Sequence Similarity Clusters for the Entities in PDB 1OL0

Entity #1 | Chains: A,B
IMMUNOGLOBULIN G protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 45819
95 % 1 1 38247 Flexibility: No
Max RMSD: 0.3, Avg RMSD: 0.3
PDBFlex
90 % 1 6 4088
70 % 80 440 9
50 % 98 659 6
40 % 492 6175 1
30 % 591 7653 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 5E7B 1 A nanobody nano-L06 9838
4 2P45 2 B ANTIBODY CAB-RN05 9838
5 2X1Q 1 A, B GELSOLIN NANOBODY 9844
6 5U64 1 B VHH-28 9838
7 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
8 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
9 4B41 1 A, B ANTIBODY G7 9844
10 5IMM 1 B Nanobody 9835
11 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
12 5NLU 1 A single domain llama antibody Nb36 9844
13 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
14 5IMK 1 B Nanobody 9835
15 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
16 4B50 1 A 2H10 LLAMA VHH 9844
17 6DBA 1 A, B nanobody VHH R303 9838
18 2XT1 2 B CAMELID VHH 9 30538
19 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
20 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
21 5J1S 3 C VHH domain BS-2 30538
22 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
23 5J1T 3 C VHH domain BS-2 30538
24 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
25 2X1O 1 A, B GELSOLIN NANOBODY 9844
26 4QGY 1 A, B nanobody n25, VH domain 9844
27 5C2B 1 H scFv 3B4 heavy chain 9606
28 5VNV 1 A Nb.b201 32630
29 5DXW 1 A PD-L1 nanobody 10090
30 4N9O 2 B Nanobody Nb484 Nb484 9844
31 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
32 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
33 1T2J 1 A M12-Variable Heavy domain 9606
34 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
35 6DBF 2 B InlB specific VHH R303 9838
36 6DBG 2 C, D VHH R303 9838
37 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
38 5VM6 1 A single domain camelid nanobody VHH T10 9844
39 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
40 4KML 2 B Nanobody 9844
41 4Z9K 2 B VHH2(F5) antibody 30538
42 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
43 5LMW 1 A Nanobody 9844
44 5NM0 1 A, B, C, D Nb36 9844
45 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
46 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
47 4PPT 1 A Engineered single domain VHH antibody 9844
48 3R0M 1 A, B Llama VHH A12 9844
49 3ZKQ 2 D XA4813 9844
50 4I13 2 B Protein ca1697 (nanobody) 9844
51 5C2U 1 B Nanobody Nanobody 9838
52 1XFP 1 A heavy chain antibody VHH domain 9838
53 4POY 1 A VHH-metal 9844
54 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
55 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
56 5NLW 1 A nanobody Nb36 9844
57 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
58 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
59 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
60 3G9A 2 B Minimizer 9838
61 2P43 2 B ANTIBODY CAB-RN05 9838
62 4KRN 1 A Nanobody/VHH domain EgA1 9844
63 4GFT 2 B Nanobody 9844
64 4TVS 2 a, b VHH Domain BS-1 30538
65 4W6Y 2 B Nanobody NbFedF9 9844
66 6EZW 1 B VHH antibody BCD090-M2 9844
67 1UAC 2 H Ig VH,anti-lysozyme 10090
68 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
69 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
70 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
71 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
72 5O02 2 C Nanobody (VHH) Nano-4 30538
73 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
74 4X7F 2 C, D Nano-25 Nanobody 30538
75 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
76 4LGR 2 B Camelid nanobody (VHH3) 30538
77 5J57 2 B VHH single chain antibody V5E1 30538
78 6BA5 2 B, D, F, H Variable domain Heavy chain, antibody R11 9606
79 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
80 5OMM 2 C Nanobody (VHH) Nano-14 30538
81 5E03 1 A mouse CTLA-4 nanobody 10090
82 5LZ0 1 A, B PorM nanobody 9844
83 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
84 6DBE 1 A, B nanobody VHH R303 9844
85 2XXC 1 B CAMELID VHH 9 30538
86 3QYC 1 A, B VH domain of IgG molecule 9606
87 5VAK 2 B Nb914 Nanobody 9844
88 2XXM 2 B CAMELID VHH 9 30538
89 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
90 6DBD 1 A, B, C, D nanobody VHH R326 9844
91 5JDS 1 B Nanobody 9835
92 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
93 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
94 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
95 5L21 2 B VHH-C2 30538
96 5FWO 1 A NANOBODY 9844
97 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
98 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
99 3B9V 1 A, B, C, D heavy chain variable domain 9606
100 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
101 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
102 5N88 1 A, H VH59 antibody 9606
103 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
104 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
105 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
106 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
107 4POU 2 B VHH Antibody 9844
108 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
109 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
110 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
