Sequence Similarity Clusters for the Entities in PDB 1RZ7

Entity #1 | Chains: L
Fab 48d light chain protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 4 15714
95 % 38 192 62 Flexibility: Low
Max RMSD: 6.5, Avg RMSD: 2.2
PDBFlex
90 % 178 762 2
70 % 562 2416 1
50 % 1160 4892 1
40 % 1160 4892 1
30 % 1281 5759 1
Entity #2 | Chains: H
Fab 48d heavy chain protein, length: 219 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 15650
95 % 1 5 9448
90 % 1 5 9349
70 % 561 2366 2
50 % 1161 4892 1
40 % 1161 4892 1
30 % 1282 5759 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 4XCF 1 L 4E10 Fab light chain 9606
4 5X08 2 L Fab 4E10 Light chain 9606
5 4XAW 1 L 4E10 Fab light chain 9606
6 5UCB 2 L Fab Light Chain 9606
7 2VXV 2 L HUMAN IGG ABT-325 9606
8 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
9 5I8C 2 B VRC34.01 Fab light chain 9606
10 5WK2 1 L M116 LIGHT CHAIN 9606
11 3PP4 2 L GA101 Fab light chain 10090
12 4PTU 1 A Antibody pn132p2C05, light chain 9606
13 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
14 4XC3 1 L 4E10 Fab light chain 9606
15 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
16 5VSI 2 L CH1/Ckappa Fab light chain 9606
17 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
18 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
19 4NWU 2 L APE1551 Ab Fab light chain 9606
20 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
21 5EWI 2 L VRC38.01 Light Chain 9606
22 5E2W 1 L AT8 LIGHT CHAIN 10090
23 5E2V 1 L AT8 LIGHT CHAIN 10090
24 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
25 5OB5 3 L fAb Light chain 9606
26 3QQ9 1 C, L 101F LIGHT CHAIN 10090
27 5I1K 1 L FAB LIGHT CHAIN 9606
28 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
29 5V7U 1 L CBTAU-22.1 Fab light chain 9606
30 5UEA 3 B, L Fab Light Chain 9606
31 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
32 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
33 3QRG 1 L Fab light chain 9606
34 3NCJ 1 L Fab15 Mut8 light chain 9606
35 5W05 1 L M59 FAB LIGHT CHAIN 10090
36 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
37 1UM5 1 L Antibody 21H3 L chain 10090
38 4NWT 1 L APE1531 Ab Fab light chain 9606
39 3NA9 1 L Fab15 light chain 9606
40 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
41 4LRI 1 A, B MSL-109 Light Chain 9606
42 4JN2 1 A, L anti dabigatran Fab 10090
43 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
44 4HHA 1 A Fab KE5 Fab fragment KE5 9606
45 5UEK 3 L Fab 12E Light Chain 9606
46 3NAA 1 L Fab15 Mut5 light chain 9606
47 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
48 5IK3 2 B, D 1E03 Fab fragment light chain 9606
49 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
50 5IT2 2 L light chain 9606
51 4PUB 2 L DX-2930 LIGHT CHAIN 9606
52 6B14 2 L Light chain of Fab BL3-6S97N 10090
53 5XHG 1 A, C polypeptide(L) 562
54 3OAZ 2 K, L Fab 2G12, light chain 9606
55 4YGV 2 B, L aDabi-Fab2a light chain 9606
56 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
57 3EO0 1 A, C GC-1008 Fab Light Chain 10090
58 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
59 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
60 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
61 4JHA 2 L D25 light chain 9606
62 4PTT 1 A Antibody pn132p2C05, light chain 9606
63 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
64 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
65 4DGV 2 L HCV1 Light Chain 9606
66 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
67 3IU4 2 L chP3 Fab light chain 10090
68 3P0Y 3 L Fab DL11 light chain 9606
69 6ANA 3 L LL2 Fab Light Chain 10090
70 5IBU 1 B, L 6652 Light Chain 9606
71 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
72 6ELE 2 B, L fAB light chain 9606
73 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
74 3NAC 1 L Fab15 Mut7 light chain 9606
75 4YHO 2 L aDabi-Fab3 light chain 9606
76 4DGY 2 L HCV1 Light Chain 9606
77 3MXW 2 L 5E1 light chain 9606
78 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
79 3EO9 1 L Efalizumab Fab fragment, light chain 9606
80 5WUV 1 L light chain 9606
81 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
82 6B0G 1 C 1245 Antibody, Light Chain 9606
83 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
84 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
85 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
86 5TL5 1 L M2177 LIGHT CHAIN 10090
87 2FX7 1 L Fab 4E10 Light Chain 9606
88 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
89 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
90 5XKU 2 B HNIgGA6 light chain 9606
91 5I18 1 L FAB LIGHT CHAIN 9606
92 4JN1 2 L anti-dabigatran Fab1, light chain 10090
93 3SOB 1 L antibody light chain 9606
