Sequence Similarity Clusters for the Entities in PDB 1OL0

Entity #1 | Chains: A,B
IMMUNOGLOBULIN G protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 46847
95 % 1 1 39071 Flexibility: No
Max RMSD: 0.3, Avg RMSD: 0.3
PDBFlex
90 % 1 6 4211
70 % 82 471 9
50 % 100 712 6
40 % 500 6382 1
30 % 599 7934 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 5E7B 1 A nanobody nano-L06 9838
4 2P45 2 B ANTIBODY CAB-RN05 9838
5 2X1Q 1 A, B GELSOLIN NANOBODY 9844
6 5U64 1 B VHH-28 9838
7 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
8 4B41 1 A, B ANTIBODY G7 9844
9 5IMM 1 B Nanobody 9835
10 5NLU 1 A single domain llama antibody Nb36 9844
11 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
12 5IMK 1 B Nanobody 9835
13 6CWK 1 A Anti-Ricin antibody 30538
14 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
15 4B50 1 A 2H10 LLAMA VHH 9844
16 6DBA 1 A, B nanobody VHH R303 9838
17 2XT1 2 B CAMELID VHH 9 30538
18 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
19 5J1S 3 C VHH domain BS-2 30538
20 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
21 5J1T 3 C VHH domain BS-2 30538
22 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
23 2X1O 1 A, B GELSOLIN NANOBODY 9844
24 4QGY 1 A, B nanobody n25, VH domain 9844
25 5VNV 1 A Nb.b201 32630
26 5DXW 1 A PD-L1 nanobody 9835
27 4N9O 2 B Nanobody Nb484 Nb484 9844
28 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
29 1T2J 1 A M12-Variable Heavy domain 9606
30 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
31 6DBF 2 B InlB specific VHH R303 9838
32 6DBG 2 C, D VHH R303 9838
33 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
34 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
35 4KML 2 B Nanobody 9844
36 4Z9K 2 B VHH2(F5) antibody 30538
37 5LMW 1 A Nanobody 9844
38 5NM0 1 A, B, C, D Nb36 9844
39 6H6Y 2 E, F, G, H Nanobody (VHH) Nano-7 30538
40 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
41 4PPT 1 A Engineered single domain VHH antibody 9844
42 3R0M 1 A, B Llama VHH A12 9844
43 3ZKQ 2 D XA4813 9844
44 4I13 2 B Protein ca1697 (nanobody) 9844
45 5C2U 1 B Nanobody Nanobody 9838
46 1XFP 1 A heavy chain antibody VHH domain 9838
47 4POY 1 A VHH-metal 9844
48 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
49 5NLW 1 A nanobody Nb36 9844
50 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
51 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
52 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
53 3G9A 2 B Minimizer 9838
54 2P43 2 B ANTIBODY CAB-RN05 9838
55 4KRN 1 A Nanobody/VHH domain EgA1 9844
56 4GFT 2 B Nanobody 9844
57 4TVS 2 a, b VHH Domain BS-1 30538
58 4W6Y 2 B Nanobody NbFedF9 9844
59 6EZW 1 B VHH antibody BCD090-M2 9844
60 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
61 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
62 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
63 5O02 2 C Nanobody (VHH) Nano-4 30538
64 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
65 4X7F 2 C, D Nano-25 Nanobody 30538
66 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
67 4LGR 2 B Camelid nanobody (VHH3) 30538
68 5J57 2 B VHH single chain antibody V5E1 30538
69 5OMM 2 C Nanobody (VHH) Nano-14 30538
70 5E03 1 A CTLA-4 nanobody 9835
71 5LZ0 1 A, B PorM nanobody 9844
72 6DBE 1 A, B nanobody VHH R303 9844
73 2XXC 1 B CAMELID VHH 9 30538
74 3QYC 1 A, B VH domain of IgG molecule 9606
75 5VAK 2 B Nb914 Nanobody 9844
76 2XXM 2 B CAMELID VHH 9 30538
77 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
78 5JDS 1 B Nanobody 9835
79 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
80 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
81 5FWO 1 A NANOBODY 9844
82 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
83 3B9V 1 A, B, C, D heavy chain variable domain 9606
84 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
85 5N88 1 A, H VH59 antibody 9606
86 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
87 4POU 2 B VHH Antibody 9844
88 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
89 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
90 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
91 6H70 2 C, D Nanobody (VHH) Nano-62 30538
92 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
