
349 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
350 6AO0 1 L CAT192 Fab Light chain 9606
351 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
352 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
353 4K94 1 L Fab19 heavy chain 9606
354 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
355 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
356 6B5L 2 L CIS43 Fab Light Chain 9606
357 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
358 3D0L 1 A 2F5 heavy chain 9606
359 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
360 5XAJ 2 B, L FabHM14c10 light chain 9606
361 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
362 5VEB 2 B, L anti-CDH6 Fab light chain 9606
363 5VZX 2 I, L Crenezumab Fab light chain 9606
364 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
365 3X3G 2 L Light chain of KMTR2 9606
366 5WAW 1 L fAb Light Chain 9606
367 5E08 2 L Fab Light Chain 9606
368 6AZ2 3 E, F Fab Light Chain 9606
369 2P8L 1 A nmAb 2F5, light chain 9606
370 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
371 5IBT 2 L UCA Light Chain 9606
372 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
373 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
374 1A4K 1 A, L ANTIBODY FAB FAB 10090
375 5MO9 2 L AB20 Fab light chain 10090
376 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
377 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
378 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
379 4NGH 1 L FAB LIGHT CHAIN 9606
380 4EDW 2 L tanezumab Fab light chain 9606
381 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
382 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
383 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
384 4NM4 1 L, M Antibody CR8043, Light Chain 9606
385 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
386 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
387 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
388 4D9R 2 D, L Fab light chain 9606
389 3U7W 2 L Light chain, Ig kappa chain C region 9606
390 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
391 4G7V 2 L fragment antibody light chain 9606
392 5W06 2 L M1587 FAB LIGHT CHAIN 10090
393 4HFW 1 A, L 6-26 Fab Light chain 9606
394 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
395 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
396 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
397 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
398 5JO4 2 B D80 Fab Light Chain 9606
399 5JO4 4 D G6 Fab Light Chain 9606
400 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
401 3INU 2 L, N KZ52 antibody fragment light chain 9606
402 5EU7 3 C, D FAB light chain 9606
403 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
404 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
405 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
406 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
407 5X8M 3 C durvalumab light chain 9606
408 6AMJ 1 A, L CAT192 Fab light chain 9606
409 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
410 4HII 1 A, C Fab 023.102 light chain 9606
411 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
412 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
413 4DN3 1 L CNTO888 LIGHT CHAIN 9606
414 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
415 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
416 5WNB 2 L, M mAb 3D3 Fab light chain 9606
417 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
418 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
419 3EYV 1 A, L hu3S193 Fab, light chain 10090
420 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
421 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
422 3PP3 2 K, L GA101 Fab light chain 10090
423 5IJK 3 C, D 1E03 Fab fragment light chain 9606
424 3BDY 2 L Fab Fragment -Light Chain 9606
425 5I8E 2 B, D VRC34.01 Fab light chain 9606
426 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
427 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
428 5UIX 2 L DH576 Fab light chain 9606
429 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
430 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
431 4HWB 3 L Fab light chain 9606
432 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
433 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
434 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
435 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
436 2HFG 1 L CB3s Fab light chain (kappa) 9606
437 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
438 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
439 4JQI 3 L Fab30 light chain 10090
440 6B0H 3 A, C 1262 antibody, light chain 9606
441 3SKJ 1 L, M Antibody, light chain 9606
442 3U30 2 B, E Light chain Fab 9606
443 6B0A 2 L 1269 antibody, light chain 9606
444 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
445 3U0T 1 A, C ponezumab LC Fab 9606
446 5HYS 2 B, D, F, L Uncharacterized protein 9606
447 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
448 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
449 5I15 1 L FAB LIGHT CHAIN 9606
450 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
451 5I1E 1 L FAB LIGHT CHAIN 9606
452 2NYY 2 C CR1 monoclonal antibody light chain 9606
453 2GCY 1 A huC25 fab fragment light chain 10090
454 4JLR 2 B, L Motavizumab Fab light chain 9606
455 2QQK 3 L Antibody Light Chain 9606
