Sequence Similarity Clusters for the Entities in PDB 1N0Y

Entity #1 | Chains: A,B
Calmodulin protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 6 7 9071
95 % 6 7 9067 Flexibility: Low
Max RMSD: 2.5, Avg RMSD: 0.9
PDBFlex
90 % 33 207 78
70 % 34 209 95
50 % 37 242 109
40 % 38 365 48
30 % 50 438 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 4J9Y 2 R Calmodulin 10116
14 2O60 1 A Calmodulin 9031
15 5V03 2 R Calmodulin 9606
16 3IF7 1 A Calmodulin 9913
17 5NIN 1 A, B Calmodulin 9606
18 1QTX 1 A PROTEIN (CALMODULIN) 562
19 4G28 2 R Calmodulin 10116
20 4G27 2 R Calmodulin 10116
21 1G4Y 2 R CALMODULIN 10116
22 4J9Z 2 R Calmodulin 10116
23 2F3Z 1 A Calmodulin 9606
24 1PRW 1 A Calmodulin 9913
25 1OSA 1 A CALMODULIN 5888
26 5JQA 1 A Calmodulin 9606
27 1MXE 1 A, B Calmodulin 7227
28 1YR5 1 A calmodulin residues 1-148 9606
29 5JTH 1 A Calmodulin 9606
30 1CLL 1 A CALMODULIN 9606
31 5V02 2 R Calmodulin-1 9606
32 2WEL 2 D CALMODULIN 9606
33 1N0Y 1 A, B Calmodulin 5888
34 3BYA 1 A Calmodulin 9606
35 1VRK 1 A CALMODULIN 32630
36 3SJQ 1 A, B Calmodulin 10116
37 5K8Q 1 A Calmodulin 9606
38 4EHQ 1 A Calmodulin 10116
39 1CLM 1 A CALMODULIN 5888
40 4BW7 1 A, C CALMODULIN 9606
41 1AHR 1 A CALMODULIN 9031
42 1IQ5 1 A CALMODULIN 8355
43 5WBX 2 R Calmodulin-1 9606
44 1CM4 1 A CALMODULIN 9913
45 1ZUZ 1 A calmodulin 9606
46 1QS7 1 A, C CALMODULIN 562
47 2Y4V 1 A CALMODULIN 9606
48 2HQW 1 A Calmodulin 10116
49 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
50 3SUI 1 A Calmodulin 9606
51 1UP5 1 A, B Calmodulin 9031
52 4BW8 1 A, B CALMODULIN 9606
53 4QNH 2 R Calmodulin 10116
54 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
55 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
56 4Q5U 1 A Calmodulin 9606
57 4AQR 1 A, B CALMODULIN-7 3702
58 2BE6 1 A, B, C Calmodulin 2 9606
59 1CDL 1 A, B, C, D CALMODULIN 9606
60 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
61 4DBP 2 C Calmodulin 7227
62 4HEX 1 A, B Calmodulin 10090
63 4M1L 1 A Calmodulin UNP residues 2-149 9606
64 2BCX 1 A Calmodulin 9031
65 1LIN 1 A CALMODULIN 9913
66 3CLN 1 A CALMODULIN 10117
67 1IWQ 1 A CALMODULIN 9606
68 2V01 1 A CALMODULIN 9606
69 1WRZ 1 A calmodulin 9606
70 2YGG 2 B CALMODULIN 10116
71 1RFJ 1 A calmodulin 4113
72 3L9I 2 C Calmodulin 7227
73 1CM1 1 A CALMODULIN 9913
74 1NIW 1 A, C, E, G calmodulin 10116
75 4CLN 1 A CALMODULIN 7227
76 3G43 1 A, B, C, D Calmodulin 9606
77 6CZQ 2 R Calmodulin-1 residues 5-148 10116
78 1XA5 1 A Calmodulin 9913
79 1OOJ 1 A Calmodulin CMD-1 6239
80 2X0G 2 B CALMODULIN 9606
81 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
82 6B8P 2 B, D, F, H Calmodulin-1 9606
83 4DCK 2 B Calmodulin Calmodulin 9606
84 4PJJ 2 B Calmodulin 7227
85 4L79 2 B Calmodulin 9606
86 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
87 5WC5 2 R Calmodulin-1 9606
88 2X51 2 B CALMODULIN 7227
89 6B8N 2 B, D, F, H Calmodulin-1 9606
90 6B8L 2 B, D, F, H Calmodulin-1 9606
91 3BXL 1 A Calmodulin 10116
92 2VB6 2 B CALMODULIN 9031
93 5DBR 1 A Calmodulin 9606
94 3DVE 1 A Calmodulin 9606
95 4DBQ 2 B Calmodulin 7227
96 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
97 2BKH 2 B CALMODULIN 7227
98 2V02 1 A CALMODULIN 9606
99 6B8M 2 B, D, F, H Calmodulin-1 9606
100 1QIW 1 A, B CALMODULIN 9913
101 4ZLK 2 B Calmodulin 10090
102 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
103 3EWT 1 A Calmodulin 9606
104 2VAS 2 B CALMODULIN 7227
105 1Y6W 1 A Calmodulin 9606
106 1CTR 1 A CALMODULIN 9606
107 1L7Z 1 A CALMODULIN 9606
108 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
109 4BYF 2 B, D CALMODULIN 9606
