
Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

Sequence Similarity Clusters for the Entities in PDB 1N32

Entity #1 | Chains: A
16S RIBOSOMAL RNA rna, length: 1522 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
30S RIBOSOMAL PROTEIN S8 protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 134 316 34
95 % 134 316 49 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.4
90 % 134 320 50
70 % 134 320 60
50 % 162 501 23
40 % 182 663 21
30 % 182 663 35
Entity #11 | Chains: I
30S RIBOSOMAL PROTEIN S9 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 18 96 251
95 % 133 316 53 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
90 % 133 316 58
70 % 133 316 68
50 % 159 487 33
40 % 159 487 45
30 % 176 645 38
Entity #12 | Chains: J
30S RIBOSOMAL PROTEIN S10 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 315 38
95 % 133 315 55 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 1.1
90 % 133 315 60
70 % 133 315 69
50 % 165 503 21
40 % 182 642 23
30 % 182 644 37
Entity #13 | Chains: K
30S RIBOSOMAL PROTEIN S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 316 36
95 % 133 316 52 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.7
90 % 133 316 57
70 % 133 316 67
50 % 159 496 29
40 % 178 646 22
30 % 178 646 36
Entity #14 | Chains: L
30S RIBOSOMAL PROTEIN S12 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 112 283 46
95 % 133 323 42 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.7
90 % 133 323 47
70 % 160 511 14
50 % 160 514 20
40 % 160 514 34
30 % 160 514 56
Entity #15 | Chains: M
30S RIBOSOMAL PROTEIN S13 protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 317 33
95 % 133 317 48 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 0.7
90 % 133 317 54
70 % 133 317 63
50 % 162 500 27
40 % 162 500 38
30 % 179 647 39
Entity #16 | Chains: N
30S RIBOSOMAL PROTEIN S14 protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 315 37
95 % 133 315 54 Flexibility: Low
Max RMSD: 2.1, Avg RMSD: 0.8
90 % 133 315 59
70 % 133 322 58
50 % 133 333 91
40 % 133 333 108
30 % 133 333 121
Entity #17 | Chains: O
30S RIBOSOMAL PROTEIN S15 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 134 321 27
95 % 137 324 41 Flexibility: Low
Max RMSD: 1.3, Avg RMSD: 0.5
90 % 137 324 46
70 % 137 324 57
50 % 166 508 22
40 % 166 513 33
30 % 166 513 55
Entity #18 | Chains: P
30S RIBOSOMAL PROTEIN S16 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 311 39
95 % 133 316 50 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.5
90 % 133 316 55
70 % 133 316 64
50 % 133 328 93
40 % 162 493 43
30 % 162 493 62
Entity #19 | Chains: Q
30S RIBOSOMAL PROTEIN S17 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 9 40 942
95 % 133 313 57 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 0.7
90 % 133 313 62
70 % 133 313 72
50 % 133 313 98
40 % 133 313 115
30 % 133 313 127
Entity #2 | Chains: Y
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
30S RIBOSOMAL PROTEIN S18 protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 116 255 55
95 % 116 263 70 Flexibility: Low
Max RMSD: 8.4, Avg RMSD: 0.9
90 % 116 263 76
70 % 116 263 89
50 % 116 263 118
40 % 116 263 141
30 % 116 263 155
Entity #21 | Chains: S
30S RIBOSOMAL PROTEIN S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 134 319 30
95 % 134 319 44 Flexibility: Low
Max RMSD: 3.7, Avg RMSD: 0.9
90 % 134 319 51
70 % 160 496 15
50 % 160 502 24
40 % 160 505 35
30 % 160 505 57
Entity #22 | Chains: T
30S RIBOSOMAL PROTEIN S20 protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 119 270 51
95 % 133 315 56 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.7
90 % 133 315 61
70 % 133 315 70
50 % 133 315 96
40 % 133 315 112
30 % 133 315 125
Entity #23 | Chains: V
30S RIBOSOMAL PROTEIN THX protein, length: 26 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 305 42
95 % 133 305 58 Flexibility: Low
Max RMSD: 1.2, Avg RMSD: 0.5
90 % 133 305 63
70 % 133 305 74
50 % 133 305 101
40 % 133 305 118
30 % 133 305 130
Entity #3 | Chains: Z
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: B
30S RIBOSOMAL PROTEIN S2 protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 316 32
95 % 133 317 47 Flexibility: Low
Max RMSD: 9.2, Avg RMSD: 1.6
90 % 133 317 53
70 % 133 317 62
50 % 159 482 34
40 % 159 488 44
30 % 159 488 63
Entity #5 | Chains: C
