Sequence Similarity Clusters for the Entities in PDB 1OL0

Entity #1 | Chains: A,B
IMMUNOGLOBULIN G protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 45734
95 % 1 1 38172 Flexibility: No
Max RMSD: 0.3, Avg RMSD: 0.3
PDBFlex
90 % 1 6 4082
70 % 80 440 9
50 % 98 659 6
40 % 492 6175 1
30 % 591 7645 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 5E7B 1 A nanobody nano-L06 9838
4 2P45 2 B ANTIBODY CAB-RN05 9838
5 2X1Q 1 A, B GELSOLIN NANOBODY 9844
6 5U64 1 B VHH-28 9838
7 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
8 4B41 1 A, B ANTIBODY G7 9844
9 5IMM 1 B Nanobody 9835
10 5NLU 1 A single domain llama antibody Nb36 9844
11 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
12 5IMK 1 B Nanobody 9835
13 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
14 4B50 1 A 2H10 LLAMA VHH 9844
15 6DBA 1 A, B nanobody VHH R303 9838
16 2XT1 2 B CAMELID VHH 9 30538
17 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
18 5J1S 3 C VHH domain BS-2 30538
19 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
20 5J1T 3 C VHH domain BS-2 30538
21 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
22 2X1O 1 A, B GELSOLIN NANOBODY 9844
23 4QGY 1 A, B nanobody n25, VH domain 9844
24 5VNV 1 A Nb.b201 32630
25 5DXW 1 A PD-L1 nanobody 10090
26 4N9O 2 B Nanobody Nb484 Nb484 9844
27 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
28 1T2J 1 A M12-Variable Heavy domain 9606
29 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
30 6DBF 2 B InlB specific VHH R303 9838
31 6DBG 2 C, D VHH R303 9838
32 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
33 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
34 4KML 2 B Nanobody 9844
35 4Z9K 2 B VHH2(F5) antibody 30538
36 5LMW 1 A Nanobody 9844
37 5NM0 1 A, B, C, D Nb36 9844
38 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
39 4PPT 1 A Engineered single domain VHH antibody 9844
40 3R0M 1 A, B Llama VHH A12 9844
41 3ZKQ 2 D XA4813 9844
42 4I13 2 B Protein ca1697 (nanobody) 9844
43 5C2U 1 B Nanobody Nanobody 9838
44 1XFP 1 A heavy chain antibody VHH domain 9838
45 4POY 1 A VHH-metal 9844
46 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
47 5NLW 1 A nanobody Nb36 9844
48 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
49 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
50 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
51 3G9A 2 B Minimizer 9838
52 2P43 2 B ANTIBODY CAB-RN05 9838
53 4KRN 1 A Nanobody/VHH domain EgA1 9844
54 4GFT 2 B Nanobody 9844
55 4TVS 2 a, b VHH Domain BS-1 30538
56 4W6Y 2 B Nanobody NbFedF9 9844
57 6EZW 1 B VHH antibody BCD090-M2 9844
58 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
59 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
60 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
61 5O02 2 C Nanobody (VHH) Nano-4 30538
62 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
63 4X7F 2 C, D Nano-25 Nanobody 30538
64 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
65 4LGR 2 B Camelid nanobody (VHH3) 30538
66 5J57 2 B VHH single chain antibody V5E1 30538
67 5OMM 2 C Nanobody (VHH) Nano-14 30538
68 5E03 1 A mouse CTLA-4 nanobody 10090
69 5LZ0 1 A, B PorM nanobody 9844
70 6DBE 1 A, B nanobody VHH R303 9844
71 2XXC 1 B CAMELID VHH 9 30538
72 3QYC 1 A, B VH domain of IgG molecule 9606
73 5VAK 2 B Nb914 Nanobody 9844
74 2XXM 2 B CAMELID VHH 9 30538
75 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
76 5JDS 1 B Nanobody 9835
77 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
78 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
79 5FWO 1 A NANOBODY 9844
80 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
81 3B9V 1 A, B, C, D heavy chain variable domain 9606
82 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
83 5N88 1 A, H VH59 antibody 9606
84 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
85 4POU 2 B VHH Antibody 9844
86 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
87 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
88 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
89 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
90 2P42 2 B, D ANTIBODY CAB-RN05 9838
91 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
92 4QLR 1 A, B Llama nanobody n02 VH domain 9844
93 5J56 2 B VHH single chain antibody V1C7 30538
94 4NBX 2 B A20.1 VHH 9844
95 4HEP 2 G vHH17 domain 9844
96 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
97 5IML 2 B Nanobody 9835
98 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
99 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
100 5M2J 2 D Anti-(ED-B) scFV 9606
101 5IVO 1 A BC2-nanobody 30538
102 4NBZ 2 B, D A26.8 VHH 9844
103 2P44 2 B ANTIBODY CAB-RN05 9838
104 5TP3 1 A, B F-VHH-4 9844
105 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
106 4LHJ 2 B Camelid antibody 30538
107 4BEL 2 D, E XA4813 9844
108 5M7Q 1 A, B Nanobody NbD2 9838
109 5H8D 1 A VHH nanobody 9844
110 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