94 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
95 5DR5 2 L AbD09097 Fab light chain 9606
96 4KQ3 1 L CNTO3186 light chain Fab 9606
97 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
98 4I77 2 L Lebrikizumab light chain Fab 9606
99 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
100 4HJG 1 A Trastuzumab light chain 9606
101 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
102 3FN0 1 L Fab Z13e1 light chain 9606
103 4YHI 2 B, L aDabi-Fab2a light chain 9606
104 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
105 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
106 6ELJ 2 B, L fAB light chain 9606
107 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
108 4MAU 1 L C2244 light chain SEE REMARK 999 10090
109 1OP3 1 K, L FAB 2G12, light chain light chain 9606
110 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
111 4LKX 2 B Fab fragment light chain 9606
112 5JW5 2 B, L MEDI8852 Light chain 9606
113 3QWO 1 B, L motavizumab light chain 10090
114 4IOI 1 A Trastuzumab light chain 9606
115 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
116 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
117 5VAG 2 B Light chain of antibody m826 9606
118 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
119 5I16 1 A, L FAB LIGHT CHAIN 9606
120 5F9O 3 L CH235.09 Light chain 9606
121 1UM4 1 L Antibody 21H3 L chain 10090
122 4RBP 1 K, L Fab 2G12 light chain 9606
123 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
124 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
125 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
126 5GGQ 1 L nivolumab light chain 9606
127 3OAY 1 K, L Fab 2G12, light chain 9606
128 6AND 3 L Pinatuzumab Fab light chain 9606
129 5K9J 2 L 56.a.09 light chain 9606
130 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
131 5TF1 2 L O2-CC Fab Light Chain 9606
132 3TCL 2 B, L CH04 Light Chain Fab 9606
133 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
134 5F7E 2 L Fab light chain 9606
135 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
136 5FHA 2 L Antibody 114 Fab light chain 9606
137 5UMN 3 D, F Antibody C05, light chain 9606
138 4X7S 2 L Ig kappa chain C region residues 23-236 9606
139 1UM6 1 L antibody 21h3, L chain 10090
140 4X0K 2 B, L Fab fragment light chain 9606
141 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
142 5E8E 1 A IGA FAB LIGHT CHAIN 9606
143 6ELL 2 B, L fAB light chain 9606
144 2HFF 1 A, L CB2 Fab, light chain 9606
145 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
146 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
147 5GGS 2 B, D light chain 9606
148 5I1L 1 A, L FAB LIGHT CHAIN 9606
149 5GGV 1 L light chain 9606
150 3L5X 1 L H2L6 LIGHT CHAIN 9606
151 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
152 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
153 2R8S 2 L Fab light chain 10090
154 4HKZ 1 A Trastuzumab light chain 9606
155 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
156 3SO3 2 B A11 FAB light chain 9606
157 3IDG 1 A 2F5 Fab light chain 9606
158 3OAU 2 L Fab 2G12, light chain 9606
159 4WY7 2 L Fab 4E10Light chain 9606
160 4ZYK 2 B, L AM14 light chain 9606
161 5E94 1 A, C Antibody Fab fragment light chain 10090
162 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
163 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
164 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
165 4HIE 1 A Fab 023.102 9606
166 4LEX 1 L FAB HEAVY CHAIN 10090
167 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
168 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
169 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
170 5Y11 2 B MAb 4-5 light chain 9606
171 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
172 4KMT 1 L light chain O12/KAPPA Fab 9606
173 3NZH 1 L 5F6 LIGHT CHAIN 10090
174 1RHH 1 A, C Fab X5, light chain 9606
175 1TJG 1 L FAB 2F5 Light Chain 9606
176 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
177 4XTR 3 D, F Antibody Light chain 32630
178 1RZ7 1 L Fab 48d light chain 9606
179 1RZG 2 B, D Fab 412d heavy chain 9606
180 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
181 3PGF 3 L SAB Light Chain 9606
182 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
183 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
184 4YHL 2 L aDabi-Fab2b light chain 9606
185 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
186 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
187 2QQN 3 L Antibody light chain 9606
188 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
189 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
190 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
191 4YHM 2 L aDabi-Fab2b light chain 9606
