Sequence Similarity Clusters for the Entities in PDB 1RZJ

Entity #1 | Chains: G
ENVELOPE GLYCOPROTEIN GP120 protein, length: 321 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 3 28688
95 % 11 15 4365 Flexibility: Medium
Max RMSD: 16.1, Avg RMSD: 5.5
PDBFlex
90 % 11 15 4410
70 % 66 183 133
50 % 66 183 162
40 % 66 183 174
30 % 66 186 190
Entity #2 | Chains: C
T-CELL SURFACE GLYCOPROTEIN CD4 protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 38 883
95 % 17 43 906 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.2
PDBFlex
90 % 17 43 940
70 % 17 43 963
50 % 17 43 1009
40 % 17 43 1024
30 % 17 43 1013
Entity #3 | Chains: L
ANTIBODY 17B, LIGHT CHAIN protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 21 1568
95 % 16 34 1111 Flexibility: Low
Max RMSD: 5.3, Avg RMSD: 1.1
PDBFlex
90 % 407 793 2
70 % 1322 2593 1
50 % 2713 5263 1
40 % 3101 5933 1
30 % 3800 7388 1
Entity #4 | Chains: H
ANTIBODY 17B, HEAVY CHAIN protein, length: 229 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 13 25 1264
95 % 13 25 1490 Flexibility: Low
Max RMSD: 3.9, Avg RMSD: 1.0
PDBFlex
90 % 13 25 1512
70 % 1315 2550 2
50 % 2714 5263 1
40 % 3102 5933 1
30 % 3801 7388 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 4XCF 1 L 4E10 Fab light chain 9606
4 5X08 2 L Fab 4E10 Light chain 9606
5 4XAW 1 L 4E10 Fab light chain 9606
6 5UCB 2 L Fab Light Chain 9606
7 2VXV 2 L HUMAN IGG ABT-325 9606
8 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
9 5I8C 2 B VRC34.01 Fab light chain 9606
10 5WK2 1 L M116 LIGHT CHAIN 9606
11 3PP4 2 L GA101 Fab light chain 10090
12 4PTU 1 A Antibody pn132p2C05, light chain 9606
13 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
14 4XC3 1 L 4E10 Fab light chain 9606
15 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
16 5VSI 2 L CH1/Ckappa Fab light chain 9606
17 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
18 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
19 4NWU 2 L APE1551 Ab Fab light chain 9606
20 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
21 5EWI 2 L VRC38.01 Light Chain 9606
22 5E2W 1 L AT8 LIGHT CHAIN 10090
23 5E2V 1 L AT8 LIGHT CHAIN 10090
24 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
25 6CA7 1 L PCT64_13C light chain 9606
26 5OB5 3 L fAb Light chain 9606
27 3QQ9 1 C, L 101F LIGHT CHAIN 10090
28 5I1K 1 L FAB LIGHT CHAIN 9606
29 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
30 5V7U 1 L CBTAU-22.1 Fab light chain 9606
31 5UEA 3 B, L Fab Light Chain 9606
32 5NMV 1 L Fab light chain 10088
33 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
34 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
35 3QRG 1 L Fab light chain 9606
36 3NCJ 1 L Fab15 Mut8 light chain 9606
37 5W05 1 L M59 FAB LIGHT CHAIN 10090
38 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
39 1UM5 1 L Antibody 21H3 L chain 10090
40 4NWT 1 L APE1531 Ab Fab light chain 9606
41 3NA9 1 L Fab15 light chain 9606
42 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
43 4LRI 1 A, B MSL-109 Light Chain 9606
44 4JN2 1 A, L anti dabigatran Fab 10090
45 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
46 5U6A 1 A Light Chain 9606
47 4HHA 1 A Fab KE5 Fab fragment KE5 9606
48 5UEK 3 L Fab 12E Light Chain 9606
49 3NAA 1 L Fab15 Mut5 light chain 9606
50 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
51 5IK3 2 B, D 1E03 Fab fragment light chain 9606
52 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
53 5U3O 2 L DH511.2_K3 Fab Light Chain 9606
54 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
55 5IT2 2 L light chain 9606
56 6BQB 1 L MGG4 Fab light chain 9606
57 4PUB 2 L DX-2930 LIGHT CHAIN 9606
58 6B14 2 L Light chain of Fab BL3-6S97N 10090
59 5VKD 3 L Fab light chain 9606
60 5XHG 1 A, C polypeptide(L) 562
61 3OAZ 2 K, L Fab 2G12, light chain 9606
62 4YGV 2 B, L aDabi-Fab2a light chain 9606
63 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
64 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
65 3EO0 1 A, C GC-1008 Fab Light Chain 10090
66 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
67 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
68 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
69 4JHA 2 L D25 light chain 9606
70 4PTT 1 A Antibody pn132p2C05, light chain 9606
71 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
72 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
73 4DGV 2 L HCV1 Light Chain 9606
74 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
75 3IU4 2 L chP3 Fab light chain 10090
76 3P0Y 3 L Fab DL11 light chain 9606
77 6ANA 3 L LL2 Fab Light Chain 10090
78 5IBU 1 B, L 6652 Light Chain 9606
79 6AOD 1 A FXIa Antibody FAB Light Chain 9606
80 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
81 6ELE 2 B, L fAB light chain 9606
82 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
83 3NAC 1 L Fab15 Mut7 light chain 9606
84 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
85 4YHO 2 L aDabi-Fab3 light chain 9606
86 4DGY 2 L HCV1 Light Chain 9606
