Sequence Similarity Clusters for the Entities in PDB 1NGY

Entity #1 | Chains: A
Mature Metal Chelatase Catalytic Antibody, Light chain protein, length: 213 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 4 6 8330
95 % 4 6 8396 Flexibility: Low
Max RMSD: 5.6, Avg RMSD: 2.3
PDBFlex
90 % 363 832 2
70 % 1156 2670 1
50 % 2368 5421 1
40 % 2711 6121 1
30 % 3275 7588 1
Entity #2 | Chains: B
Mature Metal Chelatase Catalytic Antibody, Heavy chain protein, length: 216 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 52977
95 % 4 6 8336 Flexibility: Medium
Max RMSD: 6.9, Avg RMSD: 3.6
PDBFlex
90 % 6 8 7081
70 % 1146 2629 2
50 % 2369 5421 1
40 % 2712 6121 1
30 % 3276 7588 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 6BJZ 2 L 5c8 Fab Light chain 9606
4 4XCF 1 L 4E10 Fab light chain 9606
5 5X08 2 L Fab 4E10 Light chain 9606
6 4XAW 1 L 4E10 Fab light chain 9606
7 5UCB 2 L Fab Light Chain 9606
8 2VXV 2 L HUMAN IGG ABT-325 9606
9 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
10 5I8C 2 B VRC34.01 Fab light chain 9606
11 5WK2 1 L M116 LIGHT CHAIN 9606
12 3PP4 2 L GA101 Fab light chain 10090
13 4PTU 1 A Antibody pn132p2C05, light chain 9606
14 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
15 4XC3 1 L 4E10 Fab light chain 9606
16 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
17 5VSI 2 L CH1/Ckappa Fab light chain 9606
18 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
19 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
20 4NWU 2 L APE1551 Ab Fab light chain 9606
21 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
22 5EWI 2 L VRC38.01 Light Chain 9606
23 5E2W 1 L AT8 LIGHT CHAIN 10090
24 5E2V 1 L AT8 LIGHT CHAIN 10090
25 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
26 6CA7 1 L PCT64_13C light chain 9606
27 5OB5 3 L fAb Light chain 9606
28 3QQ9 1 C, L 101F LIGHT CHAIN 10090
29 5I1K 1 L FAB LIGHT CHAIN 9606
30 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
31 5V7U 1 L CBTAU-22.1 Fab light chain 9606
32 5UEA 3 B, L Fab Light Chain 9606
33 5NMV 1 L Fab light chain 10088
34 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
35 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
36 3QRG 1 L Fab light chain 9606
37 3NCJ 1 L Fab15 Mut8 light chain 9606
38 5W05 1 L M59 FAB LIGHT CHAIN 10090
39 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
40 1UM5 1 L Antibody 21H3 L chain 10090
41 4NWT 1 L APE1531 Ab Fab light chain 9606
42 3NA9 1 L Fab15 light chain 9606
43 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
44 4LRI 1 A, B MSL-109 Light Chain 9606
45 4JN2 1 A, L anti dabigatran Fab 10090
46 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
47 5U6A 1 A Light Chain 9606
48 4HHA 1 A Fab KE5 Fab fragment KE5 9606
49 5UEK 3 L Fab 12E Light Chain 9606
50 3NAA 1 L Fab15 Mut5 light chain 9606
51 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
52 5IK3 2 B, D 1E03 Fab fragment light chain 9606
53 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
54 5U3O 2 L DH511.2_K3 Fab Light Chain 9606
55 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
56 5IT2 2 L light chain 9606
57 6DW2 1 A 6078 Fab light chain 9606
58 6BQB 1 L MGG4 Fab light chain 9606
59 4PUB 2 L DX-2930 LIGHT CHAIN 9606
60 6B14 2 L Light chain of Fab BL3-6S97N 10090
61 5VKD 3 L Fab light chain 9606
62 5XHG 1 A, C polypeptide(L) 10090
63 3OAZ 2 K, L Fab 2G12, light chain 9606
64 4YGV 2 B, L aDabi-Fab2a light chain 9606
65 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
66 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
67 3EO0 1 A, C GC-1008 Fab Light Chain 10090
68 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
69 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
70 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
71 4JHA 2 L D25 light chain 9606
72 6B9Z 1 A Trastuzumab Fab light chain 10090
73 4PTT 1 A Antibody pn132p2C05, light chain 9606
74 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
75 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
76 4DGV 2 L HCV1 Light Chain 9606
77 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
78 3IU4 2 L chP3 Fab light chain 10090
79 3P0Y 3 L Fab DL11 light chain 9606
80 6ANA 3 L LL2 Fab Light Chain 10090
81 5IBU 1 B, L 6652 Light Chain 9606
82 6AOD 1 A FXIa Antibody FAB Light Chain 9606
83 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
84 6ELE 2 B, L fAB light chain 9606
85 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
86 3NAC 1 L Fab15 Mut7 light chain 9606
87 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
88 4YHO 2 L aDabi-Fab3 light chain 9606
89 4DGY 2 L HCV1 Light Chain 9606
90 3MXW 2 L 5E1 light chain 9606
91 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
92 3EO9 1 L Efalizumab Fab fragment, light chain 9606
93 5WUV 1 L light chain 9606
94 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
95 6B0G 1 C 1245 Antibody, Light Chain 9606
96 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
97 6BAH 1 A Trastuzumab Fab light chain,Immunoglobulin kappa constant 10090
98 6D0X 2 B 1210 Antibody, light chain 9606
99 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
100 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
