Sequence Similarity Clusters for the Entities in PDB 1NAM

Entity #1 | Chains: A
BM3.3 T Cell Receptor alpha-Chain protein, length: 116 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 46402
95 % 2 2 34750 Flexibility: Low
Max RMSD: 0.8, Avg RMSD: 0.8
PDBFlex
90 % 2 2 33194
70 % 2 2 29522
50 % 2 2 25195
40 % 702 933 5
30 % 780 1061 7
Entity #2 | Chains: B
BM3.3 T Cell Receptor beta-Chain protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 29486
95 % 2 3 24468 Flexibility: Low
Max RMSD: 0.9, Avg RMSD: 0.8
PDBFlex
90 % 2 3 23663
70 % 4 5 12223
50 % 4 5 10900
40 % 4 5 9883
30 % 781 1061 7
Entity #3 | Chains: H
H-2 class I histocompatibility antigen, K-B alpha chain precursor protein, length: 275 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 41 49 420
95 % 55 65 375 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.1
PDBFlex
90 % 59 70 369
70 % 643 719 6
50 % 645 724 6
40 % 686 775 10
30 % 766 899 15
Entity #4 | Chains: P
Nucleocapsid protein, length: 8 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: L
Beta-2-microglobulin protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 111 135 96
95 % 180 228 60 Flexibility: Low
Max RMSD: 1.8, Avg RMSD: 0.6
PDBFlex
90 % 180 228 65
70 % 791 916 4
50 % 805 938 3
40 % 805 938 7
30 % 805 938 12

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4UNU 1 A, B IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
2 3PUC 1 A Titin domain M7 (UNP RESIDUES 33774-33871) 9606 2.7.11.1 | Details
3 1U2H 1 A Aortic preferentially expressed protein 1 residues 15-113 9606
4 5IVN 1 A BC2-nanobody 30538
5 5ACM 1 A, B MCG IG LAMBDA CHAIN V-II REGION MGC 9606
6 5E7B 1 A nanobody nano-L06 9838
7 2P45 2 B ANTIBODY CAB-RN05 9838
8 2X1Q 1 A, B GELSOLIN NANOBODY 9844
9 5U64 1 B VHH-28 9838
10 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
11 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
12 4B41 1 A, B ANTIBODY G7 9844
13 2JJU 1 A, B SIGNAL REGULATORY PROTEIN BETA-1 2 ISOFORMS PRODUCED BY ALTERNATIVE SPLICING. IN THIS ENTRY ISOFORM 1 (O00241-1) IS PRESENT N-TERMINAL ECTODOMAIN, RESIDUES 30-148 9606
14 5TZM 1 A Obscurin UNP residues 4946-5036 9606 2.7.11.1 | Details
15 5IMM 1 B Nanobody 9835
16 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
17 4QYO 2 B Fv fragment(mAb6D8) light chain 10090
18 5NLU 1 A single domain llama antibody Nb36 9844
19 2Q20 1 A, B Vk1 O18/O8 germline light chain variable domain 9606
20 1MQK 1 L antibody 7E2 FV fragment, light chain 10090
21 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
22 5IMK 1 B Nanobody 9835
23 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
24 4B50 1 A 2H10 LLAMA VHH 9844
25 2XT1 2 B CAMELID VHH 9 30538
26 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
27 4QY8 2 B Fv fragment(mAb6D8) light chain 10090
28 5J1S 3 C VHH domain BS-2 30538
29 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
30 2I24 1 N New Antigen Receptor PBLA8 variable domain 7801
31 5L6Q 1 A, B H5AL 9606
32 5J1T 3 C VHH domain BS-2 30538
33 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
34 3KNB 1 A Titin titin, C-terminal domain M10, resideus 34253-34350 9606 2.7.11.1 | Details
35 3KNB 2 B Obscurin-like protein 1 obscurin-like 1, N-terminal domain, residues 1-105 9606
36 2YZ1 1 A, B Tyrosine-protein phosphatase non-receptor type substrate 1 ligand-binidng domain, Ig-like V-type domain 10090 3.5.1.2 | Details
37 2X1O 1 A, B GELSOLIN NANOBODY 9844
38 4QGY 1 A, B nanobody n25, VH domain 9844
39 5C2B 1 H scFv 3B4 heavy chain 9606
40 5C2B 2 L 3B4 light chain 9606
41 5DXW 1 A PD-L1 nanobody 10090
42 3T0W 1 A, B immunoglobulin variable lambda domain 9606
43 4N9O 2 B Nanobody Nb484 Nb484 9844
44 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
45 5ACL 1 A MCG IG LAMBDA CHAIN V-II REGION MGC 9606
46 3T0V 1 A immunoglobulin variable lambda domain 9606
47 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
48 1OAQ 2 L LIGHT CHAIN FV, RESIDUES 1-120 10090
49 1T2J 1 A M12-Variable Heavy domain 9606
50 1DLF 1 L ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
51 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
52 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
53 2WP3 1 O OBSCURIN-LIKE PROTEIN 1 IG1, RESIDUES 1-106 9606
54 2WP3 2 T TITIN M10, RESIDUES 34252-34350 9606 2.7.11.1 | Details
55 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
56 1SQ2 2 N novel antigen receptor 7801
57 4KML 2 B Nanobody 9844
58 4Z9K 2 B VHH2(F5) antibody 30538
59 1J05 1 A, L anti-CEA mAb T84.66, light chain Fv fragment 10090
60 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
61 5LMW 1 A Nanobody 9844
62 5NM0 1 A, B, C, D Nb36 9844
63 2RHE 1 A BENCE-JONES PROTEIN RHE (LIGHT CHAIN) 9606
64 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
65 4QXT 2 B Fv fragment(mAb6D8) light chain 10090
66 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
67 4PPT 1 A Engineered single domain VHH antibody 9844
68 3R0M 1 A, B Llama VHH A12 9844
69 3ZKQ 2 D XA4813 9844
70 4I13 2 B Protein ca1697 (nanobody) 9844
71 5C2U 1 B Nanobody Nanobody 9838
72 2YXM 1 A Myosin-binding protein C, slow-type I-set domain 9606
73 1XFP 1 A heavy chain antibody VHH domain 9838
74 4POY 1 A VHH-metal 9844
75 1A2Y 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
76 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
77 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
78 5NLW 1 A nanobody Nb36 9844
79 3CDC 1 A, B Light Chain Amyloidogenic 9606
80 3CDF 1 A, B, C, D, E, F IMMUNOGLOBULIN LIGHT CHAIN 9606
81 3DVI 1 A Amyloidogenic light chain variable domain AL-103 9606
82 2DLF 1 L PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CHAIN)) FV FRAGMENT (VL DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
83 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
84 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
85 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
86 3G9A 2 B Minimizer 9838
87 1EEQ 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
88 3U79 1 A, B, C, D, E, F, G, H Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain 9606
89 2P43 2 B ANTIBODY CAB-RN05 9838
90 2QHL 1 A, B, C, D, E Novel immune-type receptor 10 Extracellular 7998
91 4KRN 1 A Nanobody/VHH domain EgA1 9844
92 4GFT 2 B Nanobody 9844
93 4TVS 2 a, b VHH Domain BS-1 30538
94 4W6Y 2 B Nanobody NbFedF9 9844
95 6EZW 1 B VHH antibody BCD090-M2 9844
96 1UAC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