30S RIBOSOMAL PROTEIN S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 115 263 54
95 % 115 263 69 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.7
90 % 115 263 75
70 % 115 263 88
50 % 119 339 89
40 % 119 339 104
30 % 119 339 118
Entity #6 | Chains: D
30S RIBOSOMAL PROTEIN S4 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 317 31
95 % 133 317 46 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 0.5
90 % 133 317 52
70 % 133 317 61
50 % 159 496 26
40 % 159 502 36
30 % 159 502 58
Entity #7 | Chains: E
30S RIBOSOMAL PROTEIN S5 protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 133 316 35
95 % 133 316 51 Flexibility: Low
Max RMSD: 4.8, Avg RMSD: 0.6
90 % 133 316 56
70 % 133 316 65
50 % 160 492 31
40 % 160 492 41
30 % 160 494 61
Entity #8 | Chains: F
30S RIBOSOMAL PROTEIN S6 protein, length: 101 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 135 321 28
95 % 141 327 39 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 0.9
90 % 141 327 44
70 % 141 327 55
50 % 141 327 92
40 % 141 327 109
30 % 165 432 89
Entity #9 | Chains: G
30S RIBOSOMAL PROTEIN S7 protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 134 321 29
95 % 134 321 43 Flexibility: Low
Max RMSD: 4.2, Avg RMSD: 0.8
90 % 134 321 49
70 % 134 321 59
50 % 160 435 62
40 % 160 441 75
30 % 160 441 88


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4CVN 2 E, F, G, H 30S RIBOSOMAL PROTEIN S11 29292
2 4YBB 11 AK, BK 30S ribosomal protein S11 562
3 4Y4O 42 1k, 2k 30S ribosomal protein S11 274
4 4CW7 2 B, D, F, H 30S RIBOSOMAL PROTEIN S11 29292
5 5J8B 44 k 30S ribosomal protein S11 274
6 4W2F 11 AK, CK 30S Ribosomal Protein S11 274
7 6CFL 42 1k, 2k 30S ribosomal protein S11 274
8 6CAE 42 1k, 2k 30S ribosomal protein S11 274
9 4Y4P 42 1k, 2k 30S ribosomal protein S11 274
10 5FDV 43 1k, 2k 30S ribosomal protein S11 274
11 5J4B 42 1k, 2k 30S ribosomal protein S11 274
12 4W2G 11 AK, CK 30S Ribosomal Protein S11 274
13 6CFK 42 1k, 2k 30S ribosomal protein S11 274
14 5J7L 11 AK, BK 30S ribosomal protein S11 562
15 5W4K 42 1k, 2k 30S ribosomal protein S11 274
16 4LFB 11 K ribosomal protein S11 274
17 1VY4 11 AK, CK 30S ribosomal protein S11 274
18 4WOI 11 AK, DK 30S ribosomal protein S11 562
19 5FDU 42 1k, 2k 30S ribosomal protein S11 274
20 6I7V 15 AK, BK 30S ribosomal protein S11 562
21 4W2I 11 AK, CK 30S Ribosomal Protein S11 274
22 5JC9 11 AK, BK 30S ribosomal protein S11 562
23 1VY5 11 AK, CK 30S ribosomal protein S11 274
24 5HCQ 42 1k, 2k 30S ribosomal protein S11 274
25 4WQF 44 BK, DK 30S ribosomal protein S11 274
26 4W2H 11 AK, CK 30S Ribosomal Protein S11 274
27 4WPO 44 BK, DK 30S ribosomal protein S11 274
28 5J8A 11 AK, BK 30S ribosomal protein S11 562
29 4V8I 11 AK, CK 30S Ribosomal Protein S11 274
31 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
32 4Z3S 42 1k, 2k 30S ribosomal protein S11 274
33 5DOY 42 1k, 2k 30S Ribosomal Protein S11 274
34 5J5B 11 AK, BK 30S ribosomal protein S11 562
35 5HD1 42 1k, 2k 30S ribosomal protein S11 274
36 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
37 4DR6 11 K 30S ribosomal protein S11 274
38 4LF7 11 K ribosomal protein S11 274
39 4LF8 11 K ribosomal protein S11 274
40 5WIS 42 1k, 2k 30S ribosomal protein S11 274
41 4WSD 11 2A, 2I 30S ribosomal protein S11 274
42 4WQU 44 BK, DK 30S ribosomal protein S11 274
43 5WIT 42 1k, 2k 30S ribosomal protein S11 274
44 5E81 11 2A, 2I 30S ribosomal protein S11 274
46 6GSJ 11 2A, 2I 30S ribosomal protein S11 274
47 4U27 11 AK, CK 30S ribosomal protein S11 562
48 6CFJ 42 1k, 2k 30S ribosomal protein S11 274
49 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
50 4Z8C 42 1k, 2k 30S ribosomal protein S11 274
51 5HCR 42 1k, 2k 30S ribosomal protein S11 274
52 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
54 4DV6 11 K ribosomal protein S11 274
55 4JYA 11 K 30S ribosomal protein S11 274
56 5IBB 11 2A, 2I 30S ribosomal protein S11 274
57 4DR5 11 K 30S ribosomal protein S11 274
58 5J4C 42 1k, 2k 30S ribosomal protein S11 274
59 4KHP 11 K 30S Ribosomal protein S11 274
60 4DR2 11 K 30S ribosomal protein S11 274
61 4WRO 15 2I 30S ribosomal protein S11 274
62 4WQ1 11 2A, 2I 30S ribosomal protein S11 274
63 4LF9 11 K ribosomal protein S11 274
64 4WQY 44 BK, DK 30S ribosomal protein S11 274
65 4DUY 11 K ribosomal protein S11 274
66 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