101 5TL5 1 L M2177 LIGHT CHAIN 10090
102 2FX7 1 L Fab 4E10 Light Chain 9606
103 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
104 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
105 5XKU 2 B HNIgGA6 light chain 9606
106 5I18 1 L FAB LIGHT CHAIN 9606
107 4JN1 2 L anti-dabigatran Fab1, light chain 10090
108 6HKG 2 B FISW84 Fab Fragment Light Chain 9606
109 3SOB 1 L antibody light chain 9606
110 6B5M 2 L CIS43 Fab Light chain 9606
111 4ZFO 2 L J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
112 4ZFO 4 B J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
113 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
114 5DR5 2 L AbD09097 Fab light chain 9606
115 4KQ3 1 L CNTO3186 light chain Fab 9606
116 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
117 4I77 2 L Lebrikizumab light chain Fab 9606
118 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
119 4HJG 1 A Trastuzumab light chain 9606
120 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
121 3FN0 1 L Fab Z13e1 light chain 9606
122 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
123 4YHI 2 B, L aDabi-Fab2a light chain 9606
124 5NYX 2 L, N, P LIGHT CHAIN fab light chain 9606
125 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
126 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
127 6ELJ 2 B, L fAB light chain 9606
128 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
129 4MAU 1 L C2244 light chain SEE REMARK 999 10090
130 1OP3 1 K, L FAB 2G12, light chain light chain 9606
131 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
132 4LKX 2 B Fab fragment light chain 9606
133 5JW5 2 B, L MEDI8852 Light chain 9606
134 6DCV 1 A, L Light chain of CBTAU27.1 Fab 9606
135 3QWO 1 B, L motavizumab light chain 10090
136 4IOI 1 A Trastuzumab light chain 9606
137 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
138 6GHG 2 B, L Fab light chain 9606
139 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
140 5VAG 2 B Light chain of antibody m826 9606
141 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
142 5I16 1 A, L FAB LIGHT CHAIN 9606
143 5F9O 3 L CH235.09 Light chain 9606
144 1UM4 1 L Antibody 21H3 L chain 10090
145 4RBP 1 K, L Fab 2G12 light chain 9606
146 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
147 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
148 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
149 6DCW 1 L Light chain of CBTAU27.1 Fab 9606
150 5GGQ 1 L nivolumab light chain 9606
151 6B5N 2 L CIS43 Fab Light chain 9606
152 3OAY 1 K, L Fab 2G12, light chain 9606
153 6AND 3 L Pinatuzumab Fab light chain 9606
154 5K9J 2 L 56.a.09 light chain 9606
155 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
156 5TF1 2 L O2-CC Fab Light Chain 9606
157 3TCL 2 B, L CH04 Light Chain Fab 9606
158 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
159 5F7E 2 L Fab light chain 9606
160 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
161 5FHA 2 L Antibody 114 Fab light chain 9606
162 5UMN 3 D, F Antibody C05, light chain 9606
163 4X7S 2 L Ig kappa chain C region residues 23-236 9606
164 1UM6 1 L antibody 21h3, L chain 10090
165 4X0K 2 B, L Fab fragment light chain 9606
166 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
167 5E8E 1 A IGA FAB LIGHT CHAIN 9606
168 6ELL 2 B, L fAB light chain 9606
169 2HFF 1 A, L CB2 Fab, light chain 9606
170 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
171 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
172 5GGS 2 B, D light chain 9606
173 6DG2 2 B, D 6D6 Fab light chain 10090
174 5I1L 1 A, L FAB LIGHT CHAIN 9606
175 5GGV 1 L light chain 9606
176 3L5X 1 L H2L6 LIGHT CHAIN 9606
177 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
178 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
179 2R8S 2 L Fab light chain 10090
180 4HKZ 1 A Trastuzumab light chain 9606
181 6DB8 3 L Fab-Light chain 32630
182 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
183 3SO3 2 B A11 FAB light chain 9606
184 3OAU 2 L Fab 2G12, light chain 9606
185 5WEQ 1 A MR78 mutant light chain 9606
186 4WY7 2 L Fab 4E10Light chain 9606
187 4ZYK 2 B, L AM14 light chain 9606
188 6DWA 1 A, L 4497 Fab Light Chain 9606
189 6C9U 2 L Light chain of Fab 1B2 9606
190 5E94 1 A, C Antibody Fab fragment light chain 10090
191 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
192 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
193 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
194 4HIE 1 A Fab 023.102 9606
195 4LEX 1 L FAB HEAVY CHAIN 10090
196 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
197 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
198 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
199 5Y11 2 B MAb 4-5 light chain 9606
200 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
201 4KMT 1 L light chain O12/KAPPA Fab 9606
202 3NZH 1 L 5F6 LIGHT CHAIN 10090
203 1RHH 1 A, C Fab X5, light chain 9606
204 6CW3 2 B, D antibody light chain 9606
205 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
206 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
207 4XTR 3 D, F Antibody Light chain 32630
208 1RZ7 1 L Fab 48d light chain 9606