111 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
112 2P42 2 B, D ANTIBODY CAB-RN05 9838
113 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
114 4QLR 1 A, B Llama nanobody n02 VH domain 9844
115 5J56 2 B VHH single chain antibody V1C7 30538
116 4NBX 2 B A20.1 VHH 9844
117 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
118 4HEP 2 G vHH17 domain 9844
119 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
120 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
121 5IML 2 B Nanobody 9835
122 3A6C 2 H IG VH, anti-lysozyme 10090
123 2DQD 2 H Ig VH,anti-lysozyme 10090
124 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
125 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
126 3A67 2 H IG VH, anti-lysozyme 10090
127 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
128 1J1X 2 H Ig VH,anti-lysozyme 10090
129 5M2J 2 D Anti-(ED-B) scFV 9606
130 2DQC 2 H Ig VH,anti-lysozyme 10090
131 1J1O 2 H Ig VH,anti-lysozyme 10090
132 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
133 4M62 2 H, I GEP2 FV heavy chain 9606
134 5IVO 1 A BC2-nanobody 30538
135 1J1P 2 H Ig VH,anti-lysozyme 10090
136 4NBZ 2 B, D A26.8 VHH 9844
137 5AYU 2 H Ig VH,anti-lysozyme 10090
138 3A6B 2 H IG VH, anti-lysozyme 10090
139 2DQJ 2 H Ig VH,anti-lysozyme 10090
140 5F21 2 B nanobody MU375 9844
141 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
142 2P44 2 B ANTIBODY CAB-RN05 9838
143 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
144 5TP3 1 A, B F-VHH-4 9844
145 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
146 4LHJ 2 B Camelid antibody 30538
147 4BEL 2 D, E XA4813 9844
148 5M7Q 1 A, B Nanobody NbD2 9838
149 5H8D 1 A VHH nanobody 9844
150 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
151 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
152 3DUR 2 B, D Ig-like protein 10090
153 2XV6 2 B, D CAMELID VHH 9 30538
154 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
155 5VM0 1 A, B Camelid Nanobody VHH T9 9844
156 4ZG1 1 A, B, C, D, E, F NB17 9844
157 6BAN 2 B, D, F, H Variable domain R11 Heavy chain 9606
158 4I1N 2 B Protein ca1697 (nanobody) 9844
159 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
160 6F0D 1 A, B VHH antibody BCD090-M2 9844
161 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
162 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
163 4W6X 2 B Nanobody NbFedF7 9844
164 5JA9 2 A, B Nanobody 6 9844
165 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
166 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
167 1OP9 1 A HL6 camel VHH fragment 9838
168 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
169 4LRN 1 H GEP 1 heavy chain 9606
170 4S11 1 A GELSOLIN NANOBODY 9844
171 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
172 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
173 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
174 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
175 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
176 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
177 4Y7M 1 A, B Hi113 protein 9844
178 5JMO 2 C, D camelid VHH fragment 9838
179 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
180 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
181 4B5E 1 A, B PS2-8 9844
182 2DQE 2 H Ig VH,anti-lysozyme 10090
183 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
184 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
185 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
186 4X7C 2 C, D Nano-85 Nanobody VHH 30538
187 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
188 3EBA 1 A CAbHul6 9838
189 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
190 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
191 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
192 5VM4 1 A, B, C, D, E, F, G, H, I, J, K, L Single domain camelid nanobody VHH T10 9844
193 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
194 4I0C 2 C, D cAbHuL5 antibody 9838
195 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
196 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
197 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
198 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
199 5BOP 1 A, C Nanobody 9844
200 4DKA 1 A, B single domain antibody VHH 9844
201 5O05 1 C, D Nanobody (VHH) Nano-42 30538
202 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
203 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
204 3DUU 2 B, D Ig-like protein 10090
205 3K74 2 B Nanobody 9844
206 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
207 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
208 6A3W 1 A, D, G, J utomilumab VH 9606
209 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
210 1SJV 1 A r9 llama VHH single domain antibody 9844
211 6CK8 1 A, B, C Llama antibody SD38 9844
212 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
213 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
214 6GZP 1 A Nanobody 9844
215 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
216 1UA6 2 H Ig VH,anti-lysozyme 10090
217 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
218 4W68 1 A, B Single domain antibody 9844
219 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