97 1UAC 2 H Ig VH,anti-lysozyme 10090
98 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
99 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
100 4R3S 2 B FV FRAGMENT(MAB6D8) LIGHT CHAIN 10090
101 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
102 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
103 1EEU 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
104 5O02 2 C Nanobody (VHH) Nano-4 30538
105 4UNV 1 A IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
106 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
107 4X7F 2 C, D Nano-25 Nanobody 30538
108 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
109 4UT7 2 L BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV LIGHT CHAIN DOMAIN, RESIDUES 1-147 9606
110 4LGR 2 B Camelid nanobody (VHH3) 30538
111 5J57 2 B VHH single chain antibody V5E1 30538
112 1MFA 1 L IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN) 10090
113 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
114 5OMM 2 C Nanobody (VHH) Nano-14 30538
115 5E03 1 A mouse CTLA-4 nanobody 10090
116 5LZ0 1 A, B PorM nanobody 9844
117 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
118 2XXC 1 B CAMELID VHH 9 30538
119 3QYC 1 A, B VH domain of IgG molecule 9606
120 4OF6 1 A, B Protein SYG-1, isoform b D1, UNP residues 19-129 6239
121 2XXM 2 B CAMELID VHH 9 30538
122 5IR3 1 A Ig lambda chain V-VI region AR 9606
123 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
124 4AJ0 1 A, B, C, D GERMINAL LINE LAMBDA 3 3RCW VARIANT VARIABLE DOMAIN VARIANT OF 3RJL2, RESIDUES 1-107 9606
125 5JDS 1 B Nanobody 9835
126 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
127 4OB5 2 L 4E10 antibody germline precursor 7 light chain Fv 9606
128 1BWW 1 A, B PROTEIN (IG KAPPA CHAIN V-I REGION REI) IMMUNOGLOBULIN KAPPA LIGHT CHAIN 9606
129 5L8L 2 B New antigen receptor variable domain 168098
130 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
131 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
132 4AIZ 1 A, C, D V2-17 PROTEIN 9606
133 4AIZ 2 B V2-17 PROTEIN 9606
134 5L21 2 B VHH-C2 30538
135 5FWO 1 A NANOBODY 9844
136 2V9T 1 A ROUNDABOUT HOMOLOG 1 IG1-2M, RESIDUES 61-166 9606
137 5KVE 2 L ZV-48 Antibody scFv Light Chain 10090
138 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
139 4L1H 1 A Ig kappa chain V-I region Rei 9606
140 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
141 3B9V 1 A, B, C, D heavy chain variable domain 9606
142 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
143 1VFA 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
144 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
145 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
146 2D7T 2 L anti polyhydroxybutyrate antibody Fv, light chain residues 1-110 9606
147 3BD3 1 A, B catalytic antibody 10090
148 2OTU 1 A, C, E, G Fv light chain variable domain 10090
149 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
150 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
151 1EFQ 1 A KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
152 5L8J 2 B New antigen receptor variable domain 168098
153 1T6V 2 N, O novel antigen receptor 7801
154 2E27 1 L anti-ciguatoxin antibody, light chain Fv fragment 10090
155 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
156 4N1C 1 A, B immunoglobulin variable light chain domain 9606
157 5JDJ 1 A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P Titin 9606 2.7.11.1 | Details
158 4POU 2 B VHH Antibody 9844
159 3B5T 1 A, B, C, D, E Novel immune-type receptor 10 Extracellular fragment 7998
160 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
161 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
162 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
163 4AIX 1 A, B, C, D IG LAMBDA CHAIN V-IV REGION BAU 9606
164 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
165 2P42 2 B, D ANTIBODY CAB-RN05 9838
166 2JJV 1 A, B SIGNAL-REGULATORY PROTEIN BETA 1. 2 ISOFORMS PRODUCED BY ALTERNATIVE SPLICING. IN THIS ENTRY ISOFORM 1 (O00241-1) IS PRESENT N-TERMINAL ECTODOMAIN, RESIDUES 30-148 9606
167 1I8K 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
168 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
169 4QLR 1 A, B Llama nanobody n02 VH domain 9844
170 5J56 2 B VHH single chain antibody V1C7 30538
171 4X4Z 1 A, B Herceptin VL domain with F53D mutation 9606
172 4NBX 2 B A20.1 VHH 9844
173 1G7J 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
174 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
175 4HEP 2 G vHH17 domain 9844
176 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
177 1PEW 1 A, B Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN 9606
178 2AQ2 1 A T-CELL RECEPTOR BETA CHAIN V 10090
179 1VFB 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
180 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
181 5IML 2 B Nanobody 9835
182 3A6C 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
183 3A6C 2 H IG VH, anti-lysozyme 10090
184 2DQD 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
185 2DQD 2 H Ig VH,anti-lysozyme 10090
186 2JJS 1 A, B TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1 N-TERMINAL ECTODOMAIN, RESIDUES 31-148 9606
187 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
188 1WTL 1 A, B BENCE-JONES PROTEIN MCG (LIGHT CHAIN) 9606
189 2I25 1 N, O New Antigen Receptor PBLA8 variable domain 7801
190 1G7I 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
191 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
192 2WWK 1 O OBSCURIN-LIKE PROTEIN 1 IG1, RESIDUES 1-106 9606
193 2WWK 2 T TITIN M10, RESIDUES 34252-34350 9606 2.7.11.1 | Details
194 3A67 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
195 3A67 2 H IG VH, anti-lysozyme 10090
196 2APB 1 A T-cell receptor beta chain V 10116
197 2APX 1 A T cell receptor beta chain V 10116
198 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
199 1J1X 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
200 1J1X 2 H Ig VH,anti-lysozyme 10090
201 5L8K 2 B New antigen receptor variable domain 168098
202 5M2J 2 D Anti-(ED-B) scFV 9606
203 2DQC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
204 2DQC 2 H Ig VH,anti-lysozyme 10090
205 1J1O 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
206 1J1O 2 H Ig VH,anti-lysozyme 10090
207 1TVD 1 A, B T CELL RECEPTOR DELTA CHAIN, VARIABLE DOMAIN 9606
208 1MVU 1 A Ig kappa-chain VJ-region (Light chain) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