87 3MXW 2 L 5E1 light chain 9606
88 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
89 3EO9 1 L Efalizumab Fab fragment, light chain 9606
90 5WUV 1 L light chain 9606
91 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
92 6B0G 1 C 1245 Antibody, Light Chain 9606
93 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
94 6D0X 2 B 1210 Antibody, light chain 9606
95 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
96 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
97 5TL5 1 L M2177 LIGHT CHAIN 10090
98 2FX7 1 L Fab 4E10 Light Chain 9606
99 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
100 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
101 5XKU 2 B HNIgGA6 light chain 9606
102 5I18 1 L FAB LIGHT CHAIN 9606
103 4JN1 2 L anti-dabigatran Fab1, light chain 10090
104 3SOB 1 L antibody light chain 9606
105 6B5M 2 L CIS43 Fab Light chain 9606
106 4ZFO 2 L J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
107 4ZFO 4 B J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
108 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
109 5DR5 2 L AbD09097 Fab light chain 9606
110 4KQ3 1 L CNTO3186 light chain Fab 9606
111 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
112 4I77 2 L Lebrikizumab light chain Fab 9606
113 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
114 4HJG 1 A Trastuzumab light chain 9606
115 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
116 3FN0 1 L Fab Z13e1 light chain 9606
117 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
118 4YHI 2 B, L aDabi-Fab2a light chain 9606
119 5NYX 2 L, N, P LIGHT CHAIN fab light chain 9606
120 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
121 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
122 6ELJ 2 B, L fAB light chain 9606
123 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
124 4MAU 1 L C2244 light chain SEE REMARK 999 10090
125 1OP3 1 K, L FAB 2G12, light chain light chain 9606
126 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
127 4LKX 2 B Fab fragment light chain 9606
128 5JW5 2 B, L MEDI8852 Light chain 9606
129 6DCV 1 A, L Light chain of CBTAU27.1 Fab 9606
130 3QWO 1 B, L motavizumab light chain 10090
131 4IOI 1 A Trastuzumab light chain 9606
132 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
133 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
134 5VAG 2 B Light chain of antibody m826 9606
135 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
136 5I16 1 A, L FAB LIGHT CHAIN 9606
137 5F9O 3 L CH235.09 Light chain 9606
138 1UM4 1 L Antibody 21H3 L chain 10090
139 4RBP 1 K, L Fab 2G12 light chain 9606
140 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
141 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
142 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
143 6DCW 1 L Light chain of CBTAU27.1 Fab 9606
144 5GGQ 1 L nivolumab light chain 9606
145 6B5N 2 L CIS43 Fab Light chain 9606
146 3OAY 1 K, L Fab 2G12, light chain 9606
147 6AND 3 L Pinatuzumab Fab light chain 9606
148 5K9J 2 L 56.a.09 light chain 9606
149 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
150 5TF1 2 L O2-CC Fab Light Chain 9606
151 3TCL 2 B, L CH04 Light Chain Fab 9606
152 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
153 5F7E 2 L Fab light chain 9606
154 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
155 5FHA 2 L Antibody 114 Fab light chain 9606
156 5UMN 3 D, F Antibody C05, light chain 9606
157 4X7S 2 L Ig kappa chain C region residues 23-236 9606
158 1UM6 1 L antibody 21h3, L chain 10090
159 4X0K 2 B, L Fab fragment light chain 9606
160 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
161 5E8E 1 A IGA FAB LIGHT CHAIN 9606
162 6ELL 2 B, L fAB light chain 9606
163 2HFF 1 A, L CB2 Fab, light chain 9606
164 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
165 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
166 5GGS 2 B, D light chain 9606
167 5I1L 1 A, L FAB LIGHT CHAIN 9606
168 5GGV 1 L light chain 9606
169 3L5X 1 L H2L6 LIGHT CHAIN 9606
170 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
171 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
172 2R8S 2 L Fab light chain 10090
173 4HKZ 1 A Trastuzumab light chain 9606
174 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
175 3SO3 2 B A11 FAB light chain 9606
176 3OAU 2 L Fab 2G12, light chain 9606
177 5WEQ 1 A MR78 mutant light chain 9606
178 4WY7 2 L Fab 4E10Light chain 9606
179 4ZYK 2 B, L AM14 light chain 9606
180 6C9U 2 L Light chain of Fab 1B2 9606
181 5E94 1 A, C Antibody Fab fragment light chain 10090
182 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
183 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
184 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
185 4HIE 1 A Fab 023.102 9606
186 4LEX 1 L FAB HEAVY CHAIN 10090
187 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
188 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
189 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