456 4J1U 1 A, C, E antibody 93F3 Light chain 10090
457 2PW2 1 A 2F5 Fab' heavy chain 9606
458 5N4G 2 L LIGHT CHAIN 9606
459 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
460 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
461 5SX5 1 K, L Panitumumab Fab Light Chain 9606
462 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
463 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
464 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
465 2PW1 1 A 2F5 Fab fragment heavy chain 9606
466 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
467 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
468 5BK2 3 D, L sAB Light Chain 9606
469 1TZH 2 A, L Fab YADS1 Light Chain 10090
470 6CMI 2 C m102.3 light chain 9606
471 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
472 4JZJ 3 B, L Fab Light Chain 10090
473 5BMF 2 L Fab fragment light chain 9606
474 5BO1 3 L, M Fab light chain 9606
475 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
476 4M6O 1 L CNTO7309 light chain 9606
477 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
478 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
479 5LSP 3 L, T 107_A07 Fab light chain 9606
480 4DVR 2 L Fab 48d Light chain 9606
481 3EYQ 1 C M2J5 Fab 9606
482 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
483 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
484 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
485 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
486 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
487 4XXD 1 A, D Fab Light Chain 9606
488 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
489 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
490 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
491 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
492 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
493 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
494 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
495 3DVG 1 A Human IgG1 fab fragment light chain 9606
496 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
497 2AGJ 1 L Yvo Fab, Light Chain 9606
498 4JKP 3 L Light chain of antibody 45-46M2 9606
499 3EYO 1 A, C 8f9 Fab 9606
500 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
501 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
502 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
503 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
504 4DN4 1 L CNTO888 LIGHT CHAIN 9606
505 5TRP 2 L DH272 Fab light chain 9606
506 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
507 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
508 2FJG 2 A, L Fab light chain 9606
509 4DKF 3 L, M FAb2 Light Chain 9606
510 5TLK 1 A, E M2177 LIGHT CHAIN 10090
511 5TLK 3 C, G H2191 LIGHT CHAIN 10090
512 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
513 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
514 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
515 3EFD 1 L FabL 10090
516 4LF3 1 A, D Fab heavy chain 10090
517 5K59 4 F, L Fab light chain 9606
518 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
519 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
520 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
521 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
522 4LEO 2 B RG7116 Fab light chain 10090
523 4G7Y 2 L Fragment antibody light chain 9606
524 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
525 4PY8 4 J antibody 3.1 light chain Fab 9606
526 3SDY 4 L Antibody CR8020, Light Chain 9606
527 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
528 3IXT 1 B, L Motavizumab Fab light chain 10090
529 6FAX 1 L Lob 7.4 light chain 9606
530 2P8M 1 A nmAb 2F5, light chain 9606
531 4NP4 3 L, M bezlotoxumab light chain 9606
532 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
533 4XCE 1 B, D, L 4E10 Fab light chain 9606
534 5I1I 1 L FAB LIGHT CHAIN 9606
535 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
536 4ERS 1 L Fab light chain 9606
537 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
538 4MWF 2 B, L Fab AR3C light chain 9606
539 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
540 3SQO 3 L J16 Light chain 9606
541 4K3J 4 L Onartuzumab Fab light chain 10090
542 4PS4 1 L M1295 LIGHT CHAIN 9606
543 5GGT 3 L IGK@ protein 9606
544 3HI1 2 A, L F105 Light Chain 9606
545 4PY7 2 B, J antibody 3.1 light chain Fab 9606
546 6AL5 2 L B43 LIGHT CHAIN 9606
547 4K8R 3 C Fab1, light chain 9606
548 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
549 5VOB 7 L Fab 8I21 light chain 9606
550 6CMG 2 B m102.3 light chain 9606
551 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
552 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
553 1TZI 1 A Fab YADS2 Light Chain 10090
554 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
555 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
556 4X7T 2 B, L Omalizumab-Fab Light chain 9606
557 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
558 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
559 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
560 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
561 5XMH 2 C, L YES8c light chain 9606
562 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
563 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
564 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
565 5I1G 1 L FAB LIGHT CHAIN 9606