67 4DV7 11 K ribosomal protein S11 274
68 4WRA 11 2A, 2I 30S ribosomal protein S11 274
69 5IB7 11 2A, 2I 30S ribosomal protein S11 274
70 4U26 11 AK, CK 30S ribosomal protein S11 562
71 4X64 11 K 30S ribosomal protein S11 274
72 5HCP 42 1k, 2k 30S ribosomal protein S11 274
73 5IT8 11 AK, BK 30S ribosomal protein S11 562
74 4V9D 11 AK, BK 30S ribosomal protein S11 562
75 4V9P 43 BK, DK, FK, HK 30S ribosomal protein S11 562
76 4V9H 5 AK 30S ribosomal protein S11 274
77 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
78 5J91 11 AK, BK 30S ribosomal protein S11 562
81 4DR3 11 K 30S ribosomal protein S11 274
82 4V90 11 AK 30S RIBOSOMAL PROTEIN S11 274
84 4WQR 11 2A, 2I 30S ribosomal protein S11 274
88 5IB8 11 2A, 2I 30S ribosomal protein S11 274
89 4V9R 11 AK, CK 30S Ribosomal Protein S11 274
90 4B3M 11 K 30S RIBOSOMAL PROTEIN S11 274
91 5EL6 11 2A, 2I 30S ribosomal protein S11 274
92 5EL7 11 2A, 2I 30S ribosomal protein S11 274
93 5VP2 42 1k, 2k 30S ribosomal protein S11 274
94 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
95 4LF4 11 K ribosomal protein S11 274
96 5DFE 45 QK, XK 30S ribosomal protein S11 274
97 5NDK 6 2A, 2I 30S ribosomal protein S11 274
98 4LF6 11 K ribosomal protein S11 274
100 5J88 11 AK, BK 30S ribosomal protein S11 562
101 4U24 11 AK, CK 30S ribosomal protein S11 562
102 4WU1 11 2A, 2I 30S ribosomal protein S11 274
103 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
104 5EL4 11 2A, 2I 30S ribosomal protein S11 274
105 5WNV 11 K 30S ribosomal protein S11 274
106 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
107 4B3T 11 K 30S RIBOSOMAL PROTEIN S11 274
108 4WR6 11 2A, 2I 30S ribosomal protein S11 274
109 4V8B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
110 5HAU 44 1k, 2k 30S ribosomal protein S11 274
111 4V9O 44 BK, DK, FK, HK 30S ribosomal protein S11 562
114 4V87 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
115 4WF1 11 AK, CK 30S ribosomal protein S11 562
116 4U25 11 AK, CK 30S ribosomal protein S11 562
117 4V95 11 AK, CK 30S Ribosomal Protein S11 274
118 4WWW 42 QK, XK 30S ribosomal protein S11 562
119 4V7T 11 AK, CK 30S ribosomal protein S11 562
120 1VY7 11 AK, CK 30S ribosomal protein S11 274
121 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
122 5E7K 11 2A, 2I 30S ribosomal protein S11 274
123 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
124 5EL5 11 2A, 2I 30S ribosomal protein S11 274
125 6FKR 42 1k, 2k 30S ribosomal protein S11 274
126 4B3R 11 K 30S RIBOSOMAL PROTEIN S11 274
127 4LNT 11 QK, XK 30S ribosomal protein S11 274
128 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
129 4DR1 11 K 30S ribosomal protein S11 274
130 4LFA 11 K ribosomal protein S11 274
131 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
132 4DV4 11 K ribosomal protein S11 274
133 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
134 4YZV 11 QK, XK 30S ribosomal protein S11 274
135 4JI0 11 K ribosomal protein S11 274
136 5IWA 10 K 30S ribosomal protein S11 274
137 4V7U 11 AK, CK 30S ribosomal protein S11 562
138 4V9S 11 AK, CK 30S Ribosomal Protein S11 274
140 4V6C 10 AK, CK 30S ribosomal protein S11 562
141 4JV5 11 K 30S ribosomal protein S11 274
142 4DR7 11 K 30S ribosomal protein S11 274
143 1J5E 11 K 30S RIBOSOMAL PROTEIN S11 274
144 4GKK 11 K 30S ribosomal protein S11 274
145 4DUZ 11 K ribosomal protein S11 274
146 5NDJ 6 2A, 2I 30S ribosomal protein S11 274
147 4V7V 11 AK, CK 30S ribosomal protein S11 562
148 4X65 11 K 30S ribosomal protein S11 274
149 4V8G 11 AK, CK 30S Ribosomal Protein S11 274
150 4GKJ 11 K 30S ribosomal protein S11 274
151 4DV3 11 K ribosomal protein S11 274
152 4V7S 11 AK, CK 30S ribosomal protein S11 562
153 4DV5 11 K ribosomal protein S11 274
154 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
156 4LFC 11 K ribosomal protein S11 274
158 3T1Y 11 K 30S ribosomal protein S11 274
159 4WZO 11 2A, 2I 30S ribosomal protein S11 274
161 1VY6 11 AK, CK 30S ribosomal protein S11 274
162 1XMQ 13 K 30S Ribosomal Protein S11 274
163 5WNP 11 K 30S ribosomal protein S11 274
164 6CAP 11 K 30S ribosomal protein S11 274
165 4U20 11 AK, CK 30S ribosomal protein S11 562
166 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
167 4DV0 11 K ribosomal protein S11 274
168 4V9B 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