111 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
112 3DUR 2 B, D Ig-like protein 10090
113 2XV6 2 B, D CAMELID VHH 9 30538
114 5VM0 1 A, B Camelid Nanobody VHH T9 9844
115 4ZG1 1 A, B, C, D, E, F NB17 9844
116 4I1N 2 B Protein ca1697 (nanobody) 9844
117 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
118 6F0D 1 A, B VHH antibody BCD090-M2 9844
119 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
120 4W6X 2 B Nanobody NbFedF7 9844
121 5JA9 2 A, B Nanobody 6 9844
122 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
123 1OP9 1 A HL6 camel VHH fragment 9838
124 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
125 4S11 1 A GELSOLIN NANOBODY 9844
126 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
127 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
128 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
129 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
130 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
131 4Y7M 1 A, B Hi113 protein 9844
132 5JMO 2 C, D camelid VHH fragment 9838
133 4B5E 1 A, B PS2-8 9844
134 4X7C 2 C, D Nano-85 Nanobody VHH 30538
135 3EBA 1 A CAbHul6 9838
136 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
137 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
138 4I0C 2 C, D cAbHuL5 antibody 9838
139 5BOP 1 A, C Nanobody 9844
140 4DKA 1 A, B single domain antibody VHH 9844
141 5O05 1 C, D Nanobody (VHH) Nano-42 30538
142 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
143 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
144 3DUU 2 B, D Ig-like protein 10090
145 3K74 2 B Nanobody 9844
146 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
147 1SJV 1 A r9 llama VHH single domain antibody 9844
148 6CK8 1 A, B, C Llama antibody SD38 9844
149 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
150 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
151 6GZP 1 A Nanobody 9844
152 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
153 4W68 1 A, B Single domain antibody 9844
154 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
155 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
156 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
157 3EAK 1 A, B NbBCII10-FGLA 9838
158 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
159 4ORZ 3 C single domain antibody sdAb19 9844
160 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
161 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
162 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
163 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
164 5C1M 2 B Nanobody 39 9844
165 5F7K 2 C, D Nanobody Nb-ER19 9844
166 5LMJ 1 A, B, C, D nanobody 9844
167 5E1H 2 B F8(JOB10) VHH antibody 30538
168 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
169 4OCM 3 C, F Nb1 9844
170 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
171 4X7E 2 C, D Nano-85 Nanobody 30538
172 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
173 5O03 2 C, D Nanobody (VHH) Nano-32 9844
174 4Y8D 2 C, D nanobody 9844
175 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
176 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
177 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
178 4C58 2 B NANOBODY 9844
179 3DV6 2 B Ig-like protein 10090
180 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
181 4XVJ 2 H antibody heavy chain variable domain 9606
182 4IDL 1 A Single Domain Antibody VHH A9 9844
183 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
184 3K7U 1 A Antibody 9844
185 4NBY 2 B, C A20.1 VHH 9844
186 4X7D 2 C, D Nano-85 Nanobody VHH 9844
187 5VAN 2 B Nb914 Nanobody 9844
188 5F7N 2 C, D Nanobody Nb-ER19 30538
189 5OCL 1 A, C, F, H anti-llama nanobody 30538
190 5OCL 2 B, D, E, G anti-vglut nanobody 9844
191 2A9M 2 H, I fluorescein-scfv heavy chain 9606
192 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
193 1SJX 1 A immunoglobulin VH domain 9844
194 3ZKS 2 D XA4813 9844
195 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
196 5MY6 2 B Nanobody 2Rs15d 9838
197 3DUS 2 B, D Ig-like protein 10090
198 5M2I 2 G, H, I, J, K, L VHH1 9844
199 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
200 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
201 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
202 3K1K 2 C, D Enhancer 9838
203 4U7S 1 A, B sdAb A3 9844
204 4U3X 1 A, C Human VH domain antibody 9606
205 4W81 1 A Single Domain Antibody 9844
206 5GRV 1 L homo-specific diabody heavy chain 9606
207 5JMR 1 A, B camelid VHH fragment 9838
208 4W70 1 A Single Domain Antibody 9844
209 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
210 4BFB 2 D, E XA4813 9844
211 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
212 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
213 4LHQ 2 B, D Camelid nanobody 30538
214 3DV4 2 B Ig-like protein 10090
215 3ZKX 2 B XA4813 9844
216 3ZKX 3 C XA4815 9844
217 3ZLQ 2 C, D XA4813 9844
218 4NC0 2 B A26.8 VHH 9844