209 1RZG 2 B, D Fab 412d heavy chain 9606
210 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
211 3PGF 3 L SAB Light Chain 9606
212 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
213 6DFJ 2 L anti-Zika antibody Z021, Light Chain 9606
214 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
215 4YHL 2 L aDabi-Fab2b light chain 9606
216 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
217 6B9Y 1 A Trastuzumab Fab light chain 9606
218 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
219 2QQN 3 L Antibody light chain 9606
220 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
221 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
222 6BAE 1 A Trastuzumab Fab light chain 10090
223 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
224 4YHM 2 L aDabi-Fab2b light chain 9606
225 6H0E 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF dmCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
226 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
227 3X3F 2 L Light chain of KMTR2 9606
228 2CMR 3 L D5 9606
229 5ZV3 3 L Light chain (kappa) of antibody CBTAU28.1 9606
230 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
231 5CZX 3 D, L 20358 Fab light chain 9606
232 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
233 3GRW 2 L Fab light chain 9606
234 6B3K 2 L Light chain of Fab BL3-6 10090
235 6C6Z 3 D, L Antibody CDC2-C2 light chain 9606
236 5I1D 1 A, L FAB LIGHT CHAIN 9606
237 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
238 6AYZ 2 C, D Fab Light Chain 9606
239 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
240 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
241 6CDO 2 B vFP16.02 Fab light chain 10090
242 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
243 5DRX 2 B, L CLL240 BCR light chain 9606
244 4HIX 2 L Humanized 3D6 Fab light chain 10090
245 4LKC 1 A Fab fragment of PCSK9 antibody 9606
246 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
247 4KZD 2 L BL3-6 Fab antibody, light chain 10090
248 4HCR 2 L, N PF-547659 light chain 9606
249 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
250 4HIH 1 A, C Fab 023.102 9606
251 4YHK 2 L aDabi-Fab2a light chain 9606
252 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
253 5IES 2 L VRC01cHuGL2 Fab light chain 9606
254 4UV7 3 L GC1118A 9606
255 5TKJ 2 B, E, H, K vFP1.01 chimeric mouse antibody light chain 10090
256 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
257 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
258 3S34 1 L 1121B Fab light chain 10090
259 6AZX 2 B, D 663 antibody, light chain 9606
260 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
261 5E2T 1 L AT8 LIGHT CHAIN 10090
262 6EMJ 2 B, L fAb light chain 9606
263 5W1G 2 L CR1-07 Fab light chain 9606
264 6CNR 1 L Aducanumab light chain 9606
265 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
266 2AJ3 1 A, C, E Fab m18, Light Chain 9606
267 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
268 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
269 4NRX 3 B, E, L m66 Light Chain 9606
270 3O2D 1 L ibalizumab light chain 10090
271 6DB9 3 L Fab-Light-Chain 32630
272 6DDV 3 A Anti-MICA Fab fragment light chain clone 6E1 10090
273 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
274 5O14 3 D, L Fab 1A12 Light Chain 9606
275 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
276 5V7R 1 L CBTAU-7.1 Fab light chain 9606
277 6B5O 2 L CIS43 Fab Light chain 9606
278 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
279 2R0L 1 L antibody light chain 32630
280 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
281 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
282 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
283 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
284 3Q1S 1 L Z13e1 Fab light chain 9606
285 6DWC 1 A, L 4497 Fab Light Chain 9606
286 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
287 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
288 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
289 5VZ1 1 A, C Apo Antibody Fab Light Chain 9606
290 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
291 5OD8 2 B B2 Fab fragment - Light chain 9606
292 3KR3 3 L antibody-Fab (light chain) 9606
293 5DK3 1 A, F Light Chain 9606
294 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
295 6DZN 1 L Antibody ADI-15878, light chain 9606
296 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
297 4YHN 2 B, L aDabi-Fab3 light chain 9606
298 5GGU 2 B, L light chain 9606
299 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
300 4D9Q 2 D, L Anti-Factor D, light chain 9606
301 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
302 5KW9 3 L IgA Light chain 9606
303 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
304 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
305 5W2B 2 L Fab Light Chain 9606
306 5DRW 2 B CLL183 BCR antibody light chain 9606
307 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
308 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
309 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
310 5MVZ 2 B, L Fab 4AB007 L-chain 9606
311 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