192 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
193 3X3F 2 L Light chain of KMTR2 9606
194 2CMR 3 L D5 9606
195 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
196 5CZX 3 D, L 20358 Fab light chain 9606
197 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
198 3GRW 2 L Fab light chain 9606
199 6B3K 2 L Light chain of Fab BL3-6 10090
200 6C6Z 3 D, L Antibody CDC2-C2 light chain 9606
201 5I1D 1 A, L FAB LIGHT CHAIN 9606
202 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
203 6AYZ 2 C, D Fab Light Chain 9606
204 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
205 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
206 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
207 5DRX 2 B, L CLL240 BCR light chain 9606
208 4HIX 2 L Humanized 3D6 Fab light chain 10090
209 4LKC 1 A Fab fragment of PCSK9 antibody 9606
210 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
211 4KZD 2 L BL3-6 Fab antibody, light chain 10090
212 4HCR 2 L, N PF-547659 light chain 9606
213 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
214 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
215 4HIH 1 A, C Fab 023.102 9606
216 4YHK 2 L aDabi-Fab2a light chain 9606
217 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
218 3DRQ 1 A 2F5 Fab' light chain 9606
219 5IES 2 L VRC01cHuGL2 Fab light chain 9606
220 4UV7 3 L GC1118A 9606
221 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
222 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
223 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
224 3D0V 1 A 2F5 Fab heavy chain 9606
225 3S34 1 L 1121B Fab light chain 10090
226 6AZX 2 B, D 663 antibody, light chain 9606
227 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
228 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
229 5E2T 1 L AT8 LIGHT CHAIN 10090
230 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
231 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
232 6EMJ 2 B, L fAb light chain 9606
233 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
234 2AJ3 1 A, C, E Fab m18, Light Chain 9606
235 3IDI 1 A 2F5 Fab light chain 9606
236 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
237 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
238 4NRX 3 B, E, L m66 Light Chain 9606
239 3O2D 1 L ibalizumab light chain 10090
240 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
241 5O14 3 D, L Fab 1A12 Light Chain 9606
242 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
243 5V7R 1 L CBTAU-7.1 Fab light chain 9606
244 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
245 2R0L 1 L antibody light chain 32630
246 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
247 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
248 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
249 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
250 5NBI 2 L Design of antibodies 562
251 3Q1S 1 L Z13e1 Fab light chain 9606
252 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
253 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
254 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
255 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
256 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
257 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
258 3KR3 3 L antibody-Fab (light chain) 9606
259 5DK3 1 A, F Light Chain 9606
260 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
261 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
262 4YHN 2 B, L aDabi-Fab3 light chain 9606
263 5GGU 2 B, L light chain 9606
264 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
265 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
266 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
267 4D9Q 2 D, L Anti-Factor D, light chain 9606
268 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
269 5KW9 3 L IgA Light chain 9606
270 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
271 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
272 5DRW 2 B CLL183 BCR antibody light chain 9606
273 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
274 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
275 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
276 5MVZ 2 B, L Fab 4AB007 L-chain 9606
277 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
278 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
279 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
280 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
281 2FX9 1 L, M Fab 4E10 Light Chain 9606
282 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
283 6AXL 1 B, C Fab317 light chains 9606
284 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