169 4U1V 11 AK, CK 30S ribosomal protein S11 562
170 4V6F 41 BN, CN 30S ribosomal protein S11 274
171 4X62 11 K 30S ribosomal protein S11 274
172 4V8F 41 BN, CN 30S RIBOSOMAL PROTEIN S11 274
173 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
174 4B3S 11 K 30S RIBOSOMAL PROTEIN S11 274
175 4DV2 11 K ribosomal protein S11 274
176 4DV1 11 K ribosomal protein S11 274
177 5WNU 11 K 30S ribosomal protein S11 274
178 1N32 13 K 30S RIBOSOMAL PROTEIN S11 274
179 5F8K 42 1k, 2k 30S ribosomal protein S11 274
180 1I94 11 K 30S RIBOSOMAL PROTEIN S11 274
181 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
182 4V8H 11 AK, CK 30S Ribosomal Protein S11 274
183 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
185 6CAQ 11 K 30S ribosomal protein S11 274
186 4K0K 11 K 30S ribosomal protein S11 274
187 4W2E 44 k 30S ribosomal protein S11 274
188 4V8C 41 CN, DN 30S RIBOSOMAL PROTEIN S11 274
189 5BR8 11 K 30S ribosomal protein S11 274
190 4LF5 11 K ribosomal protein S11 274
191 5J4D 45 TA, YC 30S ribosomal protein S11 274
192 4V9A 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
193 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
194 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
195 4V5J 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
196 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
197 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
198 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
199 6ND6 42 1k, 2k 30S ribosomal protein S11 274
200 4V7Y 11 AK, CK 30S ribosomal protein S11 274
201 6GSK 11 2A, 2I 30S ribosomal protein S11 274
202 4V9C 11 AK, CK 30S ribosomal protein S11 562
203 4V8E 41 BN, DN 30S RIBOSOMAL PROTEIN S11 274
204 5J30 42 QK, XK 30S ribosomal protein S11 274
205 4DR4 11 K 30S ribosomal protein S11 274
206 4WZD 11 2A, 2I 30S ribosomal protein S11 274
208 4X66 11 K 30S ribosomal protein S11 274
209 2UU9 11 K 30S RIBOSOMAL PROTEIN S11 274
210 4V8Q 45 BK 30S RIBOSOMAL PROTEIN S11 274
211 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
212 4V85 11 AK 30S ribosomal protein S11 562
213 1HR0 12 K 30S RIBOSOMAL PROTEIN S11 274
215 4W4G 11 QK, XK 30S ribosomal protein S11 274
216 4NXM 11 K ribosomal protein S11 274
217 4V5L 11 AK 30S RIBOSOMAL PROTEIN S11 274
218 4YPB 11 QK, XK 30S ribosomal protein S11 274
219 4V7X 11 AK, CK 30S ribosomal protein S11 274
220 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
221 4U1U 11 AK, CK 30S ribosomal protein S11 562
222 4ZER 42 1k, 2k 30S ribosomal protein S11 274
224 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
225 4V7W 11 AK, CK 30S ribosomal protein S11 274
226 4WT1 11 2A, 2I 30S ribosomal protein S11 274
227 6C5L 11 AK, CK 30S ribosomal protein S11 274
228 4WT8 11 AK, BK 30S ribosomal protein S11 274
229 5DOX 42 1k, 2k 30S ribosomal protein S11 274
230 4NXN 11 K ribosomal protein S11 274
231 1XNR 13 K 16S Ribosomal protein S11 274
232 4LT8 11 QK, XK 30S ribosomal protein S11 274
233 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
234 5WNQ 11 K 30S ribosomal protein S11 274
235 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
236 4V51 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
237 4V7L 11 AK, CK 30S ribosomal protein S11 274
238 4V5R 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
240 1XNQ 13 K Ribosomal protein S11 274
241 4V8A 41 CK, DK 30S ribosomal protein S11 274
242 4V5K 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
243 4V5Q 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
244 4V7J 10 Ak, Bk 30S ribosomal protein S11 274
245 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
246 6BZ6 11 QK, XK 30S ribosomal protein S11 274
247 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
248 5J3C 42 QK, XK 30S ribosomal protein S11 274
249 4V5C 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
250 4V5E 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
251 4L47 11 QK, XK 30S ribosomal protein S11 274
252 4V5P 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
253 5V8I 42 1k, 2k 30S ribosomal protein S11 274
254 4ZSN 11 QK, XK 30S ribosomal protein S11 274
255 4V5D 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
256 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
257 6BUW 11 QK, XK 30S ribosomal protein S11 274
258 4V7Z 11 AK, CK 30S ribosomal protein S11 274