312 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
313 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
314 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
315 2FX9 1 L, M Fab 4E10 Light Chain 9606
316 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
317 6AXL 1 B, C Fab317 light chains 9606
318 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
319 1TZG 1 L, M Fab 4E10 light chain 9606
320 3W9D 2 B, D Antibody Fab light chain 9606
321 6CO3 1 L Fab light chain 9606
322 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
323 3BN9 2 C, E E2 Fab Light Chain 9606
324 6EYN 1 A, C, L 8D6 Fab light chain 8D6 Fab light chain 9606
325 4HWE 2 L Fab light chain light chain 9606
326 5TZ2 2 L C47B222 Fab Light Chain 9606
327 6MLK 2 L Light chain of Fab 3A6 9606
328 6CDM 2 B, E vFP7.04 light chain 10090
329 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
330 4OGX 3 L DX-2930 LIGHT CHAIN 9606
331 3W9E 3 B Antibody Fab light chain 9606
332 5TFS 2 L 02-K Fab Light chain 9606
333 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
334 5E2U 1 L AT8 LIGHT CHAIN 10090
335 1OM3 1 L, M FAB 2G12, light chain light chain 9606
336 4KZE 2 L BL3-6 Fab antibody, light chain 10090
337 5WT9 2 L Light Chain of Nivolumab 9606
338 4HIJ 1 A, C Fab 023.102 light chain 9606
339 6MU3 1 K, L Fab 2G12, light chain 9606
340 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
341 4XVU 3 D, F, J, L Antibody light chain 32630
342 5B71 1 A, C SKY59 Fab light chain 9606
343 6BF4 3 C, L VRC-PG05 Fab light chain 9606
344 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
345 3EYF 1 A, C 8f9 Fab 9606
346 3NAB 1 L Fab15 Mut6 light chain 9606
347 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
348 5I1C 1 L FAB LIGHT CHAIN 9606
349 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
350 5WNA 2 D, L mAb 3D3 Fab light chain 9606
351 1RZ8 1 A, C Fab 17b light chain 9606
352 4WV1 3 A, D Fab light chain 9606
353 6ANP 1 A, L CAT192 Fab Light chain 9606
354 5EII 2 B, L Fab Light Chain 9606
355 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
356 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
357 4FNL 2 L, M Antibody C05, Light Chain 9606
358 4UB0 2 L IgG1, light chain 9606
359 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
360 1BJ1 1 J, L Fab fragment, light chain HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
361 5I1H 1 L FAB LIGHT CHAIN 9606
362 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
363 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
364 6BFT 1 B, L Avastin Light Chain Fab fragment mutant 9606
365 6DFI 2 L anti-Zika antibody Z021, Light Chain 9606
366 5I1J 1 L FAB LIGHT CHAIN 9606
367 3IDX 3 L Fab b13 light chain 9606
368 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
369 6AO0 1 L CAT192 Fab Light chain 9606
370 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
371 4K94 1 L Fab19 heavy chain 9606
372 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
373 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
374 6B5L 2 L CIS43 Fab Light Chain 9606
375 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
376 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
377 5XAJ 2 B, L FabHM14c10 light chain 9606
378 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
379 5VEB 2 B, L anti-CDH6 Fab light chain 9606
380 5VZX 2 I, L Crenezumab Fab light chain 9606
381 6DWI 1 A, C, E, G, I, K, M, O 4462 Fab Light Chain 9606
382 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
383 3X3G 2 L Light chain of KMTR2 9606
384 5WAW 1 L fAb Light Chain 9606
385 5E08 2 L Fab Light Chain 9606
386 6AZ2 3 E, F Fab Light Chain 9606
387 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
388 5IBT 2 L UCA Light Chain 9606
389 6CA6 1 A, L PCT64_35S light chain 9606
390 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
391 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
392 1A4K 1 A, L ANTIBODY FAB FAB 10090
393 5MO9 2 L AB20 Fab light chain 10090
394 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
395 5XRQ 2 B, L Fab H3v-47 light chain 9606
396 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
397 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
398 4NGH 1 L FAB LIGHT CHAIN 9606
399 5WB9 3 L N60P23 Fab light chain 9606
400 4EDW 2 L tanezumab Fab light chain 9606
401 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
402 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
403 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
404 4NM4 1 L, M Antibody CR8043, Light Chain 9606
405 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
406 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
407 4D9R 2 D, L Fab light chain 9606
408 3U7W 2 L Light chain, Ig kappa chain C region 9606
409 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
410 4G7V 2 L fragment antibody light chain 9606
411 5W06 2 L M1587 FAB LIGHT CHAIN 10090
412 4HFW 1 A, L 6-26 Fab Light chain 9606
413 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
414 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
415 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
416 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