219 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
220 5GS1 2 B, N, P, R heavy chain 9606
221 5F7Y 3 C, D Nanobody Nb-ER19 9844
222 5IMO 1 B Nanobody 9835
223 5U65 1 A, B VHH-5 9838
224 4TYU 1 A, B Single Domain Antibody 9844
225 4AQ1 2 B, D NBKB6 VHH 9844
226 6FV0 2 F nanobody 9844
227 4EIG 2 B CA1698 camel antibody fragment 9844
228 3EHB 3 C FV fragment Chain H 10090
229 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
230 3HB3 3 C ANTIBODY FV FRAGMENT 10090
231 2X89 1 A, B, C ANTIBODY 9838
232 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
233 5O04 2 E, F Nanobody (VHH) Nano-26 30538
234 5O04 3 C, D Nanobody (VHH) Nano-85 30538
235 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
236 3P9W 2 B, D, F, H human VEGF 9606
237 5F8R 2 C, D Nanobody Nb-ER19 9844
238 4OCL 3 C, F Nb1 9844
239 4RAV 2 A, C single-chain Fv, VH 9606
240 5XJ4 2 H durvalumab-VH 9606
241 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
242 4IOS 2 D, E, F, G Llama nanobody 11 9844
243 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
244 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
245 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
246 4OCN 3 C, F Nb1 9844
247 4GRW 3 E, G Nanobody 124C4 9844
248 4GRW 4 F, J Nanobody 37D5 9844
249 4GRW 5 H, I Nanobody 22E11 9844
250 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
251 4NC2 2 B B39 VHH 9844
252 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
253 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
254 6EY0 2 E, G, H llama nanobody nb01 9844
255 6EY0 3 F llama nanobody nb01 9844
256 5F9A 2 C Nanobody Nb-ER19 9844
257 2OTW 2 B, D Fv heavy chain variable domain VH 10090
258 3STB 1 A, B single domain antibody VHH 9844
259 4W6W 2 B NbFedF6 9844
260 5JA8 2 B, D, F, H Nanobody 2 9844
261 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
262 5U4M 2 B V1C7 VHH antibody 30538
263 5O0W 2 E, F, G, H Nb474 30538
264 4Y5V 1 A, D, G diabody 305 VH domain 9606
265 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
266 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
267 6FYU 3 C, F, I Single domain antibody SD36 9844
268 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
269 3K80 1 A, B Antibody 9844
270 5VAQ 2 B Nb914 Nanobody 9844
271 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
272 5F8Q 2 C, D Nanobody Nb-ER19 9844
273 4U05 1 A, B Single Domain Antibody 9844
274 5F9D 2 C Nanobody Nb-ER19 9844
275 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
276 4LGP 2 B, D VHH1 camelid nanobody 30538
277 2P48 2 B ANTIBODY CAB-RN05 9838
278 5U4L 2 B V1C7 VHH antibody G29R variant 30538
279 5F7M 2 C, D Nanobody Nb-ER19 9844
280 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
281 5F7W 2 C, D Nanobody Nb-ER19 9844
282 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
283 4NC1 2 C, D A20.1 VHH 9844
284 4NC1 3 E, F A26.8 VHH 9844
285 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
286 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
287 5E7F 1 A, B, C nanobody L06 9838
288 2P46 2 B, D ANTIBODY CAB-RN05 9838
289 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
290 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
291 5LHP 2 B Camelid-Derived Antibody Fragment 30538
292 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
293 5SV4 1 A, B Single Domain Antibody A3C8 9844
294 4LGS 2 B Camelid nanobody (VHH4) 30538
295 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
296 2P47 2 B ANTIBODY CAB-RN05 9838
297 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
298 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
299 1AR1 3 C ANTIBODY FV FRAGMENT 10090
300 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
301 5VNW 2 C, D Nb.b201 32630
302 6FE4 2 F, G, H, I, J Nb113 30538
303 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
304 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
305 5HVF 2 B VHH-i83 30538
306 4PGJ 1 A, C Human heavy chain domain antibody 9606
307 4KDT 1 A, B Nanobody24 9835
308 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
309 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
310 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
311 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
312 6FYT 3 I Single domain antibody SD38 9844
313 5MJE 2 B Nanobody 8 9844
314 3OGO 2 E, F, G, H GFP-nanobody 9838
315 4C59 2 B NANOBODY 9844
316 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
317 4DK6 1 A, B single domain antibody VHH 9844
318 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
319 5F7L 2 B, D Nanobody Nb-ER14 9844
320 5HVG 2 B, D VHH-a204 30538
321 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
322 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
323 5HVH 2 B VHH-a204 30538
324 5HVH 3 C VHH-i83 30538
325 4XT1 3 C nanobody 7 30538
326 5HM1 1 A, B, C lama VHH antibody 2E7 9844
327 5FUC 3 E, V VHH6 9838
328 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