259 4V8X 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
260 4V5S 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
261 4V9I 11 AK, CK 30S Ribosomal protein S11 274
262 1XMO 13 K 30S ribosomal protein S11 274
263 3T1H 11 K 30S ribosomal protein S11 274
265 1N33 13 K 30S RIBOSOMAL PROTEIN S11 274
267 4V6G 11 AN, CN 30S RIBOSOMAL PROTEIN S11 274
268 4V8N 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
269 4V97 11 AK, CK 30S ribosomal protein S11 274
270 6CAR 11 K 30S ribosomal protein S11 274
272 4V7M 11 AK, CK 30S ribosomal protein S11 274
273 4WSM 11 2A, 2I 30S ribosomal protein S11 274
274 4TUD 11 QK, XK 30S ribosomal protein S11 274
276 5WNR 11 K 30S ribosomal protein S11 274
277 6CAO 11 K 30S ribosomal protein S11 274
278 4V6A 11 AK, CK 30S ribosomal protein S11 274
279 4TUE 11 QK, XK 30S ribosomal protein S11 274
280 4TUA 11 QK, XK 30S ribosomal protein S11 274
282 4V84 11 AK, CK 30S ribosomal protein S11 274
283 5WNS 11 K 30S ribosomal protein S11 274
284 4V7K 10 Ak, Bk 30S ribosomal protein S11 274
285 4YY3 11 K 30S ribosomal protein S11 274
287 4V9Q 41 BK, DK 30S ribosomal protein S11 274
288 6BZ8 11 QK, XK 30S ribosomal protein S11 274
289 4TUC 11 QK, XK 30S ribosomal protein S11 274
290 4YHH 11 K 30S ribosomal protein S11 274
291 5VPO 12 QK, XK 30S ribosomal protein S11 274
292 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
293 4TUB 11 QK, XK 30S ribosomal protein S11 274
294 4V9N 14 AK, CK 30S ribosomal protein S11 274
295 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
296 4P70 11 QK, XK 30S ribosomal protein S11 274
297 4V8U 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
298 4LSK 11 QK, XK 30S ribosomal protein S11 274
299 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
300 4V6D 10 AK, CK 30S ribosomal protein S11 562
301 4P6F 11 QK, XK 30S ribosomal protein S11 274
302 4V67 13 AK, CK 30S ribosomal protein S11 274
303 4V83 11 AK, CK 30S ribosomal protein S11 274
304 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
305 4V5F 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
306 4V5O 20 AK, BK RPS14E 5911
307 1VVJ 11 QK, XK 30S ribosomal protein S11 274
308 4LFZ 11 QK, XK 30S ribosomal protein S11 274
309 2E5L 12 K 30S ribosomal protein S11 274
310 6BZ7 11 QK, XK 30S ribosomal protein S11 274
311 4V6E 10 AK, CK 30S ribosomal protein S11 562
312 6CAS 11 K 30S ribosomal protein S11 274
313 4V52 10 AK, CK 30S ribosomal protein S11 562
314 5CZP 42 QK, XK 30S ribosomal protein S11 274
315 6N9F 42 1k, 2k 30S ribosomal protein S11 274
316 6N9E 42 1k, 2k 30S ribosomal protein S11 274
317 2HHH 11 K 30S ribosomal protein S11 274
318 4V89 11 AK 30S ribosomal protein S11 562
319 4OX9 11 K 30S ribosomal protein S11 274
320 4V54 10 AK, CK 30S ribosomal protein S11 562
322 1I96 11 K 30S RIBOSOMAL PROTEIN S11 274
323 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
324 4V9K 10 AK, CK 30S ribosomal protein S11 274
325 4V50 13 AK, CK 30S ribosomal protein S11 562
326 1N34 12 K 30S RIBOSOMAL PROTEIN S11 274
327 4V57 10 AK, CK 30S ribosomal protein S11 562
328 4V5A 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
329 4V63 13 AK, CK 30S ribosomal protein S11 274
330 4L71 11 QK, XK 30S ribosomal protein S11 274
331 4KVB 11 K 30S ribosomal protein S11 274
332 4XEJ 38 AS11, BS11 30S ribosomal protein S11 274
333 4V64 10 AK, CK 30S ribosomal protein S11 562
334 4V7P 11 AK, DK 30S ribosomal protein S11 274
335 4V8J 11 AK, CK 30S ribosomal protein S11 274
336 1N36 11 K 30S RIBOSOMAL PROTEIN S11 274
337 2ZM6 11 K 30S ribosomal protein S11 274
338 4V4H 10 AK, CK 30S RIBOSOMAL PROTEIN S11 562
339 4V4Q 10 AK, CK 30S ribosomal protein S11 562
341 5D8B 38 HC, LA 30S ribosomal protein S11 274
342 4LEL 11 QK, XK 30S ribosomal protein S11 274
343 4V53 10 AK, CK 30S ribosomal protein S11 562
344 2F4V 12 K 30S ribosomal protein S11 274
345 4V9L 10 AK, CK 30S ribosomal protein S11 274
346 4V5G 11 AK, CK 30S RIBOSOMAL PROTEIN S11 274
347 4V56 10 AK, CK 30S ribosomal protein S11 562
348 1I97 11 K 30S RIBOSOMAL PROTEIN S11 274
349 4V9J 10 AK, CK 30S ribosomal protein S11 274
350 4V55 10 AK, CK 30S ribosomal protein S11 562
351 1I95 11 K 30S RIBOSOMAL PROTEIN S11 274
352 4V8O 11 AK 30S RIBOSOMAL PROTEIN S11 274
353 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
354 4V9M 10 AK, CK 30S ribosomal protein S11 274