417 5JO4 2 B D80 Fab Light Chain 9606
418 5JO4 4 D G6 Fab Light Chain 9606
419 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
420 3INU 2 L, N KZ52 antibody fragment light chain 9606
421 5EU7 3 C, D FAB light chain 9606
422 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
423 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
424 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
425 6CDP 2 B vFP20.01 Fab light chain 10090
426 5X8M 3 C durvalumab light chain 9606
427 6AMJ 1 A, L CAT192 Fab light chain 9606
428 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
429 4HII 1 A, C Fab 023.102 light chain 9606
430 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
431 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
432 4DN3 1 L CNTO888 LIGHT CHAIN 9606
433 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
434 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
435 5WNB 2 L, M mAb 3D3 Fab light chain 9606
436 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
437 3EYV 1 A, L hu3S193 Fab, light chain 10090
438 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
439 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
440 3PP3 2 K, L GA101 Fab light chain 10090
441 5IJK 3 C, D 1E03 Fab fragment light chain 9606
442 3BDY 2 L Fab Fragment -Light Chain 9606
443 5I8E 2 B, D VRC34.01 Fab light chain 9606
444 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
445 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
446 5UIX 2 L DH576 Fab light chain 9606
447 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
448 6MFT 2 B, L Light chain glVRC01 9606
449 4HWB 3 L Fab light chain 9606
450 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
451 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
452 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
453 2HFG 1 L CB3s Fab light chain (kappa) 9606
454 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
455 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
456 5ZIA 2 B, E, I, L, M, P Light chain (kappa) of CBTAU-24.1 antibody 9606
457 4JQI 3 L Fab30 light chain 10090
458 6B0H 3 A, C 1262 antibody, light chain 9606
459 3SKJ 1 L, M Antibody, light chain 9606
460 3U30 2 B, E Light chain Fab 9606
461 6B0A 2 L 1269 antibody, light chain 9606
462 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
463 3U0T 1 A, C ponezumab LC Fab 9606
464 5HYS 2 B, D, F, L Uncharacterized protein 9606
465 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
466 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
467 5I15 1 L FAB LIGHT CHAIN 9606
468 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
469 5I1E 1 L FAB LIGHT CHAIN 9606
470 2NYY 2 C CR1 monoclonal antibody light chain 9606
471 2GCY 1 A huC25 fab fragment light chain 10090
472 4JLR 2 B, L Motavizumab Fab light chain 9606
473 2QQK 3 L Antibody Light Chain 9606
474 4J1U 1 A, C, E antibody 93F3 Light chain 10090
475 5N4G 2 L LIGHT CHAIN 9606
476 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
477 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
478 5SX5 1 K, L Panitumumab Fab Light Chain 9606
479 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
480 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
481 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
482 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
483 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
484 5BK2 3 D, L sAB Light Chain 9606
485 1TZH 2 A, L Fab YADS1 Light Chain 10090
486 5O1R 3 L, M Uncharacterized protein 9606
487 6CMI 2 C m102.3 light chain 9606
488 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
489 4JZJ 3 B, L Fab Light Chain 10090
490 5BMF 2 L Fab fragment light chain 9606
491 5BO1 3 L, M Fab light chain 9606
492 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
493 4M6O 1 L CNTO7309 light chain 9606
494 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
495 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
496 5LSP 3 L, T 107_A07 Fab light chain 9606
497 4DVR 2 L Fab 48d Light chain 9606
498 3EYQ 1 C M2J5 Fab 9606
499 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
500 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
501 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
502 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
503 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
504 4XXD 1 A, D Fab Light Chain 9606
505 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
506 6BGT 2 A Herceptin light chain mutant 9606
507 6H06 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF HCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
508 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
509 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
510 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
511 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
512 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
513 3DVG 1 A Human IgG1 fab fragment light chain 9606
514 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
515 2AGJ 1 L Yvo Fab, Light Chain 9606
516 4JKP 3 L Light chain of antibody 45-46M2 9606
517 3EYO 1 A, C 8f9 Fab 9606