209 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
210 4M62 1 L, M GEP2 FV light chain UNP residues 21-129 9606
211 4M62 2 H, I GEP2 FV heavy chain 9606
212 5IVO 1 A BC2-nanobody 30538
213 1J1P 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
214 1J1P 2 H Ig VH,anti-lysozyme 10090
215 4NBZ 2 B, D A26.8 VHH 9844
216 1QAC 1 A, B IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN VARIABLE DOMAIN 9606
217 5AYU 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
218 5AYU 2 H Ig VH,anti-lysozyme 10090
219 3A6B 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
220 3A6B 2 H IG VH, anti-lysozyme 10090
221 2DQJ 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
222 2DQJ 2 H Ig VH,anti-lysozyme 10090
223 5F21 2 B nanobody MU375 9844
224 1N4X 1 L, M immunoglobulin kappa chain variable region 10090
225 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
226 2P44 2 B ANTIBODY CAB-RN05 9838
227 3DVF 1 A Amyloidogenic immunoglobulin light chain protein AL-12 9606
228 1KIQ 1 A MONOCLONAL ANTIBODY D1.3 10090
229 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
230 5TP3 1 A, B F-VHH-4 9844
231 2IMN 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
232 3B5G 1 A, B AMYLOID LAMBDA 6 LIGHT CHAIN VARIABLE REGION PIP residues 1-111 9606
233 2JJW 1 A SIGNAL REGULATORY PROTEIN GAMMA ISOFORM 4 N-TERMINAL ECTODOMAIN, RESIDUES 29-147 9606
234 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
235 4LHJ 2 B Camelid antibody 30538
236 4BEL 2 D, E XA4813 9844
237 5M7Q 1 A, B Nanobody NbD2 9838
238 5H8D 1 A VHH nanobody 9844
239 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
240 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
241 3DUR 1 A, C antibody Fv fragment SAG173-04 variable region fragment (Fv) 10090
242 3DUR 2 B, D Ig-like protein 10090
243 2APF 1 A T cell receptor beta chain V 10116
244 5T93 1 A, B, C, D ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient last residue was not visible on electron density 9606
245 2XV6 2 B, D CAMELID VHH 9 30538
246 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
247 1LVE 1 A LEN, A VARIABLE DOMAIN FROM KAPPA-4 TYPE 9606
248 4ZG1 1 A, B, C, D, E, F NB17 9844
249 2IMM 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
250 4I1N 2 B Protein ca1697 (nanobody) 9844
251 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
252 2UV3 1 A, B TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1 CD47 BINDING DOMAIN, RESIDUES 31-148 9606
253 5C9K 1 A, B, C, D, E, F, G, H Amyloid lambda 6 light chain variable region PIP 9606
254 6F0D 1 A, B VHH antibody BCD090-M2 9844
255 1FGV 1 L H52 FV (LIGHT CHAIN) 9606
256 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
257 4LCI 1 L anti canine CD28 antibody, 1C6, light chain 10090
258 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
259 1WAA 1 A, B, C, D TITIN IG DOMAIN, RESIDUES 12801-12889 9606 2.7.11.1 | Details
260 1WAA 2 E TITIN IG DOMAIN, RESIDUES 12801-12889 9606 2.7.11.1 | Details
261 1WAA 3 F TITIN IG DOMAIN, RESIDUES 12801-12889 9606 2.7.11.1 | Details
262 4W6X 2 B Nanobody NbFedF7 9844
263 5JA9 2 A, B Nanobody 6 9844
264 1A7N 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
265 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
266 1CD0 1 A, B PROTEIN (JTO, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) IMMUNOGLOBULIN VARIABLE DOMAIN 9606
267 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
268 1OP9 1 A HL6 camel VHH fragment 9838
269 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
270 4C4K 1 O OBSCURIN FIRST IG DOMAIN, RESIDUES 9-103 9606 2.7.11.1 | Details
271 4C4K 2 T TITIN M10 DOMAIN, RESIDUES 34252-34350 9606 2.7.11.1 | Details
272 4LRN 1 H GEP 1 heavy chain 9606
273 4LRN 2 L GEP 1 light chain 9606
274 4S11 1 A GELSOLIN NANOBODY 9844
275 1EK3 1 A, B KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL, REC 9606
276 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
277 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
278 2YC1 2 B, E SINGLE CHAIN ANTIBODY FRAGMENT 9004G LIGHT CHAIN 9606
279 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
280 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
281 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
282 1G7H 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
283 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
284 2APV 1 A T cell receptor beta chain V 10116
285 4Y7M 1 A, B Hi113 protein 9844
286 5JMO 2 C, D camelid VHH fragment 9838
287 1A7O 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
288 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
289 1KIR 1 A MONOCLONAL ANTIBODY D1.3 10090
290 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
291 4B5E 1 A, B PS2-8 9844
292 2DQE 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
293 2DQE 2 H Ig VH,anti-lysozyme 10090
294 1DVF 1 A FV D1.3 IGG1, KAPPA 10090
295 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
296 1DVF 3 C FV E5.2 IGG1, KAPPA 10090
297 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
298 1G7M 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
299 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
300 4X7C 2 C, D Nano-85 Nanobody VHH 30538
301 2Y9R 1 T TITIN M10 DOMAIN, RESIDUES 26828-26926 9606 2.7.11.1 | Details
302 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
303 1OAU 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
304 1B0W 1 A, B, C BENCE-JONES KAPPA I PROTEIN BRE VARIABLE DOMAIN OF LIGHT CHAIN 9606
305 3EBA 1 A CAbHul6 9838
306 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606 3.4.19.13 | Details
307 1A6W 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
308 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
309 2QTE 1 A, B, C, D Novel immune-type receptor 11 Extracellular fragment 7998
310 1A7R 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
311 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
312 4CMM 1 A TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1 EXTRACELLULAR DOMAIN, RESIDUES 31-149 9606
313 1WZ1 1 L Ig light chain 10090
314 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
315 3UPA 1 A, B kappa light chain variable domain 9606
316 4I0C 2 C, D cAbHuL5 antibody 9838
317 3LVE 1 A LEN KAPPA-IV LIGHT CHAIN DIMER 9606
318 1A7P 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
319 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