190 5Y11 2 B MAb 4-5 light chain 9606
191 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
192 4KMT 1 L light chain O12/KAPPA Fab 9606
193 3NZH 1 L 5F6 LIGHT CHAIN 10090
194 1RHH 1 A, C Fab X5, light chain 9606
195 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
196 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
197 4XTR 3 D, F Antibody Light chain 32630
198 1RZ7 1 L Fab 48d light chain 9606
199 1RZG 2 B, D Fab 412d heavy chain 9606
200 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
201 3PGF 3 L SAB Light Chain 9606
202 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
203 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
204 4YHL 2 L aDabi-Fab2b light chain 9606
205 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
206 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
207 2QQN 3 L Antibody light chain 9606
208 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
209 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
210 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
211 4YHM 2 L aDabi-Fab2b light chain 9606
212 6H0E 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF dmCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
213 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
214 3X3F 2 L Light chain of KMTR2 9606
215 2CMR 3 L D5 9606
216 5ZV3 3 L Light chain (kappa) of antibody CBTAU28.1 9606
217 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
218 5CZX 3 D, L 20358 Fab light chain 9606
219 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
220 3GRW 2 L Fab light chain 9606
221 6B3K 2 L Light chain of Fab BL3-6 10090
222 6C6Z 3 D, L Antibody CDC2-C2 light chain 9606
223 5I1D 1 A, L FAB LIGHT CHAIN 9606
224 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
225 6AYZ 2 C, D Fab Light Chain 9606
226 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
227 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
228 6CDO 2 B vFP16.02 Fab light chain 10090
229 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
230 5DRX 2 B, L CLL240 BCR light chain 9606
231 4HIX 2 L Humanized 3D6 Fab light chain 10090
232 4LKC 1 A Fab fragment of PCSK9 antibody 9606
233 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
234 4KZD 2 L BL3-6 Fab antibody, light chain 10090
235 4HCR 2 L, N PF-547659 light chain 9606
236 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
237 4HIH 1 A, C Fab 023.102 9606
238 4YHK 2 L aDabi-Fab2a light chain 9606
239 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
240 5IES 2 L VRC01cHuGL2 Fab light chain 9606
241 4UV7 3 L GC1118A 9606
242 5TKJ 2 B, E, H, K vFP1.01 chimeric mouse antibody light chain 10090
243 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
244 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
245 3S34 1 L 1121B Fab light chain 10090
246 6AZX 2 B, D 663 antibody, light chain 9606
247 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
248 5E2T 1 L AT8 LIGHT CHAIN 10090
249 6EMJ 2 B, L fAb light chain 9606
250 5W1G 2 L CR1-07 Fab light chain 9606
251 6CNR 1 L Aducanumab light chain 9606
252 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
253 2AJ3 1 A, C, E Fab m18, Light Chain 9606
254 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
255 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
256 4NRX 3 B, E, L m66 Light Chain 9606
257 3O2D 1 L ibalizumab light chain 10090
258 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
259 5O14 3 D, L Fab 1A12 Light Chain 9606
260 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
261 5V7R 1 L CBTAU-7.1 Fab light chain 9606
262 6B5O 2 L CIS43 Fab Light chain 9606
263 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
264 2R0L 1 L antibody light chain 32630
265 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
266 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
267 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
268 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
269 3Q1S 1 L Z13e1 Fab light chain 9606
270 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
271 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
272 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
273 5VZ1 1 A, C Apo Antibody Fab Light Chain 9606
274 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
275 5OD8 2 B B2 Fab fragment - Light chain 9606
276 3KR3 3 L antibody-Fab (light chain) 9606
277 5DK3 1 A, F Light Chain 9606
278 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
279 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
280 4YHN 2 B, L aDabi-Fab3 light chain 9606
281 5GGU 2 B, L light chain 9606
282 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
283 4D9Q 2 D, L Anti-Factor D, light chain 9606
284 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
285 5KW9 3 L IgA Light chain 9606
286 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
287 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
288 5W2B 2 L Fab Light Chain 9606
289 5DRW 2 B CLL183 BCR antibody light chain 9606