518 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
519 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
520 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
521 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
522 4DN4 1 L CNTO888 LIGHT CHAIN 9606
523 5TRP 2 L DH272 Fab light chain 9606
524 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
525 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
526 2FJG 2 A, L Fab light chain 9606
527 4DKF 3 L, M FAb2 Light Chain 9606
528 5TLK 1 A, E M2177 LIGHT CHAIN 10090
529 5TLK 3 C, G H2191 LIGHT CHAIN 10090
530 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
531 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
532 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
533 3EFD 1 L FabL 10090
534 4LF3 1 A, D Fab heavy chain 10090
535 5K59 4 F, L Fab light chain 9606
536 6MUB 1 K, L Fab 2G12, light chain 9606
537 6BFQ 2 B, D, F, L Fab Light Chain 9606
538 5WI9 2 E, L 39F7 Fab light chain 9606
539 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
540 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
541 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
542 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
543 4LEO 2 B RG7116 Fab light chain 10090
544 4G7Y 2 L Fragment antibody light chain 9606
545 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
546 4PY8 4 J antibody 3.1 light chain Fab 9606
547 3SDY 4 L Antibody CR8020, Light Chain 9606
548 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
549 3IXT 1 B, L Motavizumab Fab light chain 10090
550 6FAX 1 L Lob 7.4 light chain 9606
551 4NP4 3 L, M bezlotoxumab light chain 9606
552 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
553 4XCE 1 B, D, L 4E10 Fab light chain 9606
554 5I1I 1 L FAB LIGHT CHAIN 9606
555 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
556 4ERS 1 L Fab light chain 9606
557 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
558 4MWF 2 B, L Fab AR3C light chain 9606
559 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
560 3SQO 3 L J16 Light chain 9606
561 4K3J 4 L Onartuzumab Fab light chain 10090
562 6CYF 2 C, E, L, T IgG1 antibody, kappa light chain 9606
563 4PS4 1 L M1295 LIGHT CHAIN 9606
564 5GGT 3 L IGK@ protein 9606
565 6MNF 1 K, L Fab 2G12, light chain 9606
566 3HI1 2 A, L F105 Light Chain 9606
567 4PY7 2 B, J antibody 3.1 light chain Fab 9606
568 6AL5 2 L B43 LIGHT CHAIN 9606
569 4K8R 3 C Fab1, light chain 9606
570 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
571 5VOB 7 L Fab 8I21 light chain 9606
572 6CMG 2 B m102.3 light chain 9606
573 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
574 6ML8 4 L C05 antibody Fab light chain 9606
575 1TZI 1 A Fab YADS2 Light Chain 10090
576 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
577 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
578 4X7T 2 B, L Omalizumab-Fab Light chain 9606
579 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
580 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
581 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
582 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
583 5XMH 2 C, L YES8c light chain 9606
584 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
585 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
586 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
587 5I1G 1 L FAB LIGHT CHAIN 9606
588 2QQL 3 L Antibody Light Chain 9606
589 4XCC 1 L 4E10 Fab light chain 9606
590 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
591 5SX4 1 I, L Panitumumab Fab Light Chain 9606
592 3WD5 2 L Adalimumab Light Chain 9606
593 4NHC 1 L FAB LIGHT CHAIN 9606
594 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
595 5GZO 3 D, L Antibody light chain 9606
596 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
597 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
598 5GMQ 3 C MCA1 light chain 9606
599 6CA9 1 A, C PCT64_LMCA Fab light chain 9606
600 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
601 4HFU 4 L Fab 8M2 light chain 9606
602 5TRU 1 L, l Ipilimumab Fab light chain 9606
603 4FP8 3 L, M, N, O Antibody C05, light chain 9606
604 4YPG 1 A, L Sifalimumab light chain 9606
605 6CW2 4 B antibody light chain 9606
606 3BE1 3 L Fab Fragment-Light Chain 9606
607 2FJH 2 A, L Fab fragment light chain 9606
608 5XEZ 3 D, L Antibody, mAb1, light chain 9606
609 4K9E 1 L light chain 10090
610 3P0V 1 L, M Fab DL11 light chain 9606
611 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
612 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
613 5VIG 2 B, L Fab light chain 9606
614 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
615 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
616 4KVN 3 L Human IgG Light Chain 9606
617 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
618 5VYF 1 A, L Antibody light chain 10090
619 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
620 5WUX 2 B, D, L light 9606
621 3OB0 1 K, L Fab 2G12, light chain Fab 9606
622 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
623 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
624 6GK7 1 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-27.1(S31Y,T100I) FAB ANTIBODY FRAGMENT 9606