320 4K3G 1 A, B immunoglobulin lambda variable domain L5(L89S) 9606
321 2APT 1 A, B T-cell receptor beta chain V 10116
322 1XIW 3 C, G immunoglobulin light chain variable region 10090
323 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
324 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
325 5NGV 3 L anti-human ActRIIB mAb BYM338 light-chain VL 9606
326 1A7Q 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
327 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
328 5JOE 1 A Titin I81 domain 9606 2.7.11.1 | Details
329 3MC0 1 A, C variable beta 8.2 mouse T cell receptor unp residues 31-144 10090
330 3CAF 1 A Fibroblast growth factor receptor 2 Ig-like C2-type 2 9606 2.7.10.1 | Details
331 5BOP 1 A, C Nanobody 9844
332 4DKA 1 A, B single domain antibody VHH 9844
333 5O05 1 C, D Nanobody (VHH) Nano-42 30538
334 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606 3.4.19.13 | Details
335 1DSF 1 L ANTICANCER ANTIBODY B1 FV 10090
336 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
337 3DUU 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
338 3DUU 2 B, D Ig-like protein 10090
339 3BJ9 1 1 Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1 Fusion protein consists of Ig domain of VPREB protein and J-fragment of Ig lambda-5 9606
340 1H5B 1 A MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
341 1H5B 2 B, D MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
342 1H5B 3 C MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
343 3LRG 1 A, B anti-huntingtin VL domain anti-huntingtin VL domain 9606
344 3K74 2 B Nanobody 9844
345 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
346 1KIP 1 A MONOCLONAL ANTIBODY D1.3 10090
347 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
348 5LVE 1 A BENCE-JONES PROTEIN LEN G KAPPA CHAIN V-IV, VARIABLE DOMAIN, LIGHT CHAIN 9606
349 2EIZ 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
350 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
351 4QEG 1 A Titin domain I10 9606 2.7.11.1 | Details
352 1SJV 1 A r9 llama VHH single domain antibody 9844
353 1PW3 1 A, B immunoglobulin lambda chain variable region 9606
354 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
355 2QQQ 1 A, B, C, D Novel immune-type receptor 11 Extracellular domain 7998
356 5JPJ 1 A, B 6aJL2 protein 9606
357 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
358 2UZI 2 L ANTI-RAS FV LIGHT CHAIN 9606
359 2APW 1 A T cell receptor beta chain V 10116
360 2I27 1 N, O New Antigen Receptor Ancestral variable domain 7801
361 3T0X 1 A, B Immunoglobulin variable lambda domain M8VLA4(S55P) 9606
362 1UA6 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
363 1UA6 2 H Ig VH,anti-lysozyme 10090
364 1IC7 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
365 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
366 4W68 1 A, B Single domain antibody 9844
367 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
368 1CFV 1 L MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
369 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
370 3EAK 1 A, B NbBCII10-FGLA 9838
371 4KJY 2 B, D High-affinity SIRPa variant FD6 9606
372 3Q5O 1 A, B Titin domain M10 (UNP RESIDUES 34253-34350) 9606 2.7.11.1 | Details
373 1QP1 1 A, B, C BENCE-JONES KAPPA I ANTIBODY BRE (LIGHT CHAIN) IMMUNOGLOBULIN FRAGMENT, VARIABLE DOMAIN 9606
374 3U7A 1 A Amyloidogenic immunoglobulin light chain protein AL-09 Y32F Y96F, variable domain 9606
375 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
376 4ORZ 3 C single domain antibody sdAb19 9844
377 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
378 4UU9 2 B, L MEDI7814 VARIABLE DOMAIN LIGHT CHAIN 9606
379 3MOQ 1 A, B, C, D New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain CHIMERA OF NEW ANTIGEN RECEPTOR VARIABLE DOMAIN (RESIDUES 1-87 AND 102-113 FROM UNP Q6X1E6) INSERTED WITH AMYLOID BETA 18-41 (RESIDUES 689-712 FROM UNP P05067) 168098
380 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
381 1G7L 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
382 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
383 2AQ1 1 A, C, E, G T-cell receptor beta chain V 10090
384 1BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
385 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
386 5C1M 2 B Nanobody 39 9844
387 5F7K 2 C, D Nanobody Nb-ER19 9844
388 5LMJ 1 A, B, C, D nanobody 9844
389 5E1H 2 B F8(JOB10) VHH antibody 30538
390 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
391 2YZ8 1 A Obscurin 32th Ig-like domain 9606 2.7.11.1 | Details
392 1IVL 1 A, B IGG-KAPPA M29B FV (LIGHT CHAIN) 10090
393 4OCM 3 C, F Nb1 9844
394 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
395 1A6U 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
396 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
397 4X7E 2 C, D Nano-85 Nanobody 30538
398 5F1O 2 B nanobody MU551 9844
399 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
400 5O03 2 C, D Nanobody (VHH) Nano-32 11983
401 2DQI 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
402 2DQI 2 H Ig VH,anti-lysozyme 10090
403 1BRE 1 A, B, C, D, E, F BENCE-JONES KAPPA I PROTEIN BRE 9606
404 4Y8D 2 C, D nanobody 9844
405 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
406 3CX5 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
407 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
408 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
409 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
410 4C58 2 B NANOBODY 9844
411 5B8C 1 A, D, G, J Pembrolizumab light chain variable region (PemVL) 9606
412 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
413 3DV6 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
414 3DV6 2 B Ig-like protein 10090
415 1VES 1 A, B New Antigen Receptor variable domain 168098
416 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
417 2EKS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
418 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
419 3BD5 1 A, B catalytic antibody 10090
420 5VXM 2 B Single-domain antibody 20ipaD 30538
421 4XVJ 2 H antibody heavy chain variable domain 9606
422 4XVJ 3 L antibody light chain variable domain 9606
423 1AC6 1 A, B T-CELL RECEPTOR ALPHA VARIABLE DOMAIN 10090
424 4OF7 1 A, B, C, D Protein SYG-1, isoform b D1, UNP residues 19-129 6239
425 4IDL 1 A Single Domain Antibody VHH A9 9844
426 1JV5 1 A Ig kappa chain precursor V region anti-blood group A Fv 9606