355 4W29 10 AK, CK 30S ribosomal protein S11 274
356 4V5Y 10 AK, CK 30S ribosomal protein S11 562
357 4V4Y 13 AN 30S ribosomal protein S11 274
358 4V4J 44 l 30S ribosomal protein S11 274
359 4V4X 13 AN 30S ribosomal protein S11 274
360 4V4Z 14 AN 30S ribosomal protein S11 274
361 4V4I 44 l 30S ribosomal protein S11 274
362 4V4P 46 BN 30S ribosomal protein S11 274
363 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
364 4V4R 14 AK 30S ribosomal protein S11 274
365 4V4S 14 AK 30S ribosomal protein S11 274
366 4V4T 14 AK 30S ribosomal protein S11 274
367 4KZZ 15 O 40S Ribosomal Protein S14 9986
368 4KZX 15 O 40S ribosomal protein S14 9986
369 4KZY 15 O 40S Ribosomal Protein S14 9986
370 4V49 13 AK 30S ribosomal protein S11 562
371 4V4A 11 AK 30S ribosomal protein S11 562
372 4V4G 11 AK, CK, EK, GK, IK 30S ribosomal protein S11 562
373 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
374 6MTB 65 OO 40S ribosomal protein S14 9986
375 6MTC 64 OO 40S ribosomal protein S14 9986
376 6MTD 66 OO uS11 9986
377 6MTE 65 OO uS11 9986
378 6HRM 43 p 30S ribosomal protein S11 562
379 6HA1 41 k 30S ribosomal protein S11 1423
380 6HA8 43 k 30S ribosomal protein S11 1423
381 6H58 42 k, kk 30S ribosomal protein S11 562
382 6H4N 11 k 30S ribosomal protein S11 562
383 6DZI 11 t 30S ribosomal protein S11 1772
384 6DZK 11 K 30S ribosomal protein S11 1772
385 6GZX 41 K3, K4 30S ribosomal protein S11 274
386 6GZZ 41 K3, K4 30S ribosomal protein S11 274
387 6GZQ 41 K2 30S ribosomal protein S11 274
388 6GZ3 31 BO ribosomal protein uS11 9986
389 6GZ4 34 BO ribosomal protein uS11 9986
390 6GZ5 31 BO ribosomal protein uS11 9986
391 6GXM 44 k 30S ribosomal protein S11 562
392 6GXN 44 k 30S ribosomal protein S11 562
393 6GXO 44 k 30S ribosomal protein S11 562
394 6GXP 43 k 30S ribosomal protein S11 562
395 6GWT 44 k 30S ribosomal protein S11 562
396 6GSL 11 2A, 2I 30S ribosomal protein S11 274
397 6GQV 62 AE 40S ribosomal protein S14-B 4932
398 6GQ1 62 AE 40S ribosomal protein S14-B 4932
399 6GQB 62 AE 40S ribosomal protein S14-B 4932
400 6DNC 48 XA 30S ribosomal protein S11 562
401 6D9J 64 PP uS11 9986
402 6D90 65 PP uS11 9986
403 5ZLU 17 P 30S ribosomal protein S11 274
404 6G5H 12 O 40S ribosomal protein S14 9606
405 6G5I 16 O 40S ribosomal protein S14 9606
406 6G4S 27 O 40S ribosomal protein S14 9606
407 6G4W 23 O 40S ribosomal protein S14 9606
408 6G51 13 O 40S ribosomal protein S14 9606
409 6G53 13 O 40S ribosomal protein S14 9606
410 6G18 23 O 40S ribosomal protein S14 9606
411 6FYX 18 O 40S ribosomal protein S14 28985
412 6FYY 18 O 40S ribosomal protein S14 28985
413 6FXC 11 Ak, Bk 30S ribosomal protein S11 1280
414 5ZEU 8 k 30S ribosomal protein S11 1772
415 5ZEB 8 k 30S ribosomal protein S11 1772
416 5ZEP 8 k 30S ribosomal protein S11 1772
417 6C4I 44 k 30S ribosomal protein S11 562
418 6FEC 38 j 40S ribosomal protein S14 9606
419 6FAI 25 O 40S ribosomal protein S14-A 4932
420 6BU8 41 K 30S ribosomal protein S11 562
421 6BOH 45 UA, ZC 30S ribosomal protein S11 274
422 6BOK 44 SA, VC 30S ribosomal protein S11 274
423 6ERI 44 BK 30S ribosomal protein S11, chloroplastic 3562
424 6ENU 11 k 30S ribosomal protein S11 562
425 6ENJ 41 k 30S ribosomal protein S11 562
426 6ENF 11 k 30S ribosomal protein S11 562
427 6EML 22 Z 40S ribosomal protein S14-A 4932
428 6B4V 45 TA, XC 30S ribosomal protein S11 274
429 6EK0 75 SO 40S ribosomal protein S14 9606
430 6AZ1 15 O ribosomal protein S11 5661
431 6AWB 16 N 30S ribosomal protein S11 562
432 6AWC 16 N 30S ribosomal protein S11 562
433 6AWD 15 N 30S ribosomal protein S11 562
434 5OT7 17 J 30S ribosomal protein S11 274
435 5OQL 42 t 40S ribosomal protein S14-like protein 209285
436 5OPT 14 V 40S ribosomal protein S14, putative 5693
437 5WLC 40 NG rpS14_uS11 4932
438 5WFK 44 k 30S ribosomal protein S11 562
439 5WFS 44 k 30S ribosomal protein S11 562
440 5WF0 44 k 30S ribosomal protein S11 562
441 5XYU 10 K 30S ribosomal protein S11 1772
442 5XYI 16 O Ribosomal protein S14 5722
443 5WE4 44 k 30S ribosomal protein S11 562
444 5WE6 44 k 30S ribosomal protein S11 562
445 5WDT 44 k 30S ribosomal protein S11 562
446 5XXU 16 O Ribosomal protein uS11 5811
447 5OA3 19 O 40S ribosomal protein S14 9606
448 5O61 45 BK 30S ribosomal protein S11 1772
449 5O5J 11 K 30S ribosomal protein S11 1772