625 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
626 5DUM 2 L 65C6 Light Chain 9606
627 4I18 1 B, L antibody light chain Fab 10090
628 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
629 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
630 3IDY 3 C, L Fab b13 light chain 9606
631 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
632 3IVK 1 B, L Fab light chain man 10090
633 3KYK 2 L Light Chain Li33 IgG1 9606
634 5TGB 2 B, L 02-CB Fab Light Chain 9606
635 5I19 1 L FAB LIGHT CHAIN 9606
636 5TH9 1 L, M, N GS-5745 Fab light chain 9986
637 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
638 4IRZ 2 L Fab Natalizumab light chain 9606
639 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
640 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
641 6GK8 2 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-28.1(S32R;E35K) FAB ANTIBODY FRAGMENT 9606
642 5FEC 2 B, L germline 3BNC60 light chain 9606
643 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
644 2R56 2 L, M IgE Fab Fragment, light chain 9606
645 1ZA6 1 A, C, E, G IGG Light chain 9606
646 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
647 6FGB 3 L 1519.g57- Light chain 9606
648 4ZS6 1 D, L fab Light Chain 9606
649 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
650 6APB 3 L ADI-14359 Fab Light Chain 9606
651 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
652 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
653 5K9K 2 B, L 56.a.09 Light chain 9606
654 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
655 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
656 5W4L 6 C, E Antibody N12-i3 light chain 9606
657 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
658 6D01 2 B, D, F, H 1210 Antibody, Light chain 9606
659 5CZV 3 L Fab 20350 light chain 9606
660 5XF1 3 D, L Antibody mAb1 Light chain 9606
661 4P59 3 L MOR09825 Fab fragment light chain 9606
662 5XXY 2 L light chain of atezolizumab fab 9606
663 5CJO 3 L FAB light chain 10090
664 4LMQ 3 I, L Stromal cell-derived factor 1 9606
665 3N85 2 L Fab37 Light Chain 9606
666 6AMM 1 L CAT192 Fab Light chain 9606
667 3G6J 3 E, G Fab light chain 9606
668 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
669 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
670 6B9J 3 B, L Fab vv138 Light chain 9606
671 5O4G 2 A MF3958 FAB light chain 9606
672 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
673 4DKE 3 L, M FAb1.1 Light Chain 9606
674 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
675 5I17 1 A, L FAB LIGHT CHAIN 9606
676 5VIC 2 L Fab light chain 9606
677 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
678 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
679 4R8W 4 L Light chain of neutralizing antibody CT149 9606
680 5TPN 3 L hRSV0 light chain 9606
681 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
682 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
683 4NRY 1 B, L m66 Heavy Chain 9606
684 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
685 3S37 1 L 1121B Fab light chain 10090
686 5TZT 1 B, L Light Chain of Fab C47B161 9606
687 5XHF 1 A, C polypeptide (L chain) 10090
688 5VL7 4 L Fab33 light chain 9606
689 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
690 5JXE 2 C, F Pembrolizumab Fab light chain 9606
691 5KZC 3 D, G, L VRC01 Fab light chain 9606
692 5W42 4 L Fab H3v-47 light chain 9606
693 4JM2 3 C 17b Light chain Fab 9606
694 1S78 2 C, E Pertuzumab Fab light chain 10090
695 1OP5 1 K, L FAB 2G12, light chain light chain 9606
696 5BK0 1 A, C 663 Antibody, light chain 9606
697 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
698 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
699 5D1Z 1 A, H Y10 Light Chain 9606
700 5D1Z 3 C, E D4-10 Light Chain 9606
701 5GGR 2 B, L light chain 9606
702 5IBL 4 D, L 6639 Light Chain 9606
703 4XHJ 3 C, G Fab-RC light chain 9606
704 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
705 5O4O 1 A MF3178 FAB light chain 9606
706 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
707 4N90 3 E, G, I Fab light chain 9606
708 5BK5 2 A, C, E, G 663 germline antibody, light chain 9606
709 5VGJ 3 L VRC38.01 Fab Light Chain 9606
710 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
711 6B0E 1 A 1260 antibody, light chain 9606
712 5D1Q 1 A D2-06 Light Chain 9606
713 5D1Q 4 D P5 Light Chain 9606
714 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
715 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
716 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
717 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
718 5XHV 3 L, Q S40 light chain 9606
719 5UWE 2 L HUMAN ANTI-HIV ANTIBODY N12-I2 Fab LIGHT CHAIN 9606
720 4IOF 3 D, F Fab-bound IDE, light chain 10090
721 5FUO 3 L FAB LIGHT CHAIN 9606
722 5FEH 1 A, C, E PCT64_26 Fab light chain 9606
723 4JHW 2 L D25 light chain 9606
724 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
725 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
726 4M1C 3 D, F Fab-bound IDE, light chain 9606
727 5UQY 3 C, G, K, O MR78 Fab light chain 9606
728 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