290 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
291 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
292 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
293 5MVZ 2 B, L Fab 4AB007 L-chain 9606
294 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
295 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
296 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
297 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
298 2FX9 1 L, M Fab 4E10 Light Chain 9606
299 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
300 6AXL 1 B, C Fab317 light chains 9606
301 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
302 1TZG 1 L, M Fab 4E10 light chain 9606
303 3W9D 2 B, D Antibody Fab light chain 9606
304 6CO3 1 L Fab light chain 9606
305 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
306 3BN9 2 C, E E2 Fab Light Chain 9606
307 6EYN 1 A, C, L 8D6 Fab light chain 8D6 Fab light chain 9606
308 4HWE 2 L Fab light chain light chain 9606
309 5TZ2 2 L C47B222 Fab Light Chain 9606
310 6CDM 2 B, E vFP7.04 light chain 10090
311 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
312 4OGX 3 L DX-2930 LIGHT CHAIN 9606
313 3W9E 3 B Antibody Fab light chain 9606
314 5TFS 2 L 02-K Fab Light chain 9606
315 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
316 5E2U 1 L AT8 LIGHT CHAIN 10090
317 1OM3 1 L, M FAB 2G12, light chain light chain 9606
318 4KZE 2 L BL3-6 Fab antibody, light chain 10090
319 5WT9 2 L Light Chain of Nivolumab 9606
320 4HIJ 1 A, C Fab 023.102 light chain 9606
321 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
322 4XVU 3 D, F, J, L Antibody light chain 32630
323 5B71 1 A, C SKY59 Fab light chain 9606
324 6BF4 3 C, L VRC-PG05 Fab light chain 9606
325 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
326 3EYF 1 A, C 8f9 Fab 9606
327 3NAB 1 L Fab15 Mut6 light chain 9606
328 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
329 5I1C 1 L FAB LIGHT CHAIN 9606
330 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
331 5WNA 2 D, L mAb 3D3 Fab light chain 9606
332 1RZ8 1 A, C Fab 17b light chain 9606
333 4WV1 3 A, D Fab light chain 9606
334 6ANP 1 A, L CAT192 Fab Light chain 9606
335 5EII 2 B, L Fab Light Chain 9606
336 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
337 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
338 4FNL 2 L, M Antibody C05, Light Chain 9606
339 4UB0 2 L IgG1, light chain 9606
340 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
341 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
342 5I1H 1 L FAB LIGHT CHAIN 9606
343 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
344 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
345 5I1J 1 L FAB LIGHT CHAIN 9606
346 3IDX 3 L Fab b13 light chain 9606
347 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
348 6AO0 1 L CAT192 Fab Light chain 9606
349 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
350 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
351 4K94 1 L Fab19 heavy chain 9606
352 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
353 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
354 6B5L 2 L CIS43 Fab Light Chain 9606
355 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
356 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
357 5XAJ 2 B, L FabHM14c10 light chain 9606
358 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
359 5VEB 2 B, L anti-CDH6 Fab light chain 9606
360 5VZX 2 I, L Crenezumab Fab light chain 9606
361 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
362 3X3G 2 L Light chain of KMTR2 9606
363 5WAW 1 L fAb Light Chain 9606
364 5E08 2 L Fab Light Chain 9606
365 6AZ2 3 E, F Fab Light Chain 9606
366 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
367 5IBT 2 L UCA Light Chain 9606
368 6CA6 1 A, L PCT64_35S light chain 9606
369 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
370 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
371 1A4K 1 A, L ANTIBODY FAB FAB 10090
372 5MO9 2 L AB20 Fab light chain 10090
373 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
374 5XRQ 2 B, L Fab H3v-47 light chain 9606
375 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
376 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
377 4NGH 1 L FAB LIGHT CHAIN 9606
378 5WB9 3 L N60P23 Fab light chain 9606
379 4EDW 2 L tanezumab Fab light chain 9606
380 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
381 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
382 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
383 4NM4 1 L, M Antibody CR8043, Light Chain 9606
384 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
385 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
386 4D9R 2 D, L Fab light chain 9606
387 3U7W 2 L Light chain, Ig kappa chain C region 9606
388 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
389 4G7V 2 L fragment antibody light chain 9606
390 5W06 2 L M1587 FAB LIGHT CHAIN 10090
391 4HFW 1 A, L 6-26 Fab Light chain 9606