450 5O2R 45 k 30S ribosomal protein S11 562
451 5NWY 45 A 30S ribosomal protein S11 562
452 5VPP 40 QK, XK 30S ribosomal protein S11 274
453 5NP6 14 N 30S ribosomal protein S11 562
454 5NO2 9 K 30S ribosomal protein S11 562
455 5NO3 10 K 30S ribosomal protein S11 562
456 5NO4 10 K 30S ribosomal protein S11 562
457 5NJT 11 K 30S ribosomal protein S11 1423
458 5V93 42 k 30S ribosomal protein S11 1773
459 5NGM 11 Ak 30S ribosomal protein S11 1280
460 5ND8 11 k 30S ribosomal protein S11 1280
461 5ND9 11 k 30S ribosomal protein S11 1280
462 5X8P 41 k 30S ribosomal protein S11, chloroplastic 3562
463 5X8R 9 k 30S ribosomal protein S11, chloroplastic 3562
464 5UYK 41 K 30S ribosomal protein S11 562
465 5UYL 41 K 30S ribosomal protein S11 562
466 5UYM 41 K 30S ribosomal protein S11 562
467 5UYN 41 K 30S ribosomal protein S11 562
468 5UYP 41 K 30S ribosomal protein S11 562
469 5UYQ 41 K 30S ribosomal protein S11 562
470 5UZ4 10 K 30S ribosomal protein S11 562
471 5UQ7 42 k 30S ribosomal protein S11 274
472 5UQ8 42 k 30S ribosomal protein S11 274
473 5MYJ 11 AK 30S ribosomal protein S11 1358
474 5MY1 10 K 30S ribosomal protein S11 562
475 5WYJ 45 SP 40S ribosomal protein S14-A 4932
476 5WYK 41 SP 40S ribosomal protein S14-A 4932
477 5U9F 49 K 30S ribosomal protein S11 562
478 5U9G 49 K 30S ribosomal protein S11 562
479 5MMM 47 k 30S ribosomal protein S11, chloroplastic 3562
480 5MMJ 13 k 30S ribosomal protein S11, chloroplastic 3562
481 5U4I 42 k 30S ribosomal protein S11 Gene Name(s): rpsK b3297 JW3259 562
482 5MGP 42 k 30S ribosomal protein S11 562
483 5ME0 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
484 5ME1 11 K 30S ribosomal protein S11 Taken from PDB entry 4YBB 562
485 5MDV 48 p 30S ribosomal protein S11 562
486 5MDW 48 p 30S ribosomal protein S11 562
487 5MDY 48 p 30S ribosomal protein S11 562
488 5MDZ 46 p 30S ribosomal protein S11 562
489 5H5U 49 r 30S ribosomal protein S11 562
490 5MC6 27 Z 40S ribosomal protein S14-A 4932
491 5M1J 22 O2 40S ribosomal protein S14-A 4932
492 5LZA 11 k 30S ribosomal protein S11 562
493 5LZB 11 k 30S ribosomal protein S11 562
494 5LZC 11 k 30S ribosomal protein S11 562
495 5LZD 11 k 30S ribosomal protein S11 562
496 5LZE 11 k 30S ribosomal protein S11 562
497 5LZF 11 k 30S ribosomal protein S11 562
498 5TCU 10 S2 30S ribosomal protein S11 1280
499 5T7V 3 S2 30S ribosomal protein S11 1280
500 5T2A 63 AH uS11 5661
501 5T2C 80 AO 40S ribosomal protein S14 9606
502 5LMN 11 K 30S ribosomal protein S11 Uniprot code P80376 274
503 5LMO 11 K 30S ribosomal protein S11 274
504 5LMP 11 K 30S ribosomal protein S11 274
505 5LMQ 11 K 30S ribosomal protein S11 274
506 5LMR 11 K 30S ribosomal protein S11 274
507 5LMS 11 K 30S ribosomal protein S11 274
508 5LMT 11 K 30S ribosomal protein S11 274
509 5LMU 11 K 30S ribosomal protein S11 274
510 5LMV 11 K 30S ribosomal protein S11 274
511 5LL6 12 Z 40S ribosomal protein S14-A 4932
512 5LKS 74 SO 40S ribosomal protein S14 9606
513 5LI0 11 k 30S ribosomal protein S11 1280
514 5KPS 42 16 30S ribosomal protein S11 562
515 5KPV 41 15 30S ribosomal protein S11 562
516 5KPW 41 15 30S ribosomal protein S11 562
517 5KPX 41 15 30S ribosomal protein S11 562
518 5KCR 43 1k 30S ribosomal protein S11 562
519 5KCS 45 1k 30S ribosomal protein S11 562
520 5L3P 42 k 30S ribosomal protein S11 562
521 5K0Y 32 j ribosomal protein uS11 9986
522 5JU8 11 AK 30S ribosomal protein S11 562
523 5JUO 64 LB uS11 (yeast S14) 4932
524 5JUP 64 LB uS11 (yeast S14) 4932
525 5JUS 64 LB uS11 (yeast S14) 4932
526 5JUT 64 LB uS11 (yeast S14) 4932
527 5JUU 64 LB uS11 (yeast S14) 4932
528 5JTE 11 AK 30S ribosomal protein S11 562
529 5JPQ 29 w uS11 209285
530 5JB3 2 M 30S ribosomal protein S11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
531 5JBH 14 M 30S ribosomal protein uS11 30S ribosomal protein uS11 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
532 5IT7 62 O 40S ribosomal protein S14 28985
533 5IT9 15 O Ribosomal protein uS14 28985
534 5IQR 41 p 30S ribosomal protein S11 562
535 5IMQ 18 O 30S ribosomal protein S11 274
536 5IMR 11 O 30S ribosomal protein S11 274
537 3JCN 42 l 30S ribosomal protein S11 562
538 3JCJ 47 q 30S ribosomal protein S11 562
539 3JCD 10 k 30S ribosomal protein S11 562
540 3JCE 10 k 30S ribosomal protein S11 562
541 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