566 2QQL 3 L Antibody Light Chain 9606
567 2P8P 1 A nmAb 2F5, light chain 9606
568 4XCC 1 L 4E10 Fab light chain 9606
569 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
570 5SX4 1 I, L Panitumumab Fab Light Chain 9606
571 3WD5 2 L Adalimumab Light Chain 9606
572 4NHC 1 L FAB LIGHT CHAIN 9606
573 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
574 5GZO 3 D, L Antibody light chain 9606
575 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
576 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
577 5GMQ 3 C MCA1 light chain 9606
578 3U46 2 B, L CH02 Light chain Fab 9606
579 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
580 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
581 4HFU 4 L Fab 8M2 light chain 9606
582 5TRU 1 L, l Ipilimumab Fab light chain 9606
583 4FP8 3 L, M, N, O Antibody C05, light chain 9606
584 4YPG 1 A, L Sifalimumab light chain 9606
585 3BE1 3 L Fab Fragment-Light Chain 9606
586 2FJH 2 A, L Fab fragment light chain 9606
587 5XEZ 3 D, L Antibody, mAb1, light chain 9606
588 4K9E 1 L light chain 10090
589 3U4B 2 L CH02 Light chain 9606
590 3P0V 1 L, M Fab DL11 light chain 9606
591 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
592 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
593 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
594 5VIG 2 B, L Fab light chain 9606
595 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
596 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
597 4KVN 3 L Human IgG Light Chain 9606
598 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
599 5VYF 1 A, L Antibody light chain 10090
600 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
601 5WUX 2 B, D, L light 9606
602 3OB0 1 K, L Fab 2G12, light chain Fab 9606
603 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
604 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
605 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
606 5DUM 2 L 65C6 Light Chain 9606
607 4I18 1 B, L antibody light chain Fab 10090
608 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
609 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
610 3IDY 3 C, L Fab b13 light chain 9606
611 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
612 3IVK 1 B, L Fab light chain man 10090
613 3KYK 2 L Light Chain Li33 IgG1 9606
614 5TGB 2 B, L 02-CB Fab Light Chain 9606
615 5I19 1 L FAB LIGHT CHAIN 9606
616 5TH9 1 L, M, N GS-5745 Fab light chain 9986
617 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
618 4IRZ 2 L Fab Natalizumab light chain 9606
619 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
620 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
621 5FEC 2 B, L germline 3BNC60 light chain 9606
622 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
623 5ESV 2 B, D, L CH03 Light Chain 9606
624 2R56 2 L, M IgE Fab Fragment, light chain 9606
625 1ZA6 1 A, C, E, G IGG Light chain 9606
626 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
627 4ZS6 1 D, L fab Light Chain 9606
628 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
629 6APB 3 L ADI-14359 Fab Light Chain 9606
630 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
631 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
632 5K9K 2 B, L 56.a.09 Light chain 9606
633 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
634 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
635 5W4L 6 C, E Antibody N12-i3 light chain 9606
636 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
637 5NB5 1 L, M design of antibodies 562
638 5CZV 3 L Fab 20350 light chain 9606
639 5XF1 3 D, L Antibody mAb1 Light chain 9606
640 4P59 3 L MOR09825 Fab fragment light chain 9606
641 5XXY 2 L light chain of atezolizumab fab 9606
642 5CJO 3 L FAB light chain 10090
643 4LMQ 3 I, L Stromal cell-derived factor 1 9606
644 3N85 2 L Fab37 Light Chain 9606
645 6AMM 1 L CAT192 Fab Light chain 9606
646 3G6J 3 E, G Fab light chain 9606
647 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
648 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
649 6B9J 3 B, L Fab vv138 Light chain 9606
650 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
651 4DKE 3 L, M FAb1.1 Light Chain 9606
652 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
653 3DRT 1 A 2F5 Fab' light chain 9606
654 5I17 1 A, L FAB LIGHT CHAIN 9606
655 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
656 5VIC 2 L Fab light chain 9606
657 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
658 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
659 4R8W 4 L Light chain of neutralizing antibody CT149 9606
660 5TPN 3 L hRSV0 light chain 9606
661 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
662 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
663 4NRY 1 B, L m66 Heavy Chain 9606
664 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
665 3S37 1 L 1121B Fab light chain 10090
666 5TZT 1 B, L Light Chain of Fab C47B161 9606
667 5XHF 1 A, C polypeptide (L chain) 10090
668 5VL7 4 L Fab33 light chain 9606
669 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
670 5JXE 2 C, F Pembrolizumab Fab light chain 9606
671 5KZC 3 D, G, L VRC01 Fab light chain 9606
672 4JM2 3 C 17b Light chain Fab 9606
673 1S78 2 C, E Pertuzumab Fab light chain 10090
674 1OP5 1 K, L FAB 2G12, light chain light chain 9606
675 5BK0 1 A, C 663 Antibody, light chain 9606
676 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