427 1JV5 2 B Ig chain heavy chain precursor V region 9606
428 1FVC 1 A, C IGG1-KAPPA 4D5 FV (LIGHT CHAIN) 9606
429 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
430 3K7U 1 A Antibody 9844
431 4Z0X 1 A Antibody HC26AM light chain variable domain 9606
432 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
433 1IC5 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
434 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
435 4NBY 2 B, C A20.1 VHH 9844
436 4X7D 2 C, D Nano-85 Nanobody VHH 9844
437 2CD0 1 A, B PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) VARIABLE DOMAIN 9606
438 5F7N 2 C, D Nanobody Nb-ER19 30538
439 5OCL 1 A, C, F, H anti-llama nanobody 30538
440 5OCL 2 B, D, E, G anti-vglut nanobody 9844
441 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
442 4LAS 2 L Single light chain Variable fragment Light Chain 10090
443 2A9M 1 L, M fluorescein-scfv light chain 9606
444 2A9M 2 H, I fluorescein-scfv heavy chain 9606
445 2YWZ 1 A new antigen receptor variable domain 168098
446 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
447 1SJX 1 A immunoglobulin VH domain 9844
448 3ZKS 2 D XA4813 9844
449 3BYY 1 A T cell receptor beta chain 8.2 Variable domain 10090
450 1A6V 1 L, M, N B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
451 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
452 5MY6 2 B Nanobody 2Rs15d 9838
453 3DUS 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
454 3DUS 2 B, D Ig-like protein 10090
455 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
456 5NH3 3 L, M anti-human ActRIIB mAb BYM338 Fv light-chain 9606
457 5M2I 2 G, H, I, J, K, L VHH1 9844
458 2COQ 1 A new antigen receptor variable domain 168098
459 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
460 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
461 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
462 3K1K 2 C, D Enhancer 9838
463 4U7S 1 A, B sdAb A3 9844
464 4U3X 1 A, C Human VH domain antibody 9606
465 4W81 1 A Single Domain Antibody 9844
466 5GRV 1 L homo-specific diabody heavy chain 9606
467 5GRV 2 K homo-specific diabody light chain 9606
468 5JMR 1 A, B camelid VHH fragment 9838
469 4W70 1 A Single Domain Antibody 9844
470 2GSG 1 A, C monoclonal antibody light chain variable domain 10090
471 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
472 2W0L 1 A, B, C, D V1-22 PROTEIN 9606
473 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
474 5TBD 2 B, F, G, K Fv fragment (mAb4D1) heavy chain 10090
475 4BFB 2 D, E XA4813 9844
476 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
477 5DHV 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
478 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
479 4LVE 1 A, B LEN KAPPA-IV LIGHT CHAIN DIMER 9606
480 6BIT 3 G, H Tyrosine-protein phosphatase non-receptor type substrate 1 9606
481 43C9 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
482 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
483 1NMB 2 L FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
484 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
485 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
486 1I8I 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
487 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
488 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
489 1OAR 2 L, M, N, O IMMUNOGLOBULING E FV, RESIDUES 1-110 10090
490 1D9K 1 A, E T-CELL RECEPTOR D10 (ALPHA CHAIN) 10090
491 1D9K 2 B, F T-CELL RECEPTOR D10 (BETA CHAIN) 10090
492 4LHQ 2 B, D Camelid nanobody 30538
493 3EUU 1 A, B Fibroblast growth factor receptor 2 UNP residues 150-249 9606 2.7.10.1 | Details
494 3DV4 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
495 3DV4 2 B Ig-like protein 10090
496 4OFI 1 A, B, C, D, E, F, G, H Kin of irre, isoform A D1, UNP residues 81-185 7227
497 3ZKX 2 B XA4813 9844
498 3ZKX 3 C XA4815 9844
499 3DAR 1 A, B Fibroblast growth factor receptor 2 D2 domain, Ig-like C2-type 2, UNP residues 146-249 9606 2.7.10.1 | Details
500 5F1K 2 C, D nanobody MU1053 9844
501 3ZLQ 2 C, D XA4813 9844
502 1I3G 1 L ANTIBODY FV FRAGMENT VL DOMAIN 10090
503 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
504 2WWM 1 C, O OBSCURIN-LIKE PROTEIN 1 RESIDUES 1-106 9606
505 2WWM 2 D, T TITIN M10, RESIDUES 34252-34350 9606 2.7.11.1 | Details
506 3RBG 1 A, B, C, D Cytotoxic and regulatory T-cell molecule 9606
507 1DL7 1 L PROTEIN (ANTIBODY M3C65 (LIGHT CHAIN)) COMBINED LIGHT AND HEAVY CHAIN VIA (G4S)3 LINKER FV (SINGLE CHAIN) 10090
508 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
509 4NC0 2 B A26.8 VHH 9844
510 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
511 1OCW 2 L IMMUNOGLOBULIN E FV REGION, RESIDUES 1-120 10090
512 1IGM 1 L IGM-KAPPA POT FV (LIGHT CHAIN) 9606
513 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
514 5GS1 1 A, M, O, Q light chain 9606
515 5GS1 2 B, N, P, R heavy chain 9606
516 5F7Y 3 C, D Nanobody Nb-ER19 9844
517 2DQG 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
518 2DQG 2 H Ig VH,anti-lysozyme 10090
519 5IMO 1 B Nanobody 9835
520 5U65 1 A, B VHH-5 9838
521 2PXY 1 A T cell receptor alpha chain 10090
522 2PXY 2 B T cell receptor beta chain 10090
523 3BDX 1 A, B, C Amyloid lambda 6 light chain variable region PIP (fragment) Residues 1-111 9606
524 4TYU 1 A, B Single Domain Antibody 9844
525 43CA 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
526 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
527 2DQH 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
528 2DQH 2 H Ig VH,anti-lysozyme 10090
529 4AQ1 2 B, D NBKB6 VHH 9844
530 2Q1E 1 A, B, C, D Amyloidogenic immunoglobulin light chain protein AL-09 9606
531 2AQ3 1 A, C, E, G T-cell receptor beta chain V 10090
532 4EIG 2 B CA1698 camel antibody fragment 9844
533 3EHB 3 C FV fragment Chain H 10090
534 3EHB 4 D FV fragment Chain L 10090
535 3HB3 3 C ANTIBODY FV FRAGMENT 10090
536 3HB3 4 D ANTIBODY FV FRAGMENT 10090
537 4FFY 1 L DENV1-E111 single chain variable fragment (light chain) 10090
538 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
539 2QJD 1 A, B Novel immune-type receptor 10 Extracellular fragment 7998
540 4N1E 1 A, B, C, D, E, F, G, H immunoglobulin variable light chain domain 9606
541 2X89 1 A, B, C ANTIBODY 9838
542 4WV1 1 C, F Fibroblast growth factor receptor 2 UNP residues 153-251 9606 2.7.10.1 | Details
543 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