220 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
221 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
222 3EAK 1 A, B NbBCII10-FGLA 9838
223 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
224 4ORZ 3 C single domain antibody sdAb19 9844
225 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
226 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
227 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
228 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
229 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
230 5C1M 2 B Nanobody 39 9844
231 5F7K 2 C, D Nanobody Nb-ER19 9844
232 5LMJ 1 A, B, C, D nanobody 9844
233 5E1H 2 B F8(JOB10) VHH antibody 30538
234 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
235 4OCM 3 C, F Nb1 9844
236 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
237 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
238 4X7E 2 C, D Nano-85 Nanobody 30538
239 5F1O 2 B nanobody MU551 9844
240 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
241 5O03 2 C, D Nanobody (VHH) Nano-32 9844
242 2DQI 2 H Ig VH,anti-lysozyme 10090
243 4Y8D 2 C, D nanobody 9844
244 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
245 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
246 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
247 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
248 4C58 2 B NANOBODY 9844
249 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
250 3DV6 2 B Ig-like protein 10090
251 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
252 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
253 5VXM 2 B Single-domain antibody 20ipaD 30538
254 4XVJ 2 H antibody heavy chain variable domain 9606
255 4IDL 1 A Single Domain Antibody VHH A9 9844
256 1JV5 2 B Ig chain heavy chain precursor V region 9606
257 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
258 3K7U 1 A Antibody 9844
259 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
260 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
261 4NBY 2 B, C A20.1 VHH 9844
262 4X7D 2 C, D Nano-85 Nanobody VHH 9844
263 5VAN 2 B Nb914 Nanobody 9844
264 5F7N 2 C, D Nanobody Nb-ER19 30538
265 5OCL 1 A, C, F, H anti-llama nanobody 30538
266 5OCL 2 B, D, E, G anti-vglut nanobody 9844
267 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
268 2A9M 2 H, I fluorescein-scfv heavy chain 9606
269 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
270 1SJX 1 A immunoglobulin VH domain 9844
271 3ZKS 2 D XA4813 9844
272 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
273 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
274 5MY6 2 B Nanobody 2Rs15d 9838
275 3DUS 2 B, D Ig-like protein 10090
276 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
277 5M2I 2 G, H, I, J, K, L VHH1 9844
278 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
279 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
280 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
281 3K1K 2 C, D Enhancer 9838
282 4U7S 1 A, B sdAb A3 9844
283 4U3X 1 A, C Human VH domain antibody 9606
284 4W81 1 A Single Domain Antibody 9844
285 5GRV 1 L homo-specific diabody heavy chain 9606
286 5JMR 1 A, B camelid VHH fragment 9838
287 4W70 1 A Single Domain Antibody 9844
288 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
289 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
290 4BFB 2 D, E XA4813 9844
291 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
292 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
293 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
294 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
295 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
296 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
297 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
298 4LHQ 2 B, D Camelid nanobody 30538
299 3DV4 2 B Ig-like protein 10090
300 3ZKX 2 B XA4813 9844
301 3ZKX 3 C XA4815 9844
302 5F1K 2 C, D nanobody MU1053 9844
303 3ZLQ 2 C, D XA4813 9844
304 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
305 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
306 4NC0 2 B A26.8 VHH 9844
307 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
308 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
309 5GS1 2 B, N, P, R heavy chain 9606
310 5F7Y 3 C, D Nanobody Nb-ER19 9844
311 2DQG 2 H Ig VH,anti-lysozyme 10090
312 5IMO 1 B Nanobody 9835
313 5U65 1 A, B VHH-5 9838
314 4TYU 1 A, B Single Domain Antibody 9844
315 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
316 2DQH 2 H Ig VH,anti-lysozyme 10090
317 4AQ1 2 B, D NBKB6 VHH 9844
318 6FV0 2 F nanobody 9844
319 4EIG 2 B CA1698 camel antibody fragment 9844
320 3EHB 3 C FV fragment Chain H 10090
321 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
322 3HB3 3 C ANTIBODY FV FRAGMENT 10090
323 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
324 2X89 1 A, B, C ANTIBODY 9838
325 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
326 5O04 2 E, F Nanobody (VHH) Nano-26 30538
327 5O04 3 C, D Nanobody (VHH) Nano-85 30538
328 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
329 3P9W 2 B, D, F, H human VEGF 9606
330 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