285 1TZG 1 L, M Fab 4E10 light chain 9606
286 3W9D 2 B, D Antibody Fab light chain 9606
287 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
288 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
289 3BN9 2 C, E E2 Fab Light Chain 9606
290 4HWE 2 L Fab light chain light chain 9606
291 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
292 5TZ2 2 L C47B222 Fab Light Chain 9606
293 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
294 4OGX 3 L DX-2930 LIGHT CHAIN 9606
295 3W9E 3 B Antibody Fab light chain 9606
296 5TFS 2 L 02-K Fab Light chain 9606
297 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
298 5E2U 1 L AT8 LIGHT CHAIN 10090
299 1OM3 1 L, M FAB 2G12, light chain light chain 9606
300 4KZE 2 L BL3-6 Fab antibody, light chain 10090
301 5WT9 2 L Light Chain of Nivolumab 9606
302 4HIJ 1 A, C Fab 023.102 light chain 9606
303 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
304 4XVU 3 D, F, J, L Antibody light chain 32630
305 5B71 1 A, C SKY59 Fab light chain 9606
306 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
307 3EYF 1 A, C 8f9 Fab 9606
308 3NAB 1 L Fab15 Mut6 light chain 9606
309 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
310 3IDN 1 A 2F5 Fab light chain 9606
311 5I1C 1 L FAB LIGHT CHAIN 9606
312 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
313 1RZ8 1 A, C Fab 17b light chain 9606
314 4WV1 3 A, D Fab light chain 9606
315 6ANP 1 A, L CAT192 Fab Light chain 9606
316 5EII 2 B, L Fab Light Chain 9606
317 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
318 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
319 4FNL 2 L, M Antibody C05, Light Chain 9606
320 4UB0 2 L IgG1, light chain 9606
321 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
322 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
323 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
324 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
325 5I1H 1 L FAB LIGHT CHAIN 9606
326 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
327 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
328 5I1J 1 L FAB LIGHT CHAIN 9606
329 3IDX 3 L Fab b13 light chain 9606
330 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
331 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
332 3IDJ 1 A 2F5 Fab light chain 9606
333 3IDM 1 A 2F5 Fab light chain 9606
334 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
335 6AO0 1 L CAT192 Fab Light chain 9606
336 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
337 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
338 4K94 1 L Fab19 heavy chain 9606
339 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
340 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
341 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
342 3D0L 1 A 2F5 heavy chain 9606
343 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
344 5XAJ 2 B, L FabHM14c10 light chain 9606
345 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
346 5VEB 2 B, L anti-CDH6 Fab light chain 9606
347 5VZX 2 I, L Crenezumab Fab light chain 9606
348 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
349 3X3G 2 L Light chain of KMTR2 9606
350 5WAW 1 L fAb Light Chain 9606
351 5E08 2 L Fab Light Chain 9606
352 6AZ2 3 E, F Fab Light Chain 9606
353 2P8L 1 A nmAb 2F5, light chain 9606
354 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
355 5IBT 2 L UCA Light Chain 9606
356 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
357 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
358 1A4K 1 A, L ANTIBODY FAB FAB 10090
359 5MO9 2 L AB20 Fab light chain 10090
360 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
361 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
362 4NGH 1 L FAB LIGHT CHAIN 9606
363 4EDW 2 L tanezumab Fab light chain 9606
364 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
365 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
366 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
367 4NM4 1 L, M Antibody CR8043, Light Chain 9606
368 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
369 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
370 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
371 4D9R 2 D, L Fab light chain 9606
372 3U7W 2 L Light chain, Ig kappa chain C region 9606
373 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
374 4G7V 2 L fragment antibody light chain 9606
375 5W06 2 L M1587 FAB LIGHT CHAIN 10090
376 4HFW 1 A, L 6-26 Fab Light chain 9606
377 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
378 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
379 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
380 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