729 3ULV 2 L Fab15 light chain 9606
730 5UG0 3 C 2897 light chain 9606
731 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
732 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
733 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
734 5UOE 3 L, N, Q, T, W FAB light chain 9606
735 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
736 5D1X 1 A D4-30 Light Chain 9606
737 5D1X 4 D P5 Light Chain 9606
738 5JW3 4 L MEDI8852 light chain 9606
739 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
740 5UMI 2 B, L PA50 Fab Light chain 9606
741 6D11 2 B, D 1450 Antibody, Light chain 9606
742 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
743 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
744 3S36 1 L 1121B light chain 10090
745 5CWS 1 A, G sAB-158 Fab Light Chain 9606
746 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
747 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
748 2R0K 2 L antibody light chain of Fab58 9606
749 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
750 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
751 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
752 4G80 3 B, D, F, H fragment antibody light chain 9606
753 3JWO 3 L FAB 48D LIGHT CHAIN 9606
754 5CD5 3 D DRVIA7 Fab Light Chain 9606
755 3P11 2 L Fab DL11 light chain 9606
756 6EYO 3 L, M 8D6 Fab light chain 8D6 Fab light chain 9606
757 3F12 1 A, C M2J1 Fab 9606
758 3B2V 1 L IMC-11F8 FAB Light chain 9606
759 5IGX 3 L germline NIH45-46 light chain 9606
760 3ULU 2 L Fab15 light chain 9606
761 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
762 6ATT 3 L Antibody 39S Fab light chain Antibody, light chain 9606
763 5W1K 1 A, F, K, S CR1-28 Fab light chain 9606
764 5W1K 3 C, H, M, N CR1-10 Fab light chain 9606
765 4XI5 3 C Fab-94 light chain 9606
766 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
767 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
768 6EAY 1 L CA45 light chain 9541
769 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
770 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
771 5W1M 1 A, C, E, G CR1-07 Fab light chain 9606
772 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
773 5K9O 2 B, L 31.b.09 Light Fv 9606
774 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
775 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
776 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
777 5JW4 6 R MEDI8852 light chain 9606
778 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
779 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
780 5VOC 7 L Fab 8I21 light chain 9606
781 5J3D 2 B, D, L 14N4 light chain 9606
782 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
783 5ESZ 2 B, L CH04 Light Chain 9606
784 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
785 3EFF 1 A, C FAB 10090
786 3PJS 1 A, C FAB light chain 10090
787 5O7P 2 A MF3178 FAB light chain 9606
788 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
789 4ZYP 5 E, G, I AM14 antibody light chain 9606
790 6B3M 4 D, J, N, P, U, W 70-1F02 Fab Light Chain 9606
791 5DWU 4 L Fab - Light Chain 9606
792 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
793 6EA7 4 L, N, R ADI-15878 Fab Light Chain 9606
794 5I8H 5 F, H VRC34.01 Fab light chain 9606
795 4RQS 2 C 17b Fab Light Chain 9606
796 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
797 4R4H 3 L Antibody 2.2c, Light chain 9606
798 6EA5 4 L, N, R ADI-15878 Fab Light Chain 9606
799 5VOD 7 L Fab 9I6 light chain 9606
800 5FHC 5 L Antibody 114 Fab light chain 9606
801 4XMN 6 L Antibody 87 light chain 32630
802 4XMM 8 L Antibody 57 light chain 9606
803 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
804 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
805 6MZJ 2 C, L VRC01GL light chain germline VK3-11 with the mature CDRL3 of VRC01 9606
806 6MYY 2 C, F, L VRC01GL light chain germline VK3-11 with the mature CDR L3 of VRC01 9606
807 6MJZ 3 L PIA174 Fab Light chain 9606
808 6HJP 4 H, J, L Light chain of FISW84 Fab Fragment 9606
809 6HJQ 4 H, J, L Light chain of FISW84 Fab 9606
810 6E1K 2 C, E cat06 light chain 9606
811 6DJP 6 F 68 light chain Fab 10090
812 6CUF 2 4, L, l vFP1.01 Light chain 10090
813 6CMO 5 L Fab light chain 32630
814 6CM3 4 J, L, N 17b Fab light chain 9606
815 6CDE 2 4, L, l vFP20.01 Light chain 9606
816 6CDI 8 4, L, l vFP16.02 Light Chain 9606
817 6BF7 3 D, F Fab H11-E light chain 10090
818 6BF9 3 D, F Fab H11-E light chain 10090
819 6B7Z 3 D, F FAB H11 light chain 10090
820 6B70 3 D, F FAB H11-E light chain 10090
821 5VN3 1 L, N, O 17b Fab light chain 9606
822 5GZR 4 L, N Z23 Fab light chain 9606
823 5THR 4 J, K, L 17b Fab VL domain 9606
824 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
825 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
826 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
827 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
828 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
829 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
830 2ESG 1 L, M Immunoglobulin A1 light chain 9606
831 1R70 1 A, C Human IgA2(m1) Light Chain 9606
832 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606