93 2P42 2 B, D ANTIBODY CAB-RN05 9838
94 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
95 4QLR 1 A, B Llama nanobody n02 VH domain 9844
96 5J56 2 B VHH single chain antibody V1C7 30538
97 4NBX 2 B A20.1 VHH 9844
98 4HEP 2 G vHH17 domain 9844
99 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
100 5IML 2 B Nanobody 9835
101 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
102 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
103 5M2J 2 D Anti-(ED-B) scFV 9606
104 5IVO 1 A BC2-nanobody 30538
105 4NBZ 2 B, D A26.8 VHH 9844
106 2P44 2 B ANTIBODY CAB-RN05 9838
107 5TP3 1 A, B F-VHH-4 9844
108 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
109 4LHJ 2 B Camelid antibody 30538
110 4BEL 2 D, E XA4813 9844
111 5M7Q 1 A, B Nanobody NbD2 9838
112 5H8D 1 A VHH nanobody 9844
113 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
114 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
115 3DUR 2 B, D Ig-like protein 10090
116 2XV6 2 B, D CAMELID VHH 9 30538
117 5VM0 1 A, B Camelid Nanobody VHH T9 9844
118 4ZG1 1 A, B, C, D, E, F NB17 9844
119 4I1N 2 B Protein ca1697 (nanobody) 9844
120 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
121 6F0D 1 A, B VHH antibody BCD090-M2 9844
122 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
123 4W6X 2 B Nanobody NbFedF7 9844
124 5JA9 2 A, B Nanobody 6 9844
125 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
126 1OP9 1 A HL6 camel VHH fragment 9838
127 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
128 4S11 1 A GELSOLIN NANOBODY 9844
129 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
130 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
131 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
132 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
133 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
134 4Y7M 1 A, B Hi113 protein 9844
135 5JMO 2 C, D camelid VHH fragment 9838
136 4B5E 1 A, B PS2-8 9844
137 4X7C 2 C, D Nano-85 Nanobody VHH 30538
138 3EBA 1 A CAbHul6 9838
139 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
140 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
141 4I0C 2 C, D cAbHuL5 antibody 9838
142 6H1F 1 A gelsolin nanobody, Nb11 9844
143 5BOP 1 A, C Nanobody 9844
144 4DKA 1 A, B single domain antibody VHH 9844
145 5O05 1 C, D Nanobody (VHH) Nano-42 30538
146 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
147 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
148 3DUU 2 B, D Ig-like protein 10090
149 3K74 2 B Nanobody 9844
150 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
151 1SJV 1 A r9 llama VHH single domain antibody 9844
152 6CK8 1 A, B, C Llama antibody SD38 9844
153 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
154 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
155 6GZP 1 A Nanobody 9844
156 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
157 6H6Z 2 C, D Nanobody (VHH) Nano-62 30538
158 4W68 1 A, B Single domain antibody 9844
159 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
160 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
161 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
162 3EAK 1 A, B NbBCII10-FGLA 9838
163 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
164 4ORZ 3 C single domain antibody sdAb19 9844
165 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
166 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
167 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
168 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
169 5C1M 2 B Nanobody 39 9844
170 5F7K 2 C, D Nanobody Nb-ER19 9844
171 5LMJ 1 A, B, C, D nanobody 9844
172 5E1H 2 B F8(JOB10) VHH antibody 30538
173 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
174 4OCM 3 C, F Nb1 9844
175 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
176 4X7E 2 C, D Nano-85 Nanobody 30538
177 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
178 5O03 2 C, D Nanobody (VHH) Nano-32 9844
179 4Y8D 2 C, D nanobody 9844
180 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
181 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
182 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
183 4C58 2 B nanobody 9844
184 3DV6 2 B Ig-like protein 10090