110 3DVK 1 A Calmodulin 9606
111 3BXK 1 A, C Calmodulin 10116
112 1QIV 1 A CALMODULIN 9913
113 1A29 1 A CALMODULIN 9913
114 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
115 2FOT 1 A Calmodulin 9913
116 3HR4 2 B, D, F, H Calmodulin 9606
117 6B8Q 2 B, D, F, H Calmodulin-1 9606
118 3GN4 2 B, D, F, H Calmodulin 7227
119 3EWV 1 A Calmodulin 9606
120 3OXQ 1 A, B, C, D Calmodulin 9606
121 1K90 2 D, E, F CALMODULIN 9606
122 4GOW 1 D Calmodulin 9606
123 4ANJ 2 B CALMODULIN 7227
124 4OVN 1 A, B, C, D, E Calmodulin 9606
125 5HIT 1 A Calmodulin 9031
126 5V7X 2 B Calmodulin-1 9606
127 5I0I 2 C Calmodulin 9606
128 5I0I 3 E Calmodulin 9606
129 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
130 4UMO 2 C, D CALMODULIN 9606
131 4JPZ 3 C, I Calmodulin 9606
132 1DEG 1 A CALMODULIN 9913
133 3DVJ 1 A Calmodulin 9606
134 3DVM 1 A Calmodulin 9606
135 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
136 2BKI 2 B, D CALMODULIN 9031
137 1S26 2 D, E, F Calmodulin 9606
138 1SK6 2 D, E, F Calmodulin 9606
139 1K93 2 D, E, F CALMODULIN 9606
140 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
141 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
142 4R8G 2 A, B, H Calmodulin 8355
143 1PK0 2 D, E, F Calmodulin 9606
144 1QX7 1 A, B, I, M, R Calmodulin 10116
145 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
146 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
147 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
148 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
149 4JQ0 2 C Calmodulin 9606
150 1LVC 2 D, E, F calmodulin 9606
151 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
152 6E2F 2 E Calmodulin-1 9606
153 6E2G 2 E Calmodulin-1 9606
154 6CNM 2 E, F, G, H Calmodulin-1 9606
155 6CNN 2 E, F, G, H Calmodulin-1 9606
156 6CNO 2 E, F, G, H Calmodulin-1 9606
157 6C1D 3 R Calmodulin 32644
158 6C1G 2 R Calmodulin 32644
159 6C1H 3 R Calmodulin 32644
160 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
161 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
162 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
163 5OEO 1 A Calmodulin-1 9606
164 5VMS 2 B Calmodulin 9606
165 5TP5 1 A Calmodulin 9606
166 5TP6 1 A Calmodulin 9606
167 5T0X 1 A Calmodulin 8355
168 5SY1 1 C, D Calmodulin 7108
169 5GGM 1 A Calmodulin 9606
170 5K7L 2 B Calmodulin 9606
171 5J8H 1 A Calmodulin 9606
172 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
173 2N8J 1 A Calmodulin 9606
174 2N27 1 A Calmodulin UNP residues 2-149 9606
175 2MGU 1 A Calmodulin 10116
176 2MG5 1 A Calmodulin UNP residues 2-149 9606
177 2MES 1 A Calmodulin 8355
178 3J41 2 E, F Calmodulin 9606
179 2M55 1 A Calmodulin 9606
180 2M3S 1 A Calmodulin UNP residues 1-149 9031
181 2M0J 1 A Calmodulin 9606
182 2M0K 1 A Calmodulin 9606
183 2LV6 1 A Calmodulin 9606
184 2LL6 1 A Calmodulin 9606
185 2LL7 1 A Calmodulin 9606
186 2LGF 1 A Calmodulin sequence database residues 4-149 9606
187 2L7L 1 A Calmodulin 9606
188 2L53 1 A Calmodulin calmodulin 9606
189 2KNE 1 A Calmodulin 9606
190 2KDU 1 A Calmodulin 8355
191 2K61 1 A Calmodulin 9606
192 2K0J 1 A calmodulin 9606
193 2K0E 1 A Calmodulin 9606
194 2K0F 1 A calmodulin 9606
195 2JZI 1 A Calmodulin 9606
196 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
197 1X02 1 A calmodulin 8355
198 1SY9 1 A CALMODULIN 8355
199 1NWD 1 A Calmodulin 8355
200 1CFF 1 A CALMODULIN 8355
201 1CKK 1 A Calmodulin-1 8355
202 1MUX 1 A CALMODULIN 8355
203 1DMO 1 A CALMODULIN 8355
204 1CFD 1 A CALMODULIN 8355
205 1CFC 1 A CALMODULIN 8355
206 2BBM 1 A CALMODULIN 7227
207 2BBN 1 A CALMODULIN 7227