392 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
393 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
394 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
395 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
396 5JO4 2 B D80 Fab Light Chain 9606
397 5JO4 4 D G6 Fab Light Chain 9606
398 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
399 3INU 2 L, N KZ52 antibody fragment light chain 9606
400 5EU7 3 C, D FAB light chain 9606
401 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
402 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
403 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
404 6CDP 2 B vFP20.01 Fab light chain 10090
405 5X8M 3 C durvalumab light chain 9606
406 6AMJ 1 A, L CAT192 Fab light chain 9606
407 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
408 4HII 1 A, C Fab 023.102 light chain 9606
409 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
410 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
411 4DN3 1 L CNTO888 LIGHT CHAIN 9606
412 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
413 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
414 5WNB 2 L, M mAb 3D3 Fab light chain 9606
415 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
416 3EYV 1 A, L hu3S193 Fab, light chain 10090
417 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
418 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
419 3PP3 2 K, L GA101 Fab light chain 10090
420 5IJK 3 C, D 1E03 Fab fragment light chain 9606
421 3BDY 2 L Fab Fragment -Light Chain 9606
422 5I8E 2 B, D VRC34.01 Fab light chain 9606
423 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
424 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
425 5UIX 2 L DH576 Fab light chain 9606
426 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
427 4HWB 3 L Fab light chain 9606
428 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
429 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
430 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
431 2HFG 1 L CB3s Fab light chain (kappa) 9606
432 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
433 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
434 4JQI 3 L Fab30 light chain 10090
435 6B0H 3 A, C 1262 antibody, light chain 9606
436 3SKJ 1 L, M Antibody, light chain 9606
437 3U30 2 B, E Light chain Fab 9606
438 6B0A 2 L 1269 antibody, light chain 9606
439 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
440 3U0T 1 A, C ponezumab LC Fab 9606
441 5HYS 2 B, D, F, L Uncharacterized protein 9606
442 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
443 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
444 5I15 1 L FAB LIGHT CHAIN 9606
445 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
446 5I1E 1 L FAB LIGHT CHAIN 9606
447 2NYY 2 C CR1 monoclonal antibody light chain 9606
448 2GCY 1 A huC25 fab fragment light chain 10090
449 4JLR 2 B, L Motavizumab Fab light chain 9606
450 2QQK 3 L Antibody Light Chain 9606
451 4J1U 1 A, C, E antibody 93F3 Light chain 10090
452 5N4G 2 L LIGHT CHAIN 9606
453 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
454 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
455 5SX5 1 K, L Panitumumab Fab Light Chain 9606
456 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
457 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
458 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
459 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
460 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
461 5BK2 3 D, L sAB Light Chain 9606
462 1TZH 2 A, L Fab YADS1 Light Chain 10090
463 5O1R 3 L, M Uncharacterized protein 9606
464 6CMI 2 C m102.3 light chain 9606
465 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
466 4JZJ 3 B, L Fab Light Chain 10090
467 5BMF 2 L Fab fragment light chain 9606
468 5BO1 3 L, M Fab light chain 9606
469 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
470 4M6O 1 L CNTO7309 light chain 9606
471 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
472 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
473 5LSP 3 L, T 107_A07 Fab light chain 9606
474 4DVR 2 L Fab 48d Light chain 9606
475 3EYQ 1 C M2J5 Fab 9606
476 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
477 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
478 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
479 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
480 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
481 4XXD 1 A, D Fab Light Chain 9606
482 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
483 6H06 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF HCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
484 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
485 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
486 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
487 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
488 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
489 3DVG 1 A Human IgG1 fab fragment light chain 9606