544 3BZD 1 A T cell receptor beta chain 8.2 Variable domain 10090
545 5O04 2 E, F Nanobody (VHH) Nano-26 30538
546 5O04 3 C, D Nanobody (VHH) Nano-85 30538
547 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
548 5LBS 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 SCFV fragment, light chain 9606
549 3P9W 2 B, D, F, H human VEGF 9606
550 1AP2 1 A, C MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
551 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
552 5F8R 2 C, D Nanobody Nb-ER19 9844
553 1IC4 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
554 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
555 4OCL 3 C, F Nb1 9844
556 3CDY 1 A, B IMMUNOGLOBULIN LIGHT CHAIN 9606
557 4RAV 1 B, D Single-chain Fv, VL 9606
558 4RAV 2 A, C single-chain Fv, VH 9606
559 5LWY 2 H V REGION HEAVY CHAIN 10090
560 5LWY 3 L V REGION LIGHT CHAIN 10090
561 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
562 1KB9 11 K LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
563 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
564 4X4X 2 B, D Human Variable Light Chain of Herceptin 9606
565 2Z8V 2 C, D New antigen receptor variable domain 168098
566 4IOS 2 D, E, F, G Llama nanobody 11 9844
567 2W0K 1 A, B V1-22 PROTEIN 9606
568 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
569 2BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
570 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
571 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
572 2IBZ 11 Y Variable Light chain of antibody fragment 10090
573 4K3H 1 A, B, C, D, E, F, G, H Immunoglobulin lambda variable domain L5(L89S) 9606
574 4C57 2 C, D NANOBODY 9844
575 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
576 2Z8W 2 C, D New antigen receptor variable domain 168098
577 4OCN 3 C, F Nb1 9844
578 4GRW 3 E, G Nanobody 124C4 9844
579 4GRW 4 F, J Nanobody 37D5 9844
580 4GRW 5 H, I Nanobody 22E11 9844
581 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
582 3BYT 1 A, C, E, G T cell receptor beta chain 8.2 10090
583 4NC2 2 B B39 VHH 9844
584 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
585 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
586 2OI9 2 B T cell receptor alpha chain 10090
587 2OI9 3 C T cell receptor beta chain 10090
588 4HGM 1 A Shark V-NAR 7797
589 3BD4 1 A, B catalytic antibody 10090
590 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
591 1WT5 2 C, D ANTI EGFR ANTIBODY FV REGION VL fragment 9606
592 1JHL 1 L IGG1-KAPPA D11.15 FV (LIGHT CHAIN) 10090
593 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
594 5F9A 2 C Nanobody Nb-ER19 9844
595 2IJ0 2 C, E penultimate affinity-matured variant of hVbeta 2.1, D10 9606
596 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
597 4LLV 2 B, D, F, L 4E10 Fv light chain 9606
598 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
599 4LAR 2 L Single light chain variable fragment Light Chain 10090
600 5CBA 1 A, C 3b4 heavy chain 9606
601 5CBA 2 B, D 3b4 light chain 9606
602 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
603 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
604 1A14 3 L NC10 FV (LIGHT CHAIN) VL DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
605 1C08 1 A ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VL FRAGMENT 10090
606 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
607 2OTW 1 A, C Fv light chain avriable domain VL 10090
608 2OTW 2 B, D Fv heavy chain variable domain VH 10090
609 3CU1 1 A, C Fibroblast growth factor receptor 2 Ig-like C2-type 2 domain, UNP residues 150-249 9606 2.7.10.1 | Details
610 3STB 1 A, B single domain antibody VHH 9844
611 2YSS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
612 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
613 4W6W 2 B NbFedF6 9844
614 5JA8 2 B, D, F, H Nanobody 2 9844
615 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
616 2YBR 2 B, E, H SINGLE CHAIN ANTIBODY FRAGMENT 9004G LIGHT CHAIN, RESIDUES 118-263 9606
617 2JJT 1 A, B TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1 N-TERMINAL ECTODOMAIN, RESIDUES 31-148 9606
618 2I26 1 N, O, P New Antigen Receptor Ancestral variable domain 7801
619 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
620 2BJM 2 L IGE SPE7 LIGHT CHAIN LIGHT CHAIN, RESIDUES 1-110 10090
621 2AP2 1 A, C PROTEIN (ANTIBODY (LIGHT CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
622 2AP2 2 B, D PROTEIN (ANTIBODY (HEAVY CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
623 1P4B 1 L Antibody Variable light chain 10090
624 1P4B 2 H Antibody Variable heavy chain 10090
625 5U4M 2 B V1C7 VHH antibody 30538
626 5O0W 2 E, F, G, H Nb474 30538
627 4Y5V 1 A, D, G diabody 305 VH domain 9606
628 4Y5V 2 B, E, H Diabody 305 VL domain 9606
629 1I9E 1 A CYTOTOXIC TCELL VALPHA DOMAIN N-TERMINAL DOMAIN OF ALPHA CHAIN 10090
630 1DQL 1 L IGM MEZ IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN FRAGMENT 9606
631 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
632 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
633 3V0A 3 C Llama antibody F12 9844
634 2Z35 1 A T-cell receptor alpha-chain 10090
635 2Z35 2 B T-cell receptor beta-chain 10090
636 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
637 3K80 1 A, B Antibody 9844
638 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
639 5F8Q 2 C, D Nanobody Nb-ER19 9844
640 4U05 1 A, B Single Domain Antibody 9844
641 5F9D 2 C Nanobody Nb-ER19 9844
642 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
643 4X4Y 2 B, D Human Variable Light Chain of Herceptin 9606
644 4LGP 2 B, D VHH1 camelid nanobody 30538
645 2P48 2 B ANTIBODY CAB-RN05 9838
646 5U4L 2 B V1C7 VHH antibody G29R variant 30538
647 5VXK 1 B single-domain antibody JMK-H2 30538
648 5F7M 2 C, D Nanobody Nb-ER19 9844
649 3MFG 2 B V_segment translation product 9606
650 1VER 1 A New Antigen Receptor variable domain 168098
651 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
652 5F7W 2 C, D Nanobody Nb-ER19 9844
653 4YQX 1 H, N JES6-1 VH domain 10116
654 4YQX 2 L, O JES6-1 VL domain 10116
655 1FO0 4 A PROTEIN (BM3.3 T CELL RECEPTOR ALPHA-CHAIN) FV FRAGMENT, VARIABLE DOMAIN 10090
656 1FO0 5 B PROTEIN (BM3.3 T CELL RECEPTOR BETA-CHAIN) FV FRAGMENT, VARIABLE DOMAIN 10090
657 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
658 1EZV 11 Y LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
659 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
660 3U6R 2 B, L Antibody 1:7 (Light chain) 9606