185 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
186 4XVJ 2 H antibody heavy chain variable domain 9606
187 4IDL 1 A Single Domain Antibody VHH A9 9844
188 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
189 3K7U 1 A Antibody 9844
190 4NBY 2 B, C A20.1 VHH 9844
191 4X7D 2 C, D Nano-85 Nanobody VHH 9844
192 5VAN 2 B Nb914 Nanobody 9844
193 5F7N 2 C, D Nanobody Nb-ER19 30538
194 5OCL 1 A, C, F, H anti-llama nanobody 30538
195 5OCL 2 B, D, E, G anti-vglut nanobody 9844
196 2A9M 2 H, I fluorescein-scfv heavy chain 9606
197 5E5M 2 B, D, F, H CTLA-4 nanobody 9835
198 1SJX 1 A immunoglobulin VH domain 9844
199 3ZKS 2 D XA4813 9844
200 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
201 6H72 2 C, D Nanobody (VHH) Nano-94 30538
202 5MY6 2 B Nanobody 2Rs15d 9838
203 3DUS 2 B, D Ig-like protein 10090
204 6F5G 2 B VHH minibody anti-Cter PCSK9 VHH from immunization of Llama from E. coli expression 9844
205 5M2I 2 G, H, I, J, K, L VHH1 9844
206 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
207 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
208 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
209 3K1K 2 C, D Enhancer 9838
210 4U7S 1 A, B sdAb A3 9844
211 4U3X 1 A, C Human VH domain antibody 9606
212 4W81 1 A Single Domain Antibody 9844
213 5GRV 1 L homo-specific diabody heavy chain 9606
214 5JMR 1 A, B camelid VHH fragment 9838
215 4W70 1 A Single Domain Antibody 9844
216 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
217 4BFB 2 D, E XA4813 9844
218 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
219 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
220 4LHQ 2 B, D Camelid nanobody 30538
221 3DV4 2 B Ig-like protein 10090
222 6H71 2 C, D Nanobody (VHH) Nano-94 30538
223 3ZKX 2 B XA4813 9844
224 3ZKX 3 C XA4815 9844
225 6I6J 2 C Sybody 32644
226 6A78 3 H, I Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv 10090
227 3ZLQ 2 C, D XA4813 9844
228 4NC0 2 B A26.8 VHH 9844
229 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
230 5GS1 2 B, N, P, R heavy chain 9606
231 5F7Y 3 C, D Nanobody Nb-ER19 9844
232 5IMO 1 B Nanobody 9835
233 5U65 1 A, B VHH-5 9838
234 4TYU 1 A, B Single Domain Antibody 9844
235 4AQ1 2 B, D NBKB6 VHH 9844
236 6FV0 2 F nanobody 9844
237 4EIG 2 B CA1698 camel antibody fragment 9844
238 3EHB 3 C FV fragment Chain H 10090
239 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
240 3HB3 3 C ANTIBODY FV FRAGMENT 10090
241 2X89 1 A, B, C ANTIBODY 9838
242 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
243 5O04 2 E, F Nanobody (VHH) Nano-26 30538
244 5O04 3 C, D Nanobody (VHH) Nano-85 30538
245 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
246 3P9W 2 B, D, F, H human VEGF 9606
247 5F8R 2 C, D Nanobody Nb-ER19 9844
248 4OCL 3 C, F Nb1 9844
249 4RAV 2 A, C single-chain Fv, VH 9606
250 5XJ4 2 H durvalumab-VH 9606
251 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
252 4IOS 2 D, E, F, G Llama nanobody 11 9844
253 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
254 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
255 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
256 4OCN 3 C, F Nb1 9844
257 4GRW 3 E, G Nanobody 124C4 9844
258 4GRW 4 F, J Nanobody 37D5 9844
259 4GRW 5 H, I Nanobody 22E11 9844
260 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
261 4NC2 2 B B39 VHH 9844
262 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
263 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
264 6EY0 2 E, G, H llama nanobody nb01 9844
265 6EY0 3 F llama nanobody nb01 9844
266 5F9A 2 C Nanobody Nb-ER19 9844
267 2OTW 2 B, D Fv heavy chain variable domain VH 10090
268 3STB 1 A, B single domain antibody VHH 9844
269 4W6W 2 B NbFedF6 9844
270 5JA8 2 B, D, F, H Nanobody 2 9844
271 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
272 5U4M 2 B V1C7 VHH antibody 30538
273 5O0W 2 E, F, G, H Nb474 30538
274 4Y5V 1 A, D, G diabody 305 VH domain 9606
275 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
276 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
277 6FYU 3 C, F, I Single domain antibody SD36 9844
278 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
279 3K80 1 A, B Antibody 9844
280 5VAQ 2 B Nb914 Nanobody 9844
281 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