490 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
491 2AGJ 1 L Yvo Fab, Light Chain 9606
492 4JKP 3 L Light chain of antibody 45-46M2 9606
493 3EYO 1 A, C 8f9 Fab 9606
494 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
495 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
496 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
497 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
498 4DN4 1 L CNTO888 LIGHT CHAIN 9606
499 5TRP 2 L DH272 Fab light chain 9606
500 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
501 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
502 2FJG 2 A, L Fab light chain 9606
503 4DKF 3 L, M FAb2 Light Chain 9606
504 5TLK 1 A, E M2177 LIGHT CHAIN 10090
505 5TLK 3 C, G H2191 LIGHT CHAIN 10090
506 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
507 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
508 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
509 3EFD 1 L FabL 10090
510 4LF3 1 A, D Fab heavy chain 10090
511 5K59 4 F, L Fab light chain 9606
512 5WI9 2 E, L 39F7 Fab light chain 9606
513 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
514 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
515 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
516 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
517 4LEO 2 B RG7116 Fab light chain 10090
518 4G7Y 2 L Fragment antibody light chain 9606
519 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
520 4PY8 4 J antibody 3.1 light chain Fab 9606
521 3SDY 4 L Antibody CR8020, Light Chain 9606
522 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
523 3IXT 1 B, L Motavizumab Fab light chain 10090
524 6FAX 1 L Lob 7.4 light chain 9606
525 4NP4 3 L, M bezlotoxumab light chain 9606
526 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
527 4XCE 1 B, D, L 4E10 Fab light chain 9606
528 5I1I 1 L FAB LIGHT CHAIN 9606
529 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
530 4ERS 1 L Fab light chain 9606
531 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
532 4MWF 2 B, L Fab AR3C light chain 9606
533 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
534 3SQO 3 L J16 Light chain 9606
535 4K3J 4 L Onartuzumab Fab light chain 10090
536 6CYF 2 C, E, L, T IgG1 antibody, kappa light chain 9606
537 4PS4 1 L M1295 LIGHT CHAIN 9606
538 5GGT 3 L IGK@ protein 9606
539 3HI1 2 A, L F105 Light Chain 9606
540 4PY7 2 B, J antibody 3.1 light chain Fab 9606
541 6AL5 2 L B43 LIGHT CHAIN 9606
542 4K8R 3 C Fab1, light chain 9606
543 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
544 5VOB 7 L Fab 8I21 light chain 9606
545 6CMG 2 B m102.3 light chain 9606
546 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
547 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
548 1TZI 1 A Fab YADS2 Light Chain 10090
549 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
550 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
551 4X7T 2 B, L Omalizumab-Fab Light chain 9606
552 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
553 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
554 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
555 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
556 5XMH 2 C, L YES8c light chain 9606
557 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
558 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
559 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
560 5I1G 1 L FAB LIGHT CHAIN 9606
561 2QQL 3 L Antibody Light Chain 9606
562 4XCC 1 L 4E10 Fab light chain 9606
563 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
564 5SX4 1 I, L Panitumumab Fab Light Chain 9606
565 3WD5 2 L Adalimumab Light Chain 9606
566 4NHC 1 L FAB LIGHT CHAIN 9606
567 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
568 5GZO 3 D, L Antibody light chain 9606
569 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
570 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
571 5GMQ 3 C MCA1 light chain 9606
572 6CA9 1 A, C PCT64_LMCA Fab light chain 9606
573 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
574 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
575 4HFU 4 L Fab 8M2 light chain 9606
576 5TRU 1 L, l Ipilimumab Fab light chain 9606
577 4FP8 3 L, M, N, O Antibody C05, light chain 9606
578 4YPG 1 A, L Sifalimumab light chain 9606
579 3BE1 3 L Fab Fragment-Light Chain 9606
580 2FJH 2 A, L Fab fragment light chain 9606
581 5XEZ 3 D, L Antibody, mAb1, light chain 9606
582 4K9E 1 L light chain 10090
583 3P0V 1 L, M Fab DL11 light chain 9606
584 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
585 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
586 5VIG 2 B, L Fab light chain 9606
587 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
588 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
589 4KVN 3 L Human IgG Light Chain 9606
590 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
591 5VYF 1 A, L Antibody light chain 10090