329 5OMN 2 C Nanobody (VHH) Nano-27 30538
330 4KRP 2 B Nanobody/VHH domain 9G8 9844
331 6FUZ 2 N nanobody 9844
332 4FHB 2 D Nb179 9844
333 4DK3 1 A, B single domain antibody VHH 9844
334 4KRL 1 B Nanobody/VHH domain 7D12 9844
335 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
336 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
337 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
338 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
339 6MXT 2 N nanobody Nb71 9844
340 4LDE 2 B Camelid Antibody Fragment 9844
341 4Y5Y 1 A, D diabody 330 VH domain 9606
342 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
343 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
344 3RJQ 2 B Llama VHH A12 9844
345 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
346 6H7K 3 C, D Camelid antibody fragment Nb80 9844
347 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
348 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
349 6EQI 2 B Nb696 9844
350 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
351 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
352 4KFZ 2 C, D Anti-LMO2 VH 9606
353 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
354 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
355 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
356 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
357 4YGA 2 B, D, F, H VHH-1B7 30538
358 2A9N 2 H, I fluorescein-scfv heavy chain 9606
359 5YY5 2 H Heavy chain 9606
360 5YY5 4 C Heavy chain 9606
361 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
362 5GRJ 1 H avelumab H chain 9606
363 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
364 4KRO 2 B Nanobody/VHH domain EgA1 9844
365 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
366 5TJW 2 K NP-specific inhibitory VHH 30538
367 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
368 6H7M 3 C, D Camelid antibody fragment Nb6B9 562
369 4LDL 2 B Camelid Antibody Fragment 9844
370 4LDO 2 B Camelid Antibody Fragment 9844
371 5XJ3 1 A, D, G, J ipilimumab-VH 9606
372 3SN6 5 N Camelid antibody VHH fragment 9844
373 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
374 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
375 5O8F 2 K, O Nanobody Nb25 9844
376 5O8F 3 L, M, N Nanobody Nb25 9844
377 5NQW 2 C, D 026 9844
378 5C3L 4 D Nanobody Nb15 Nanobody 9838
379 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
380 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
381 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
382 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
383 6H7J 3 C, D Camelid antibody fragment Nb80 9844
384 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
385 6B73 2 C, D Nanobody 9844
386 4PIR 2 F, G, H, I, J VHH15 9844
387 6C5W 2 C, E nanobody 32644
388 4QKX 2 B R9 protein 9844
389 5JQH 2 C, D Nanobody60, Nb60 9844
390 6C9W 2 B Nanobody9047 Full 9844
391 5DA0 2 B Nanobody 9844
392 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
393 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
394 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
395 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
396 4MQS 2 B Nanobody 9-8 9844
397 5WB2 3 D nanobody B1 32630
398 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
399 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
400 4MQT 2 B Nanobody 9-8 9844
401 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
402 6CNV 3 C SD84h 32630
403 5EUL 4 V AYC08 30538
404 5GXB 2 B nanobody 30538
405 5NBD 2 C Nanobody 9844
406 5H8O 1 A VHH nanobody 9844
407 4KSD 2 B R2 protein 9844
408 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
409 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
410 5TD8 5 E nanobody 30538
411 6E3Y 2 N Nanobody 35 9844
412 6A96 1 K, L, O Nb25 9844
413 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
414 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
415 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
416 6BSP 1 A U4 Heavy chain 10090
417 6B3J 6 N Nanobody 35 9844
418 6EHG 3 C hC3Nb1 9844
419 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
420 5XS7 2 H Heavy chain of Fab 1D5 10090
421 5VAI 6 N nanobody 35 9844
422 5UZ7 4 N NANOBODY 35 9844
423 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
424 5KWL 4 7 VHH 10E 9838
425 5KTZ 4 7 VHH 12B 9838
426 5KU0 4 7 VHH 17B 9838
427 5KU2 4 7 VHH 7A 9838
428 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
429 5FOJ 1 A NANOBODY 9838
430 3JBC 5 7 nanobody VHH PVSP29F 9838
431 3JBD 5 7 nanobody VHH PVSP6A 9838
432 3JBE 5 7 nanobody VHH PVSS8A 9838
433 3JBF 5 7 nanobody VHH PVSP19B 9838
434 3JBG 5 7 nanobody VHH PVSS21E 9838
435 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
436 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
437 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
438 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
439 1G9E 1 A H14 9844
440 1VHP 1 A VH-P8 9606