331 5F8R 2 C, D Nanobody Nb-ER19 9844
332 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
333 4OCL 3 C, F Nb1 9844
334 4RAV 2 A, C single-chain Fv, VH 9606
335 5XJ4 2 H durvalumab-VH 9606
336 5LWY 2 H V REGION HEAVY CHAIN 10090
337 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
338 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
339 4IOS 2 D, E, F, G Llama nanobody 11 9844
340 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
341 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
342 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
343 4C57 2 C, D NANOBODY 9844
344 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
345 4OCN 3 C, F Nb1 9844
346 4GRW 3 E, G Nanobody 124C4 9844
347 4GRW 4 F, J Nanobody 37D5 9844
348 4GRW 5 H, I Nanobody 22E11 9844
349 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
350 4NC2 2 B B39 VHH 9844
351 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
352 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
353 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
354 6EY0 2 E, G, H llama nanobody nb01 9844
355 6EY0 3 F llama nanobody nb01 9844
356 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
357 5F9A 2 C Nanobody Nb-ER19 9844
358 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
359 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
360 5CBA 1 A, C 3b4 heavy chain 9606
361 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
362 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
363 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
364 2OTW 2 B, D Fv heavy chain variable domain VH 10090
365 3STB 1 A, B single domain antibody VHH 9844
366 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
367 4W6W 2 B NbFedF6 9844
368 5JA8 2 B, D, F, H Nanobody 2 9844
369 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
370 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
371 1P4B 2 H Antibody Variable heavy chain 10090
372 5U4M 2 B V1C7 VHH antibody 30538
373 5O0W 2 E, F, G, H Nb474 30538
374 4Y5V 1 A, D, G diabody 305 VH domain 9606
375 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
376 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
377 3V0A 3 C Llama antibody F12 9844
378 6FYU 3 C, F, I Single domain antibody SD36 9844
379 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
380 3K80 1 A, B Antibody 9844
381 5VAQ 2 B Nb914 Nanobody 9844
382 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
383 5F8Q 2 C, D Nanobody Nb-ER19 9844
384 4U05 1 A, B Single Domain Antibody 9844
385 5F9D 2 C Nanobody Nb-ER19 9844
386 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
387 4LGP 2 B, D VHH1 camelid nanobody 30538
388 2P48 2 B ANTIBODY CAB-RN05 9838
389 5U4L 2 B V1C7 VHH antibody G29R variant 30538
390 5VXK 1 B single-domain antibody JMK-H2 30538
391 5F7M 2 C, D Nanobody Nb-ER19 9844
392 5NBL 3 E, F nAct-Nanobody N-actin and Arp4 specific nanobody with a C-terminal double Strep-Tag. 30538
393 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
394 5F7W 2 C, D Nanobody Nb-ER19 9844
395 4YQX 1 H, N JES6-1 VH domain 10116
396 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
397 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
398 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
399 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
400 4NC1 2 C, D A20.1 VHH 9844
401 4NC1 3 E, F A26.8 VHH 9844
402 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
403 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
404 2DQF 2 B, E Ig VH,anti-lysozyme 10090
405 5E7F 1 A, B, C nanobody L06 9838
406 2P46 2 B, D ANTIBODY CAB-RN05 9838
407 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
408 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
409 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
410 5LHP 2 B Camelid-Derived Antibody Fragment 30538
411 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
412 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
413 5SV4 1 A, B Single Domain Antibody A3C8 9844
414 4LGS 2 B Camelid nanobody (VHH4) 30538
415 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
416 5Y80 2 B NANOBODY 9844
417 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
418 5CBE 1 A, C E10 heavy chain 9606
419 2P47 2 B ANTIBODY CAB-RN05 9838
420 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
421 3WXW 2 H V region heavy chain 10090
422 3K3Q 1 A llama Aa1 VHH domain 9844
423 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
424 1AR1 3 C ANTIBODY FV FRAGMENT 10090
425 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
426 5VNW 2 C, D Nb.b201 32630
427 1BVK 2 B, E HULYS11 FV 9606
428 6FE4 2 F, G, H, I, J Nb113 30538
429 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
430 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
431 5HVF 2 B VHH-i83 30538
432 1P4I 2 H antibody variable heavy chain 10090
433 4PGJ 1 A, C Human heavy chain domain antibody 9606
434 4KDT 1 A, B Nanobody24 9835
435 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
436 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
437 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
438 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
439 6FYT 3 I Single domain antibody SD38 9844