592 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
593 5WUX 2 B, D, L light 9606
594 3OB0 1 K, L Fab 2G12, light chain Fab 9606
595 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
596 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
597 6GK7 1 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-27.1(S31Y,T100I) FAB ANTIBODY FRAGMENT 9606
598 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
599 5DUM 2 L 65C6 Light Chain 9606
600 4I18 1 B, L antibody light chain Fab 10090
601 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
602 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
603 3IDY 3 C, L Fab b13 light chain 9606
604 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
605 3IVK 1 B, L Fab light chain man 10090
606 3KYK 2 L Light Chain Li33 IgG1 9606
607 5TGB 2 B, L 02-CB Fab Light Chain 9606
608 5I19 1 L FAB LIGHT CHAIN 9606
609 5TH9 1 L, M, N GS-5745 Fab light chain 9986
610 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
611 4IRZ 2 L Fab Natalizumab light chain 9606
612 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
613 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
614 6GK8 2 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-28.1(S32R;E35K) FAB ANTIBODY FRAGMENT 9606
615 5FEC 2 B, L germline 3BNC60 light chain 9606
616 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
617 2R56 2 L, M IgE Fab Fragment, light chain 9606
618 1ZA6 1 A, C, E, G IGG Light chain 9606
619 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
620 4ZS6 1 D, L fab Light Chain 9606
621 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
622 6APB 3 L ADI-14359 Fab Light Chain 9606
623 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
624 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
625 5K9K 2 B, L 56.a.09 Light chain 9606
626 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
627 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
628 5W4L 6 C, E Antibody N12-i3 light chain 9606
629 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
630 6D01 2 B, D, F, H 1210 Antibody, Light chain 9606
631 5CZV 3 L Fab 20350 light chain 9606
632 5XF1 3 D, L Antibody mAb1 Light chain 9606
633 4P59 3 L MOR09825 Fab fragment light chain 9606
634 5XXY 2 L light chain of atezolizumab fab 9606
635 5CJO 3 L FAB light chain 10090
636 4LMQ 3 I, L Stromal cell-derived factor 1 9606
637 3N85 2 L Fab37 Light Chain 9606
638 6AMM 1 L CAT192 Fab Light chain 9606
639 3G6J 3 E, G Fab light chain 9606
640 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
641 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
642 6B9J 3 B, L Fab vv138 Light chain 9606
643 5O4G 2 A MF3958 FAB light chain 9606
644 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
645 4DKE 3 L, M FAb1.1 Light Chain 9606
646 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
647 5I17 1 A, L FAB LIGHT CHAIN 9606
648 5VIC 2 L Fab light chain 9606
649 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
650 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
651 4R8W 4 L Light chain of neutralizing antibody CT149 9606
652 5TPN 3 L hRSV0 light chain 9606
653 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
654 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
655 4NRY 1 B, L m66 Heavy Chain 9606
656 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
657 3S37 1 L 1121B Fab light chain 10090
658 5TZT 1 B, L Light Chain of Fab C47B161 9606
659 5XHF 1 A, C polypeptide (L chain) 10090
660 5VL7 4 L Fab33 light chain 9606
661 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
662 5JXE 2 C, F Pembrolizumab Fab light chain 9606
663 5KZC 3 D, G, L VRC01 Fab light chain 9606
664 5W42 4 L Fab H3v-47 light chain 9606
665 4JM2 3 C 17b Light chain Fab 9606
666 1S78 2 C, E Pertuzumab Fab light chain 10090
667 1OP5 1 K, L FAB 2G12, light chain light chain 9606
668 5BK0 1 A, C 663 Antibody, light chain 9606
669 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
670 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
671 5D1Z 1 A, H Y10 Light Chain 9606
672 5D1Z 3 C, E D4-10 Light Chain 9606
673 5GGR 2 B, L light chain 9606
674 5IBL 4 D, L 6639 Light Chain 9606
675 4XHJ 3 C, G Fab-RC light chain 9606
676 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
677 5O4O 1 A MF3178 FAB light chain 9606
678 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
679 4N90 3 E, G, I Fab light chain 9606
680 5BK5 2 A, C, E, G 663 germline antibody, light chain 9606
681 5VGJ 3 L VRC38.01 Fab Light Chain 9606
682 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
683 6B0E 1 A 1260 antibody, light chain 9606
684 5D1Q 1 A D2-06 Light Chain 9606
685 5D1Q 4 D P5 Light Chain 9606
686 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
687 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
688 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
689 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
690 5XHV 3 L, Q S40 light chain 9606
691 4IOF 3 D, F Fab-bound IDE, light chain 10090
692 5FUO 3 L FAB LIGHT CHAIN 9606