381 5JO4 2 B D80 Fab Light Chain 9606
382 5JO4 4 D G6 Fab Light Chain 9606
383 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
384 3INU 2 L, N KZ52 antibody fragment light chain 9606
385 5EU7 3 C, D FAB light chain 9606
386 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
387 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
388 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
389 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
390 5X8M 3 C durvalumab light chain 9606
391 6AMJ 1 A, L CAT192 Fab light chain 9606
392 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
393 4HII 1 A, C Fab 023.102 light chain 9606
394 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
395 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
396 4DN3 1 L CNTO888 LIGHT CHAIN 9606
397 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
398 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
399 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
400 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
401 3EYV 1 A, L hu3S193 Fab, light chain 10090
402 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
403 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
404 3PP3 2 K, L GA101 Fab light chain 10090
405 5IJK 3 C, D 1E03 Fab fragment light chain 9606
406 3BDY 2 L Fab Fragment -Light Chain 9606
407 5I8E 2 B, D VRC34.01 Fab light chain 9606
408 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
409 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
410 5UIX 2 L DH576 Fab light chain 9606
411 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
412 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
413 4HWB 3 L Fab light chain 9606
414 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
415 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
416 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
417 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
418 2HFG 1 L CB3s Fab light chain (kappa) 9606
419 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
420 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
421 4JQI 3 L Fab30 light chain 10090
422 6B0H 3 A, C 1262 antibody, light chain 9606
423 3SKJ 1 L, M Antibody, light chain 9606
424 3U30 2 B, E Light chain Fab 9606
425 6B0A 2 L 1269 antibody, light chain 9606
426 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
427 3U0T 1 A, C ponezumab LC Fab 9606
428 5HYS 2 B, D, F, L Uncharacterized protein 9606
429 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
430 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
431 5I15 1 L FAB LIGHT CHAIN 9606
432 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
433 5I1E 1 L FAB LIGHT CHAIN 9606
434 2NYY 2 C CR1 monoclonal antibody light chain 9606
435 2GCY 1 A huC25 fab fragment light chain 10090
436 4JLR 2 B, L Motavizumab Fab light chain 9606
437 2QQK 3 L Antibody Light Chain 9606
438 4J1U 1 A, C, E antibody 93F3 Light chain 10090
439 2PW2 1 A 2F5 Fab' heavy chain 9606
440 5N4G 2 L LIGHT CHAIN 9606
441 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
442 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
443 5SX5 1 K, L Panitumumab Fab Light Chain 9606
444 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
445 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
446 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
447 2PW1 1 A 2F5 Fab fragment heavy chain 9606
448 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
449 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
450 5BK2 3 D, L sAB Light Chain 9606
451 1TZH 2 A, L Fab YADS1 Light Chain 10090
452 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
453 4JZJ 3 B, L Fab Light Chain 10090
454 5BMF 2 L Fab fragment light chain 9606
455 5BO1 3 L, M Fab light chain 9606
456 4M6O 1 L CNTO7309 light chain 9606
457 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
458 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
459 5LSP 3 L, T 107_A07 Fab light chain 9606
460 4DVR 2 L Fab 48d Light chain 9606
461 3EYQ 1 C M2J5 Fab 9606
462 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
463 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
464 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
465 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
466 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
467 4XXD 1 A, D Fab Light Chain 9606
468 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
469 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
470 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
471 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
472 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
473 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