542 3JBU 10 K 30S ribosomal protein S11 562
543 3JBV 11 K 30S ribosomal protein S11 UNP residues 1-131 562
544 3JBN 26 P 40S ribosomal protein uS11 5833
545 3JBO 32 P 40S ribosomal protein uS11 5833
546 3JBP 26 P 40S ribosomal protein uS11 5833
547 5A9Z 44 BO 30S ribosomal protein S11 274
548 5AA0 44 BO 30S ribosomal protein S11 274
549 3JAP 18 O uS11 28985
550 3JAQ 18 O uS11 28985
551 3JAM 16 O uS11 28985
552 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
553 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
554 3JAG 66 OO uS11 9986
555 3JAH 66 OO uS11 9986
556 3JAI 66 OO uS11 9986
558 3JA1 11 SK 30S ribosomal protein S11 562
559 3J9Z 5 SK 30S ribosomal protein S11 562
560 3J9Y 7 k 30S ribosomal protein S11 562
561 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
562 3J9W 11 AK 30S ribosomal protein uS11 1423
564 5AJ0 64 BO 40S ribosomal protein S14 9606
565 5AFI 11 k 30S ribosomal protein S11 562
566 4UER 21 K US11 4934
567 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
568 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
569 4V3P 9 SK 40S ribosomal protein S14 4565
570 3J81 16 O uS11 28985
571 3J80 12 O uS11 28985
572 3J7P 64 SO Ribosomal protein uS11 9823
573 3J7R 65 SO Ribosomal protein uS11 9823
576 3J7A 16 P 40S ribosomal protein uS11 5833
577 3J77 60 14 40S ribosomal protein S14 4932
578 3J78 60 14 40S ribosomal protein S14 4932
579 3J6X 61 14 40S ribosomal protein S14 4932
580 3J6Y 61 14 40S ribosomal protein S14 4932
582 4V92 17 BO US11 28985
583 4V7E 16 BO 40S ribosomal protein S11 4565
584 4V7D 45 BK 30S ribosomal protein S11 562
585 4V7C 11 AK 30S ribosomal protein S11 562
586 4V7B 11 AK 30S ribosomal protein S11 562
587 4V6Y 10 AK 30S ribosomal protein S11 562
588 4V6Z 10 AK 30S ribosomal protein S11 562
589 4V70 10 AK 30S ribosomal protein S11 562
590 4V71 10 AK 30S ribosomal protein S11 562
591 4V72 10 AK 30S ribosomal protein S11 562
592 4V73 10 AK 30S ribosomal protein S11 562
593 4V74 10 AK 30S ribosomal protein S11 562
594 4V75 10 AK 30S ribosomal protein S11 562
595 4V76 10 AK 30S ribosomal protein S11 562
596 4V77 10 AK 30S ribosomal protein S11 562
597 4V78 10 AK 30S ribosomal protein S11 562
598 4V79 10 AK 30S ribosomal protein S11 562
599 4V7A 10 AK 30S ribosomal protein S11 562
600 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
601 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
602 4V4N 25 BM 30S ribosomal protein S11P SEE REMARK 999 2190
603 4V6W 5 AO 40S ribosomal protein S14 7227
604 4V6X 5 AO 40S ribosomal protein S14 9606
605 4V6V 2 AK 30S ribosomal protein S11 562
606 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
607 4V6U 14 AM 30S ribosomal protein S11P 2261
608 4V6T 11 AK 30S ribosomal protein S11 562
610 4V6S 47 BM 30S ribosomal protein S11 562
611 4V6P 14 AN 30S ribosomal protein S11 562
612 4V6Q 14 AN 30S ribosomal protein S11 562
613 4V6R 14 AN 30S ribosomal protein S11 562
614 4V6N 48 BN 30S ribosomal protein S11 562
615 4V6O 14 AN 30S ribosomal protein S11 562
616 3J0O 12 K Ribosomal protein S14 9986
617 3J0L 12 K Ribosomal protein S14 9986
618 4A2I 11 K 30S RIBOSOMAL PROTEIN S11 562
620 4V6M 15 AK 30S ribosomal protein S11 562
621 4V6K 47 BO 30S ribosomal protein S11 562
622 4V6L 14 AO 30S ribosomal protein S11 562
623 4V5N 11 AK 30S RIBOSOMAL PROTEIN S11 274
624 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
625 4V5M 11 AK 30S RIBOSOMAL PROTEIN S11 274
626 4V5H 11 AK 30S RIBOSOMAL PROTEIN S11 RESIDUES 13-129 562
627 4V7I 46 BK 30S ribosomal protein S11 562
628 4V7H 10 AK 40S ribosomal protein S14(A) 5541
629 3IY8 6 K 30S ribosomal protein S11 562
630 4V68 7 AK 30S ribosomal protein S11 274
631 4V69 2 AK 30S ribosomal protein S11 562
632 4V65 5 AC 30S ribosomal protein S11 562
633 4V66 5 AC 30S ribosomal protein S11 562
634 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
635 4V61 11 AK Ribosomal Protein S11 modeled using Escherichia coli 2AVY as template 3562
636 4V4V 12 AK 30S ribosomal subunit protein S11 562
637 4V4W 12 AK 30S ribosomal subunit protein S11 562
638 1X18 7 G 30S ribosomal protein S11 274
639 4V4B 11 AK 40S ribosomal protein S14-A 4932
640 4V47 37 BK 30S RIBOSOMAL PROTEIN S11 562
641 4V48 39 BK 30S RIBOSOMAL PROTEIN S11 562
642 1ML5 16 N 30S RIBOSOMAL PROTEIN S11 562
646 4V42 14 AN 30S RIBOSOMAL PROTEIN S11 274