693 5FEH 1 A, C, E PCT64_26 Fab light chain 9606
694 4JHW 2 L D25 light chain 9606
695 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
696 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
697 4M1C 3 D, F Fab-bound IDE, light chain 9606
698 5UQY 3 C, G, K, O MR78 Fab light chain 9606
699 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
700 3ULV 2 L Fab15 light chain 9606
701 5UG0 3 C 2897 light chain 9606
702 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
703 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
704 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
705 5UOE 3 L, N, Q, T, W FAB light chain 9606
706 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
707 5D1X 1 A D4-30 Light Chain 9606
708 5D1X 4 D P5 Light Chain 9606
709 5JW3 4 L MEDI8852 light chain 9606
710 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
711 5UMI 2 B, L PA50 Fab Light chain 9606
712 6D11 2 B, D 1450 Antibody, Light chain 9606
713 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
714 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
715 3S36 1 L 1121B light chain 10090
716 5CWS 1 A, G sAB-158 Fab Light Chain 9606
717 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
718 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
719 2R0K 2 L antibody light chain of Fab58 9606
720 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
721 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
722 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
723 4G80 3 B, D, F, H fragment antibody light chain 9606
724 3JWO 3 L FAB 48D LIGHT CHAIN 9606
725 5CD5 3 D DRVIA7 Fab Light Chain 9606
726 3P11 2 L Fab DL11 light chain 9606
727 6EYO 3 L, M 8D6 Fab light chain 8D6 Fab light chain 9606
728 3F12 1 A, C M2J1 Fab 9606
729 3B2V 1 L IMC-11F8 FAB Light chain 9606
730 5IGX 3 L germline NIH45-46 light chain 9606
731 3ULU 2 L Fab15 light chain 9606
732 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
733 6ATT 3 L Antibody 39S Fab light chain Antibody, light chain 9606
734 5W1K 1 A, F, K, S CR1-28 Fab light chain 9606
735 5W1K 3 C, H, M, N CR1-10 Fab light chain 9606
736 4XI5 3 C Fab-94 light chain 9606
737 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
738 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
739 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
740 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
741 5W1M 1 A, C, E, G CR1-07 Fab light chain 9606
742 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
743 5K9O 2 B, L 31.b.09 Light Fv 9606
744 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
745 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
746 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
747 5JW4 6 R MEDI8852 light chain 9606
748 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
749 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
750 5VOC 7 L Fab 8I21 light chain 9606
751 5J3D 2 B, D, L 14N4 light chain 9606
752 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
753 5ESZ 2 B, L CH04 Light Chain 9606
754 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
755 3EFF 1 A, C FAB 10090
756 3PJS 1 A, C FAB light chain 10090
757 5O7P 2 A MF3178 FAB light chain 9606
758 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
759 4ZYP 5 E, G, I AM14 antibody light chain 9606
760 6B3M 4 D, J, N, P, U, W 70-1F02 Fab Light Chain 9606
761 5DWU 4 L Fab - Light Chain 9606
762 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
763 5I8H 5 F, H VRC34.01 Fab light chain 9606
764 4RQS 2 C 17b Fab Light Chain 9606
765 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
766 4R4H 3 L Antibody 2.2c, Light chain 9606
767 5VOD 7 L Fab 9I6 light chain 9606
768 5FHC 5 L Antibody 114 Fab light chain 9606
769 4XMN 6 L Antibody 87 light chain 32630
770 4XMM 8 L Antibody 57 light chain 9606
771 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
772 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
773 6DJP 6 F 68 light chain Fab 10090
774 6CUF 2 4, L, l vFP1.01 Light chain 10090
775 6CMO 5 L Fab light chain 32644
776 6CDE 2 4, L, l vFP20.01 Light chain 9606
777 6CDI 8 4, L, l vFP16.02 Light Chain 9606
778 6BF7 3 D, F Fab H11-E light chain 10090
779 6BF9 3 D, F Fab H11-E light chain 10090
780 6B7Z 3 D, F FAB H11 light chain 10090
781 6B70 3 D, F FAB H11-E light chain 10090
782 5VN3 1 L, N, O 17b Fab light chain 9606
783 5GZR 4 L, N Z23 Fab light chain 9606
784 5THR 4 J, K, L 17b Fab VL domain 9606
785 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
786 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
787 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
788 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
789 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
790 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
791 2ESG 1 L, M Immunoglobulin A1 light chain 9606
792 1R70 1 A, C Human IgA2(m1) Light Chain 9606
793 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606