661 1U3H 1 A, E T-cell receptor alpha-chain V2.3-J39-C 10090
662 1U3H 2 B, F Mouse TCRVbeta 172.10, extracellular variable domain 10090
663 1KTR 1 L Anti-his tag antibody 3d5 variable light chain 10090
664 1KTR 3 H Anti-his tag antibody 3d5 variable heavy chain 10090
665 2YWY 1 A, B, C, D new antigen receptor variable domain 168098
666 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
667 1NMC 3 C, L SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
668 1KB5 1 A KB5-C20 T-CELL ANTIGEN RECEPTOR 24 RESIDUE LINK BETWEEN VALPHA C-TERMINUS AND VBETA N-TERMINUS FV FRAGMENT, VARIABLE DOMAIN 10090
669 1KB5 2 B KB5-C20 T-CELL ANTIGEN RECEPTOR 24 RESIDUE LINK BETWEEN VALPHA C-TERMINUS AND VBETA N-TERMINUS FV FRAGMENT, VARIABLE DOMAIN 10090
670 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
671 4NC1 2 C, D A20.1 VHH 9844
672 4NC1 3 E, F A26.8 VHH 9844
673 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
674 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
675 2DQF 1 A, D lysozyme binding Ig kappa chain V23-J2 region 10090
676 2DQF 2 B, E Ig VH,anti-lysozyme 10090
677 1B88 1 A, B T CELL RECEPTOR V-ALPHA DOMAIN V-ALPHA DOMAIN 10090
678 5E7F 1 A, B, C nanobody L06 9838
679 2P46 2 B, D ANTIBODY CAB-RN05 9838
680 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
681 3CXH 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
682 2E7L 1 A, B Cytotoxic Tcell receptor UNP RESIDUES 21-132 10090
683 2E7L 2 C, D Beta-chain UNP RESIDUES 30-144 10090
684 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
685 3OWE 1 A, C, E, G, I, K, M, O Beta-chain VARIABLE DOMAIN 10090
686 5LHP 2 B Camelid-Derived Antibody Fragment 30538
687 2ICW 5 I, K T-cell receptor alpha chain V residues 21-131 10090
688 2ICW 6 J, L T-cell receptor beta chain V 10090
689 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
690 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
691 1P84 11 K Light Chain (Vl) Of Fv-Fragment 10090
692 2ATP 3 B, D T-cell surface glycoprotein CD8 beta chain CD8b ectodomain fragment 10090
693 5SV4 1 A, B Single Domain Antibody A3C8 9844
694 4LGS 2 B Camelid nanobody (VHH4) 30538
695 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
696 2XTJ 2 B FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
697 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
698 5CBE 1 A, C E10 heavy chain 9606
699 5CBE 2 B, D E10 light chain 9606
700 2P47 2 B ANTIBODY CAB-RN05 9838
701 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
702 3WXW 2 H V region heavy chain 10090
703 3WXW 3 L V region light chain 10090
704 3K3Q 1 A llama Aa1 VHH domain 9844
705 1F6L 1 L ANTI-FERRITIN IMMUNOGLOBULIN LIGHT CHAIN VARIABLE LIGHT CHAIN 9606
706 3LRH 1 A, C, E, G, I, K, M, O anti-huntingtin VL domain anti-huntingtin VL domain 9606
707 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
708 1AR1 3 C ANTIBODY FV FRAGMENT 10090
709 1AR1 4 D ANTIBODY FV FRAGMENT 10090
710 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
711 1BVK 1 A, D HULYS11 FV 9606
712 1BVK 2 B, E HULYS11 FV 9606
713 5FV1 1 L, M VK DOMAIN ANTIBODY VK DOMAIN ANTIBODY, RESIDUES 1-108 9606
714 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
715 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
716 2CJU 2 L NQ16-113.8 ANTI-PHOX ANTIBODY 10090
717 5HVF 2 B VHH-i83 30538
718 1P4I 1 L ANTIBODY VARIABLE LIGHT CHAIN 10090
719 1P4I 2 H antibody variable heavy chain 10090
720 4PGJ 1 A, C Human heavy chain domain antibody 9606
721 2LVE 1 A RLEN KAPPA-IV LIGHT CHAIN DIMER 9606
722 4KDT 1 A, B Nanobody24 9835
723 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
724 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
725 2VH5 2 L ANTI-RAS FV LIGHT CHAIN 9606
726 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
727 4RSV 1 A Obscurin UNP residues 4337-4429 9606 2.7.11.1 | Details
728 5MJE 2 B Nanobody 8 9844
729 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
730 3LH2 3 L, M, N, O Fv 4E10 light chain 9606
731 3OGO 2 E, F, G, H GFP-nanobody 9838
732 4C59 2 B NANOBODY 9844
733 5VXL 2 B single-domain antibody JPS-G3 30538
734 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
735 1OAZ 3 L, N IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
736 4DK6 1 A, B single domain antibody VHH 9844
737 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
738 1CL7 2 H PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain)) FAB 10090
739 5F7L 2 B, D Nanobody Nb-ER14 9844
740 1KJ2 4 A, D KB5-C20 T-Cell receptor alpha-chain Fv fragment , variable domain 10090
741 1KJ2 5 B, E KB5-C20 T-Cell receptor beta-chain Fv fragment , variable domain 10090
742 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
743 1OAY 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
744 5HVG 2 B, D VHH-a204 30538
745 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
746 4LAQ 2 L Single light chain variable fragment Light Chain 10090
747 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606 3.4.19.13 | Details
748 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
749 5HVH 2 B VHH-a204 30538
750 5HVH 3 C VHH-i83 30538
751 4XT1 3 C nanobody 7 30538
752 5LXG 2 H V REGION HEAVY CHAIN 10090
753 5LXG 3 L V REGION LIGHT CHAIN 10090
754 5HM1 1 A, B, C lama VHH antibody 2E7 9844
755 5FUC 3 E, V VHH6 9838
756 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
757 4RZC 2 B, D, F, L Fv M6P-1 heavy chain 9986
758 3H3P 1 H, I Fv 4E10 heavy chain 9606
759 3H3P 2 L, M Fv 4E10 light chain 9606
760 5O2U 2 B, D VHH 59H10 9844
761 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
762 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
763 3NN8 2 B, E, F, H Engineered scFv, light chain 10090
764 5OMN 2 C Nanobody (VHH) Nano-27 30538
765 4KRP 2 B Nanobody/VHH domain 9G8 9844
766 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
767 1OAX 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
768 4FHB 2 D Nb179 9844
769 4DK3 1 A, B single domain antibody VHH 9844
770 4KRL 1 B Nanobody/VHH domain 7D12 9844
771 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
772 4V1D 2 B SINGLE CHAIN ANTIBODY FRAGMENT LR, LIGHT CHAIN 9606
773 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
774 4V1D 5 E SINGLE CHAIN ANTIBODY FRAGMENT RU1, LIGHT CHAIN 9606
775 2Z31 1 A T-cell receptor alpha-chain 10090
776 2Z31 2 B T-cell receptor beta-chain 10090
777 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