474 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
475 3DVG 1 A Human IgG1 fab fragment light chain 9606
476 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
477 2AGJ 1 L Yvo Fab, Light Chain 9606
478 4JKP 3 L Light chain of antibody 45-46M2 9606
479 3EYO 1 A, C 8f9 Fab 9606
480 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
481 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
482 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
483 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
484 4DN4 1 L CNTO888 LIGHT CHAIN 9606
485 5TRP 2 L DH272 Fab light chain 9606
486 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
487 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
488 2FJG 2 A, L Fab light chain 9606
489 4DKF 3 L, M FAb2 Light Chain 9606
490 5TLK 1 A, E M2177 LIGHT CHAIN 10090
491 5TLK 3 C, G H2191 LIGHT CHAIN 10090
492 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
493 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
494 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
495 3EFD 1 L FabL 10090
496 4LF3 1 A, D Fab heavy chain 10090
497 5K59 4 F, L Fab light chain 9606
498 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
499 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
500 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
501 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
502 4LEO 2 B RG7116 Fab light chain 10090
503 4G7Y 2 L Fragment antibody light chain 9606
504 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
505 4PY8 4 J antibody 3.1 light chain Fab 9606
506 3SDY 4 L Antibody CR8020, Light Chain 9606
507 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
508 3IXT 1 B, L Motavizumab Fab light chain 10090
509 6FAX 1 L Lob 7.4 light chain 9606
510 2P8M 1 A nmAb 2F5, light chain 9606
511 4NP4 3 L, M bezlotoxumab light chain 9606
512 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
513 4XCE 1 B, D, L 4E10 Fab light chain 9606
514 5I1I 1 L FAB LIGHT CHAIN 9606
515 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
516 4ERS 1 L Fab light chain 9606
517 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
518 4MWF 2 B, L Fab AR3C light chain 9606
519 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
520 3SQO 3 L J16 Light chain 9606
521 4K3J 4 L Onartuzumab Fab light chain 10090
522 4PS4 1 L M1295 LIGHT CHAIN 9606
523 5GGT 3 L IGK@ protein 9606
524 3HI1 2 A, L F105 Light Chain 9606
525 4PY7 2 B, J antibody 3.1 light chain Fab 9606
526 4K8R 3 C Fab1, light chain 9606
527 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
528 5VOB 7 L Fab 8I21 light chain 9606
529 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
530 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
531 1TZI 1 A Fab YADS2 Light Chain 10090
532 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
533 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
534 4X7T 2 B, L Omalizumab-Fab Light chain 9606
535 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
536 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
537 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
538 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
539 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
540 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
541 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
542 5I1G 1 L FAB LIGHT CHAIN 9606
543 2QQL 3 L Antibody Light Chain 9606
544 2P8P 1 A nmAb 2F5, light chain 9606
545 4XCC 1 L 4E10 Fab light chain 9606
546 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
547 5SX4 1 I, L Panitumumab Fab Light Chain 9606
548 3WD5 2 L Adalimumab Light Chain 9606
549 4NHC 1 L FAB LIGHT CHAIN 9606
550 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
551 5GZO 3 D, L Antibody light chain 9606
552 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
553 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
554 5GMQ 3 C MCA1 light chain 9606
555 3U46 2 B, L CH02 Light chain Fab 9606
556 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
557 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
558 4HFU 4 L Fab 8M2 light chain 9606
559 5TRU 1 L, l Ipilimumab Fab light chain 9606
560 4FP8 3 L, M, N, O Antibody C05, light chain 9606
561 4YPG 1 A, L Sifalimumab light chain 9606
562 3BE1 3 L Fab Fragment-Light Chain 9606
563 2FJH 2 A, L Fab fragment light chain 9606
564 5XEZ 3 D, L Antibody, mAb1, light chain 9606
565 4K9E 1 L light chain 10090
566 3U4B 2 L CH02 Light chain 9606
567 3P0V 1 L, M Fab DL11 light chain 9606
568 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
569 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
570 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