677 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
678 5D1Z 1 A, H Y10 Light Chain 9606
679 5D1Z 3 C, E D4-10 Light Chain 9606
680 5GGR 2 B, L light chain 9606
681 5IBL 4 D, L 6639 Light Chain 9606
682 4XHJ 3 C, G Fab-RC light chain 9606
683 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
684 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
685 4N90 3 E, G, I Fab light chain 9606
686 5BK5 2 A, C, E, G 663 germline antibody, light chain 9606
687 5VGJ 3 L VRC38.01 Fab Light Chain 9606
688 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
689 6B0E 1 A 1260 antibody, light chain 9606
690 5D1Q 1 A D2-06 Light Chain 9606
691 5D1Q 4 D P5 Light Chain 9606
692 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
693 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
694 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
695 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
696 5XHV 3 L, Q S40 light chain 9606
697 4IOF 3 D, F Fab-bound IDE, light chain 10090
698 5FUO 3 L FAB LIGHT CHAIN 9606
699 4JHW 2 L D25 light chain 9606
700 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
701 3BQU 1 A 2F5 Fab' light chain 9606
702 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
703 4M1C 3 D, F Fab-bound IDE, light chain 9606
704 5UQY 3 C, G, K, O MR78 Fab light chain 9606
705 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
706 3ULV 2 L Fab15 light chain 9606
707 5UG0 3 C 2897 light chain 9606
708 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
709 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
710 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
711 3EGS 1 A 2F5 Fab' light chain 9606
712 5UOE 3 L, N, Q, T, W FAB light chain 9606
713 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
714 5D1X 1 A D4-30 Light Chain 9606
715 5D1X 4 D P5 Light Chain 9606
716 5JW3 4 L MEDI8852 light chain 9606
717 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
718 5UMI 2 B, L PA50 Fab Light chain 9606
719 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
720 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
721 3S36 1 L 1121B light chain 10090
722 3DRO 1 A 2F5 Fab light chain 9606
723 5CWS 1 A, G sAB-158 Fab Light Chain 9606
724 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
725 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
726 2R0K 2 L antibody light chain of Fab58 9606
727 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
728 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
729 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
730 4G80 3 B, D, F, H fragment antibody light chain 9606
731 3JWO 3 L FAB 48D LIGHT CHAIN 9606
732 5CD5 3 D DRVIA7 Fab Light Chain 9606
733 3P11 2 L Fab DL11 light chain 9606
734 3F12 1 A, C M2J1 Fab 9606
735 3B2V 1 L IMC-11F8 FAB Light chain 9606
736 5IGX 3 L germline NIH45-46 light chain 9606
737 3ULU 2 L Fab15 light chain 9606
738 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
739 4XI5 3 C Fab-94 light chain 9606
740 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
741 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
742 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
743 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
744 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
745 5K9O 2 B, L 31.b.09 Light Fv 9606
746 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
747 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
748 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
749 5JW4 6 R MEDI8852 light chain 9606
750 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
751 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
752 5VOC 7 L Fab 8I21 light chain 9606
753 5J3D 2 B, D, L 14N4 light chain 9606
754 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
755 5ESZ 2 B, L CH04 Light Chain 9606
756 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
757 3EFF 1 A, C FAB 10090
758 3PJS 1 A, C FAB light chain 10090
759 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
760 4ZYP 5 E, G, I AM14 antibody light chain 9606
761 5DWU 4 L Fab - Light Chain 9606
762 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
763 5I8H 5 F, H VRC34.01 Fab light chain 9606
764 4RQS 2 C 17b Fab Light Chain 9606
765 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
766 4R4H 3 L Antibody 2.2c, Light chain 9606
767 5VOD 7 L Fab 9I6 light chain 9606
768 5FHC 5 L Antibody 114 Fab light chain 9606
769 4XMN 6 L Antibody 87 light chain 32630
770 4XMM 8 L Antibody 57 light chain 9606
771 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
772 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
773 6BF7 3 D, F Fab H11-E light chain 10090
774 6BF9 3 D, F Fab H11-E light chain 10090
775 6B7Z 3 D, F FAB H11 light chain 10090
776 6B70 3 D, F FAB H11-E light chain 10090
777 5VN3 1 L, N, O 17b Fab light chain 9606
778 5GZR 4 L, N Z23 Fab light chain 9606
779 5THR 4 J, K, L 17b Fab VL domain 9606
780 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
781 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
782 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
783 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
784 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
785 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
786 2ESG 1 L, M Immunoglobulin A1 light chain 9606
787 1R70 1 A, C Human IgA2(m1) Light Chain 9606
788 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606