778 1NMA 2 L FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
779 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
780 1NAM 1 A BM3.3 T Cell Receptor alpha-Chain Fv Fragment, Variable Domain 10090
781 1NAM 2 B BM3.3 T Cell Receptor beta-Chain Fv Fragment, Variable Domain 10090
782 3B9K 4 B, F T-cell surface glycoprotein CD8 beta chain Ig-like V-type domain 10090
783 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
784 4LDE 2 B Camelid Antibody Fragment 9844
785 4Y5Y 1 A, D diabody 330 VH domain 9606
786 4Y5Y 2 B, E diabody 330 VL domain 9606
787 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
788 1BVL 1 A, C HULYS11 FV 10090
789 1BVL 2 B, D HULYS11 FV 10090
790 3RJQ 2 B Llama VHH A12 9844
791 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
792 4UNT 1 A, B, C, D, E, F, G, H IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
793 4UOW 1 0, 2, 4, 6, 8, A, C, E, G, I, K, M, O, Q, S, U, W, Y OBSCURIN FIRST IG DOMAIN, RESIDUES 26829-26925 9606 2.7.11.1 | Details
794 4UOW 2 1, 3, 5, 7, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z TITIN M10 DOMAIN, RESIDUES 7-99 9606 2.7.11.1 | Details
795 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
796 3AB0 3 C, F antibody ScFv fragment, light chain 10090
797 3LHP 1 H, I Fv 4E10 heavy chain 9606
798 3LHP 2 L, M Fv 4E10 light chain 9606
799 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
800 2BX5 1 A, B, C, D, E, F, G, H, I, J, K, L, M, N, O VD9 VKI LIGHT-CHAIN LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
801 6EQI 2 B Nb696 9844
802 2OL3 2 B BM3.3 T-CELL RECEPTOR BETA-CHAIN 10090
803 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
804 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
805 4KFZ 2 C, D Anti-LMO2 VH 9606 3.4.19.13 | Details
806 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
807 2UUD 2 K, L NQ10-1.12 ANTI-PHOX ANTIBODY 10090
808 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
809 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
810 4Y5X 2 B, E, H, K diabody 310 VH domain 9606
811 4YGA 2 B, D, F, H VHH-1B7 30538
812 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
813 4UT9 3 L, M, N, O BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, LIGHT CHAIN DOMAIN 9606
814 2A9N 1 L, M fluorescein-scfv light chain 9606
815 2A9N 2 H, I fluorescein-scfv heavy chain 9606
816 5XQY 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 Y96K mutant of REI VL 9606
817 5GS0 2 C, E light chain (anti-TLR3) 10090
818 5GS0 3 D, F heavy chain (anti-TLR3) 10090
819 5GS0 4 H, X heavy chain (anti-Lid) 10090
820 5GS0 5 L, Y light chain (anti-Lid) 10090
821 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
822 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
823 1KYO 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT RESIDUES 1-107 10090
824 5GRJ 1 H avelumab H chain 9606
825 5GRJ 2 L avelumab L chain 9606
826 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
827 4NKD 2 B, D, F, H Engineered scFv light chain 10090
828 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
829 5FM5 2 O, P OBSCURIN-LIKE-1 OL3 (THIRD IG DOMAIN), RESIDUES 251-339 9606
830 4KRO 2 B Nanobody/VHH domain EgA1 9844
831 3WXV 2 H V region heavy chain 10090
832 3WXV 3 L V region light chain 10090
833 1AR2 1 A REI VARIABLE REGION, LIGHT CHAIN 9606
834 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
835 4KV5 3 F, I, K, L light chain GC1009 scFv 9606
836 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
837 5TJW 2 K NP-specific inhibitory VHH 30538
838 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
839 1QLE 6 L LIGHT CHAIN ANTIBODY FV FRAGMENT 10090
840 4LDL 2 B Camelid Antibody Fragment 9844
841 3E3Q 3 C, D, I, M, R, V, Z, d T-cell receptor alpha chain V region PHDS58 10090
842 3E3Q 4 E, F, J, N, S, W, a, e TCR beta chain 10090
843 5XP1 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 UNP residues 22-117 9606
844 4LDO 2 B Camelid Antibody Fragment 9844
845 3SN6 5 N Camelid antibody VHH fragment 9844
846 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
847 4M8Q 1 A, H GEP1 Fv heavy chain 9606
848 4M8Q 2 B, L GEP1 Fv light chain UNP residues 21-129 9606
849 5NHR 1 B, L Bimagrumab Fv Light-Chain VL domain LIGAND BINDING domain 9606
850 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
851 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
852 5O8F 2 K, O Nanobody Nb25 9844
853 5O8F 3 L, M, N Nanobody Nb25 9844
854 5C3L 4 D Nanobody Nb15 Nanobody 9838
855 5J3H 2 C mAb 83-7 Fab heavy chain 10090
856 5J3H 3 D mAb 83-7 Fab light chain 10090
857 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
858 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
859 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
860 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
861 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
862 4PIR 2 F, G, H, I, J VHH15 9844
863 4QKX 2 B R9 protein 9844
864 5JQH 2 C, D Nanobody60, Nb60 9844
865 4YBQ 2 C, E antibody Fv fragment light chain 10090
866 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
867 4PD4 10 J Igh protein 10090
868 4PD4 11 K Ig kappa chain V-V region HP 124E1 10090
869 5DA0 2 B Nanobody 9844
870 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
871 4R0L 3 B, L Antibody 1C6 Light chain UNP residues 20-137 10090
872 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
873 4ODX 2 A, H GEP7 Fv heavy chain 9606
874 4ODX 3 B, L GEP7 Fv light chain 9606
875 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
876 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
877 3E2H 3 B T-cell receptor alpha chain V region PHDS58 10090
878 3E2H 4 C M67 TCR beta chain 10090
879 4H1L 4 G, I Ani2.3 TCR A chain 562
880 4H1L 5 H, J Ani2.3 TCR B chain 562
881 1RVF 5 L FAB 17-IA 10090
882 1RVF 6 H FAB 17-IA 10090
883 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
884 5JZ7 3 D, I, K, L MEDI578 scFv, light chain 9606
885 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
886 4MQS 2 B Nanobody 9-8 9844
887 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
888 5DHY 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
889 1QFW 3 L ANTIBODY (ANTI ALPHA SUBUNIT) (LIGHT CHAIN) FV 10090
890 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
891 1QFW 5 M ANTIBODY (ANTI BETA SUBUNIT) (LIGHT CHAIN) FV 10090
892 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
893 3K81 2 A, B Single strand antibody VHH domain