282 5F8Q 2 C, D Nanobody Nb-ER19 9844
283 4U05 1 A, B Single Domain Antibody 9844
284 5F9D 2 C Nanobody Nb-ER19 9844
285 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
286 4LGP 2 B, D VHH1 camelid nanobody 30538
287 2P48 2 B ANTIBODY CAB-RN05 9838
288 5U4L 2 B V1C7 VHH antibody G29R variant 30538
289 5F7M 2 C, D Nanobody Nb-ER19 9844
290 6H15 2 C, D VHH L-P2-B10 9844
291 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
292 5F7W 2 C, D Nanobody Nb-ER19 9844
293 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
294 4NC1 2 C, D A20.1 VHH 9844
295 4NC1 3 E, F A26.8 VHH 9844
296 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
297 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
298 5E7F 1 A, B, C nanobody L06 9838
299 2P46 2 B, D ANTIBODY CAB-RN05 9838
300 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
301 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
302 5LHP 2 B Camelid-Derived Antibody Fragment 30538
303 6J7W 1 A, B UniAb Heavy chain Antibody 9606
304 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
305 5SV4 1 A, B Single Domain Antibody A3C8 9844
306 4LGS 2 B Camelid nanobody (VHH4) 30538
307 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
308 2P47 2 B ANTIBODY CAB-RN05 9838
309 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
310 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
311 1AR1 3 C ANTIBODY FV FRAGMENT 10090
312 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
313 5VNW 2 C, D Nb.b201 32630
314 6FE4 2 F, G, H, I, J Nb113 30538
315 6GS4 2 H nanobody 9839
316 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
317 6A79 3 H, I Heavy chain of the anti-human Robo1 antibody B5209B scFv 10090
318 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
319 6CWG 2 B, D VHH antibody 30538
320 5HVF 2 B VHH-i83 30538
321 4PGJ 1 A, C Human heavy chain domain antibody 9606
322 4KDT 1 A, B Nanobody24 9835
323 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
324 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
325 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
326 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
327 6FYT 3 I Single domain antibody SD38 9844
328 5MJE 2 B Nanobody 8 9844
329 3OGO 2 E, F, G, H GFP-nanobody 9838
330 4C59 2 B NANOBODY 9844
331 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
332 4DK6 1 A, B single domain antibody VHH 9844
333 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
334 5F7L 2 B, D Nanobody Nb-ER14 9844
335 5HVG 2 B, D VHH-a204 30538
336 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
337 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
338 5HVH 2 B VHH-a204 30538
339 5HVH 3 C VHH-i83 30538
340 4XT1 3 C nanobody 7 30538
341 5HM1 1 A, B, C lama VHH antibody 2E7 9844
342 5FUC 3 E, V VHH6 9838
343 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
344 5OMN 2 C Nanobody (VHH) Nano-27 30538
345 4KRP 2 B Nanobody/VHH domain 9G8 9844
346 6FUZ 2 N nanobody 9844
347 4FHB 2 D Nb179 9844
348 4DK3 1 A, B single domain antibody VHH 9844
349 4KRL 1 B Nanobody/VHH domain 7D12 9844
350 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
351 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
352 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
353 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
354 6H16 2 B VHH L-P2-D07 9844
355 6MXT 2 N nanobody Nb71 9844
356 4LDE 2 B Camelid Antibody Fragment 9844
357 4Y5Y 1 A, D diabody 330 VH domain 9606
358 6IBL 2 C, D Camelid antibody fragment Nb80 9844
359 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
360 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
361 3RJQ 2 B Llama VHH A12 9844
362 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
363 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
364 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
365 6EQI 2 B Nb696 9844
366 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
367 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
368 4KFZ 2 C, D Anti-LMO2 VH 9606
369 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
370 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
371 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
372 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