440 5MJE 2 B Nanobody 8 9844
441 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
442 3OGO 2 E, F, G, H GFP-nanobody 9838
443 4C59 2 B NANOBODY 9844
444 5VXL 2 B single-domain antibody JPS-G3 30538
445 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
446 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
447 4DK6 1 A, B single domain antibody VHH 9844
448 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
449 5F7L 2 B, D Nanobody Nb-ER14 9844
450 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
451 5HVG 2 B, D VHH-a204 30538
452 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
453 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
454 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
455 5HVH 2 B VHH-a204 30538
456 5HVH 3 C VHH-i83 30538
457 4XT1 3 C nanobody 7 30538
458 5LXG 2 H V REGION HEAVY CHAIN 10090
459 5HM1 1 A, B, C lama VHH antibody 2E7 9844
460 5NBM 3 E, F nAct-Nanobody N-actin and Arp4 binding nanobody with a C-terminal double Strep-Tag. 30538
461 5FUC 3 E, V VHH6 9838
462 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
463 3H3P 1 H, I Fv 4E10 heavy chain 9606
464 5O2U 2 B, D VHH 59H10 9844
465 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
466 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
467 5OMN 2 C Nanobody (VHH) Nano-27 30538
468 4KRP 2 B Nanobody/VHH domain 9G8 9844
469 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
470 6FUZ 2 N nanobody 9844
471 4FHB 2 D Nb179 9844
472 4DK3 1 A, B single domain antibody VHH 9844
473 4KRL 1 B Nanobody/VHH domain 7D12 9844
474 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
475 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
476 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
477 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
478 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
479 6MXT 2 N nanobody Nb71 9844
480 4LDE 2 B Camelid Antibody Fragment 9844
481 4Y5Y 1 A, D diabody 330 VH domain 9606
482 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
483 1BVL 1 A, C HULYS11 FV 10090
484 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
485 3RJQ 2 B Llama VHH A12 9844
486 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
487 6H7K 3 C, D Camelid antibody fragment Nb80 9844
488 6CF2 1 A Anti-Rev Antibody, heavy chain Fab single-chain variable fragment 9986
489 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
490 3LHP 1 H, I Fv 4E10 heavy chain 9606
491 5Y7Z 2 C, D NANOBODY 9844
492 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
493 6CK9 2 D 35O22 scFv heavy chain portion 9606
494 6EQI 2 B Nb696 9844
495 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
496 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
497 4KFZ 2 C, D Anti-LMO2 VH 9606
498 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
499 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
500 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
501 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
502 4YGA 2 B, D, F, H VHH-1B7 30538
503 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
504 2A9N 2 H, I fluorescein-scfv heavy chain 9606
505 5GS0 3 D, F heavy chain (anti-TLR3) 10090
506 5GS0 4 H, X heavy chain (anti-Lid) 10090
507 5YY5 2 H Heavy chain 9606
508 5YY5 4 C Heavy chain 9606
509 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
510 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
511 5GRJ 1 H avelumab H chain 9606
512 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
513 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
514 4KRO 2 B Nanobody/VHH domain EgA1 9844
515 3WXV 2 H V region heavy chain 10090
516 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
517 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
518 5TJW 2 K NP-specific inhibitory VHH 30538
519 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
520 6H7M 3 C, D Camelid antibody fragment Nb6B9 562
521 4LDL 2 B Camelid Antibody Fragment 9844
522 4LDO 2 B Camelid Antibody Fragment 9844
523 5XJ3 1 A, D, G, J ipilimumab-VH 9606
524 3SN6 5 N Camelid antibody VHH fragment 9844
525 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
526 4M8Q 1 A, H GEP1 Fv heavy chain 9606
527 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
528 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
529 5O8F 2 K, O Nanobody Nb25 9844
530 5O8F 3 L, M, N Nanobody Nb25 9844
531 5NQW 2 C, D 026 9844
532 5C3L 4 D Nanobody Nb15 Nanobody 9838
533 5J3H 2 C mAb 83-7 Fab heavy chain 10090
534 5U8R 2 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
535 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
536 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
537 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
538 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
539 6H7J 3 C, D Camelid antibody fragment Nb80 9844
540 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
541 6B73 2 C, D Nanobody 9844
542 4PIR 2 F, G, H, I, J VHH15 9844
543 5XWD 2 H VH chain of 059-152 9606
544 6C5W 2 C, E nanobody 32644
545 4QKX 2 B R9 protein 9844
546 5JQH 2 C, D Nanobody60, Nb60 9844
547 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
548 4PD4 10 J Igh protein 10090