571 5VIG 2 B, L Fab light chain 9606
572 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
573 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
574 4KVN 3 L Human IgG Light Chain 9606
575 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
576 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
577 5WUX 2 B, D, L light 9606
578 3OB0 1 K, L Fab 2G12, light chain Fab 9606
579 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
580 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
581 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
582 5DUM 2 L 65C6 Light Chain 9606
583 4I18 1 B, L antibody light chain Fab 10090
584 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
585 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
586 3IDY 3 C, L Fab b13 light chain 9606
587 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
588 3IVK 1 B, L Fab light chain man 10090
589 3KYK 2 L Light Chain Li33 IgG1 9606
590 5TGB 2 B, L 02-CB Fab Light Chain 9606
591 5I19 1 L FAB LIGHT CHAIN 9606
592 5TH9 1 L, M, N GS-5745 Fab light chain 9986
593 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
594 4IRZ 2 L Fab Natalizumab light chain 9606
595 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
596 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
597 5FEC 2 B, L germline 3BNC60 light chain 9606
598 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
599 5ESV 2 B, D, L CH03 Light Chain 9606
600 2R56 2 L, M IgE Fab Fragment, light chain 9606
601 1ZA6 1 A, C, E, G IGG Light chain 9606
602 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
603 4ZS6 1 D, L fab Light Chain 9606
604 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
605 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
606 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
607 5K9K 2 B, L 56.a.09 Light chain 9606
608 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
609 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
610 5W4L 6 C, E Antibody N12-i3 light chain 9606
611 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
612 5NB5 1 L, M design of antibodies 562
613 5CZV 3 L Fab 20350 light chain 9606
614 5XF1 3 D, L Antibody mAb1 Light chain 9606
615 4P59 3 L MOR09825 Fab fragment light chain 9606
616 5XXY 2 L light chain of atezolizumab fab 9606
617 5CJO 3 L FAB light chain 10090
618 4LMQ 3 I, L Stromal cell-derived factor 1 9606
619 3N85 2 L Fab37 Light Chain 9606
620 6AMM 1 L CAT192 Fab Light chain 9606
621 3G6J 3 E, G Fab light chain 9606
622 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
623 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
624 6B9J 3 B, L Fab vv138 Light chain 9606
625 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
626 4DKE 3 L, M FAb1.1 Light Chain 9606
627 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
628 3DRT 1 A 2F5 Fab' light chain 9606
629 5I17 1 A, L FAB LIGHT CHAIN 9606
630 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
631 5VIC 2 L Fab light chain 9606
632 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
633 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
634 4R8W 4 L Light chain of neutralizing antibody CT149 9606
635 5TPN 3 L hRSV0 light chain 9606
636 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
637 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
638 4NRY 1 B, L m66 Heavy Chain 9606
639 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
640 3S37 1 L 1121B Fab light chain 10090
641 5TZT 1 B, L Light Chain of Fab C47B161 9606
642 5XHF 1 A, C polypeptide (L chain) 10090
643 5VL7 4 L Fab33 light chain 9606
644 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
645 5JXE 2 C, F Pembrolizumab Fab light chain 9606
646 5KZC 3 D, G, L VRC01 Fab light chain 9606
647 4JM2 3 C 17b Light chain Fab 9606
648 1S78 2 C, E Pertuzumab Fab light chain 10090
649 1OP5 1 K, L FAB 2G12, light chain light chain 9606
650 5BK0 1 A, C 663 Antibody, light chain 9606
651 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
652 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
653 5D1Z 1 A, H Y10 Light Chain 9606
654 5D1Z 3 C, E D4-10 Light Chain 9606
655 5GGR 2 B, L light chain 9606
656 5IBL 4 D, L 6639 Light Chain 9606
657 4XHJ 3 C, G Fab-RC light chain 9606
658 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
659 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
660 4N90 3 E, G, I Fab light chain 9606
661 5BK5 2 A, C, E, G 663 germline antibody, light chain 9606
662 5VGJ 3 L VRC38.01 Fab Light Chain 9606
663 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
664 6B0E 1 A 1260 antibody, light chain 9606
665 5D1Q 1 A D2-06 Light Chain 9606
666 5D1Q 4 D P5 Light Chain 9606