373 4YGA 2 B, D, F, H VHH-1B7 30538
374 2A9N 2 H, I fluorescein-scfv heavy chain 9606
375 5YY5 2 H Heavy chain 9606
376 5YY5 4 C Heavy chain 9606
377 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
378 5GRJ 1 H avelumab H chain 9606
379 6N4Y 2 E, F, G, H Nanobody 43 Nanobody 43 9844
380 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
381 4KRO 2 B Nanobody/VHH domain EgA1 9844
382 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
383 5TJW 2 K NP-specific inhibitory VHH 30538
384 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
385 6H7M 3 C, D Camelid antibody fragment Nb6B9 562
386 4LDL 2 B Camelid Antibody Fragment 9844
387 6GS7 2 H nanobody 9839
388 4LDO 2 B Camelid Antibody Fragment 9844
389 5XJ3 1 A, D, G, J ipilimumab-VH 9606
390 3SN6 5 N Camelid antibody VHH fragment 9844
391 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
392 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
393 5O8F 2 K, O Nanobody Nb25 9844
394 5O8F 3 L, M, N Nanobody Nb25 9844
395 5NQW 2 C, D 026 9844
396 5C3L 4 D Nanobody Nb15 Nanobody 9838
397 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
398 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
399 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
400 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
401 6H7J 3 C, D Camelid antibody fragment Nb80 9844
402 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
403 6B73 2 C, D Nanobody 9844
404 4PIR 2 F, G, H, I, J VHH15 9844
405 6C5W 2 C, E nanobody 32644
406 4QKX 2 B R9 protein 9844
407 5JQH 2 C, D Nanobody60, Nb60 9844
408 6C9W 2 B Nanobody9047 Full 9844
409 6GS1 2 H Nanobody 00 9844
410 5DA0 2 B Nanobody 9844
411 6GCI 2 B Nanobody Nanobody selected against the BKA-inhibited ADP/ATP carrier 9844
412 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
413 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
414 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
415 6DO1 2 C, D, E, F Nanobody Nb.AT110i1 32630
416 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
417 4MQS 2 B Nanobody 9-8 9844
418 5WB2 3 D nanobody B1 32630
419 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
420 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
421 4MQT 2 B Nanobody 9-8 9844
422 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
423 6CNV 3 C SD84h 32630
424 6N50 2 E Nanobody 43 9844
425 5EUL 4 V AYC08 30538
426 5GXB 2 B nanobody 30538
427 5NBD 2 C Nanobody 9844
428 5H8O 1 A VHH nanobody 9844
429 4KSD 2 B R2 protein 9844
430 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
431 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
432 5TD8 5 E nanobody 30538
433 6NIY 2 N Nanobody35 9844
434 6IYN 1 A Nb26 30538
435 6NB3 3 D, H LCA60 heavy chain 9606
436 6NB4 2 H LCA60 heavy chain 9606
437 6NB6 2 H, I S230 heavy chain 9606
438 6NB7 2 D, G, H S230 heavy chain 9606
439 6N51 2 C, D Nanobody 43 9844
440 6I53 4 G Megabody38 9844
441 6MID 3 H monoclonal antibody ZIKV-195 heavy chain Fab variable domain 9606
442 6E3Y 2 N Nanobody 35 9844
443 6A96 1 K, L, O Nb25 9844
444 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
445 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
446 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
447 6BSP 1 A U4 Heavy chain 10090
448 6B3J 6 N Nanobody 35 9844
449 6EHG 3 C hC3Nb1 9844
450 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
451 5XS7 2 H Heavy chain of Fab 1D5 10090
452 5VAI 6 N nanobody 35 9844
453 5UZ7 4 N NANOBODY 35 9844
454 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
455 5KWL 4 7 VHH 10E 9838
456 5KTZ 4 7 VHH 12B 9838
457 5KU0 4 7 VHH 17B 9838
458 5KU2 4 7 VHH 7A 9838
459 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
460 5FOJ 1 A NANOBODY 9838
461 3JBC 5 7 nanobody VHH PVSP29F 9838
462 3JBD 5 7 nanobody VHH PVSP6A 9838
463 3JBE 5 7 nanobody VHH PVSS8A 9838
464 3JBF 5 7 nanobody VHH PVSP19B 9838
465 3JBG 5 7 nanobody VHH PVSS21E 9838
466 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
467 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
468 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
469 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
470 1G9E 1 A H14 9844
471 1VHP 1 A VH-P8 9606