549 6C9W 2 B Nanobody9047 Full 9844
550 5DA0 2 B Nanobody 9844
551 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
552 5U8Q 3 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
553 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
554 4ODX 2 A, H GEP7 Fv heavy chain 9606
555 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
556 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
557 1RVF 6 H FAB 17-IA 10090
558 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
559 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
560 4MQS 2 B Nanobody 9-8 9844
561 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
562 5WB2 3 D nanobody B1 32630
563 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
564 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
565 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
566 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
567 4MQT 2 B Nanobody 9-8 9844
568 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
569 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
570 6CNV 3 C SD84h 32630
571 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
572 4NKO 2 B, D, F Engineered scFv heavy chain 10090
573 5EUL 4 V AYC08 30538
574 5GXB 2 B nanobody 30538
575 5NBD 2 C Nanobody 9844
576 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
577 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
578 5H8O 1 A VHH nanobody 9844
579 4KSD 2 B R2 protein 9844
580 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
581 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
582 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
583 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
584 5WDU 2 D, O, W bnAb NIH45-46 scFv heavy chain 9606
585 5TD8 5 E nanobody 30538
586 6MF7 2 H antibody 860-55D heavy chain Fab 9606
587 6AJ7 2 H VH of Fab 15C5 10090
588 6AJ9 2 D VH of Fab 11G1 10090
589 6AJ9 4 H VH of Fab 15C5 10090
590 6AD0 2 H VH of Fab 2G8 10090
591 6E3Y 2 N Nanobody 35 9844
592 6A96 1 K, L, O Nb25 9844
593 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
594 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
595 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
596 6CUE 3 3, H, h vFP7.04 Heavy chain 10090
597 6CUE 5 5, M, m PGT122 heavy Chain 9606
598 6CUE 7 7, Q, q VRC03 Heavy chain 9606
599 6CUF 3 5, M, m PGT122 Heavy chain 9606
600 6CUF 6 8, Q, q VRC03 heavy chain 9606
601 6CDI 4 5, M, m PGT122 Heavy Chain 9606
602 6BSP 1 A U4 Heavy chain 10090
603 6B3J 6 N Nanobody 35 9844
604 6EHG 3 C hC3Nb1 9844
605 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
606 5XS7 2 H Heavy chain of Fab 1D5 10090
607 5W3L 5 E C5 antibody variable heavy domain 10090
608 5W3M 1 E C5 antibody variable heavy domain 10090
609 5W3O 1 D C5 antibody variable heavy domain 10090
610 5W3E 1 E C5 antibody variable heavy domain 10090
611 5VAI 6 N nanobody 35 9844
612 5UZ7 4 N NANOBODY 35 9844
613 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
614 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
615 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
616 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
617 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
618 5H30 3 G, I, K IgG C10 heavy chain 9606
619 5KWL 4 7 VHH 10E 9838
620 5KTZ 4 7 VHH 12B 9838
621 5KU0 4 7 VHH 17B 9838
622 5KU2 4 7 VHH 7A 9838
623 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
624 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
625 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
626 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
627 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
628 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
629 3JCX 2 H Fab E heavy chain 10116
630 5FOJ 1 A NANOBODY 9838
631 3JBC 5 7 nanobody VHH PVSP29F 9838
632 3JBD 5 7 nanobody VHH PVSP6A 9838
633 3JBE 5 7 nanobody VHH PVSS8A 9838
634 3JBF 5 7 nanobody VHH PVSP19B 9838
635 3JBG 5 7 nanobody VHH PVSS21E 9838
636 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
637 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
638 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
639 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
640 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
641 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
642 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
643 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
644 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
645 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
646 3J6U 3 H Fab 5J7 heavy chain variable region 9606
647 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
648 3IY1 2 B Fab B, heavy chain 10116
649 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
650 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
651 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
652 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
653 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
654 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
655 3IY0 2 H Fab 14, heavy domain 10090
656 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
657 1G9E 1 A H14 9844
658 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
659 1VHP 1 A VH-P8 9606