667 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
668 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
669 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
670 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
671 5XHV 3 L, Q S40 light chain 9606
672 4IOF 3 D, F Fab-bound IDE, light chain 10090
673 5FUO 3 L FAB LIGHT CHAIN 9606
674 4JHW 2 L D25 light chain 9606
675 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
676 3BQU 1 A 2F5 Fab' light chain 9606
677 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
678 4M1C 3 D, F Fab-bound IDE, light chain 9606
679 5UQY 3 C, G, K, O MR78 Fab light chain 9606
680 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
681 3ULV 2 L Fab15 light chain 9606
682 5UG0 3 C 2897 light chain 9606
683 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
684 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
685 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
686 3EGS 1 A 2F5 Fab' light chain 9606
687 5UOE 3 L, N, Q, T, W FAB light chain 9606
688 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
689 5D1X 1 A D4-30 Light Chain 9606
690 5D1X 4 D P5 Light Chain 9606
691 5JW3 4 L MEDI8852 light chain 9606
692 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
693 5UMI 2 B, L PA50 Fab Light chain 9606
694 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
695 3S36 1 L 1121B light chain 10090
696 3DRO 1 A 2F5 Fab light chain 9606
697 5CWS 1 A, G sAB-158 Fab Light Chain 9606
698 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
699 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
700 2R0K 2 L antibody light chain of Fab58 9606
701 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
702 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
703 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
704 4G80 3 B, D, F, H fragment antibody light chain 9606
705 3JWO 3 L FAB 48D LIGHT CHAIN 9606
706 5CD5 3 D DRVIA7 Fab Light Chain 9606
707 3P11 2 L Fab DL11 light chain 9606
708 3F12 1 A, C M2J1 Fab 9606
709 3B2V 1 L IMC-11F8 FAB Light chain 9606
710 5IGX 3 L germline NIH45-46 light chain 9606
711 3ULU 2 L Fab15 light chain 9606
712 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
713 4XI5 3 C Fab-94 light chain 9606
714 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
715 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
716 4Q5Z 3 J, L, N, P, R, T, V, X IDE-bound Fab, light chain 10090
717 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
718 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
719 5K9O 2 B, L 31.b.09 Light Fv 9606
720 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
721 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
722 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
723 5JW4 6 R MEDI8852 light chain 9606
724 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
725 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
726 5VOC 7 L Fab 8I21 light chain 9606
727 5J3D 2 B, D, L 14N4 light chain 9606
728 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
729 5ESZ 2 B, L CH04 Light Chain 9606
730 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
731 3EFF 1 A, C FAB 10090
732 3PJS 1 A, C FAB light chain 10090
733 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
734 4ZYP 5 E, G, I AM14 antibody light chain 9606
735 5DWU 4 L Fab - Light Chain 9606
736 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9605
737 5I8H 5 F, H VRC34.01 Fab light chain 9606
738 4RQS 2 C 17b Fab Light Chain 9606
739 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
740 4R4H 3 L Antibody 2.2c, Light chain 9606
741 5VOD 7 L Fab 9I6 light chain 9606
742 5FHC 5 L Antibody 114 Fab light chain 9606
743 4XMN 6 L Antibody 87 light chain 32630
744 4XMM 8 L Antibody 57 light chain 9606
745 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
746 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
747 6BF7 3 D, F Fab H11-E light chain 10090
748 6BF9 3 D, F Fab H11-E light chain 10090
749 6B7Z 3 D, F FAB H11 light chain 10090
750 6B70 3 D, F FAB H11-E light chain 10090
751 5VN3 1 L, N, O 17b Fab light chain 9606
752 5GZR 4 L, N Z23 Fab light chain 9606
753 5THR 4 J, K, L 17b Fab VL domain 9606
754 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
755 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
756 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
757 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
758 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
759 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
760 2ESG 1 L, M Immunoglobulin A1 light chain 9606
761 1R70 1 A, C Human IgA2(m1) Light Chain 9606
762 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606