Sequence Similarity Clusters for the Entities in PDB 1N0Y

Entity #1 | Chains: A,B
Calmodulin protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 6 7 9104
95 % 6 7 9095 Flexibility: Low
Max RMSD: 2.5, Avg RMSD: 0.9
PDBFlex
90 % 34 212 77
70 % 35 214 93
50 % 38 247 106
40 % 39 370 43
30 % 51 443 43

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4YI8 1 A Recoverin 9913
7 4YI9 1 A Recoverin 9913
8 4DJC 1 A Calmodulin 9606
9 3GOF 1 A, B Calmodulin 9031
10 3GP2 1 A Calmodulin 9031
11 4LZX 1 A Calmodulin UNP residues 2-149 9606
12 2W73 1 A, B, E, F CALMODULIN 9606
13 2F3Y 1 A Calmodulin 9606
14 4MLW 1 A Recoverin 9913
15 5DOW 1 A, C, E, G Calmodulin 9606
16 4M2P 1 A Recoverin 9913
17 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
18 4M2O 1 A Recoverin 9913
19 4J9Y 2 R Calmodulin 10116
20 5G08 1 A FREQUENIN 2 7227
21 2O60 1 A Calmodulin 9031
22 5AAN 1 A CG5907-PA, ISOFORM A 7227
23 5V03 2 R Calmodulin 9606
24 3IF7 1 A Calmodulin 9913
25 4F0Z 2 B Calcineurin subunit B type 1 Calcineurin B Subunit 9606 3.1.3.16 | Details
26 6DAD 1 A, B Calmodulin-1 9606
27 5NIN 1 A, B Calmodulin 9606
28 1QTX 1 A PROTEIN (CALMODULIN) 562
29 4G28 2 R Calmodulin 10116
30 1OMR 1 A recoverin 9913
31 4G27 2 R Calmodulin 10116
32 1M45 1 A Myosin light chain 4932
33 1G4Y 2 R CALMODULIN 10116
34 4J9Z 2 R Calmodulin 10116
35 2F3Z 1 A Calmodulin 9606
36 1PRW 1 A Calmodulin 9913
37 1OSA 1 A CALMODULIN 5888
38 5JQA 1 A Calmodulin 9606
39 1MXE 1 A, B Calmodulin 7227
40 1NCX 1 A TROPONIN C 9031
41 1TOP 1 A TROPONIN C 9031
42 5B8I 2 B Calcineurin subunit B, variant 5501
43 1YR5 1 A calmodulin residues 1-148 9606
44 5JTH 1 A Calmodulin 9606
45 1CLL 1 A CALMODULIN 9606
46 4GUK 1 A, B, C, D Neuronal calcium sensor 1 9606
47 5V02 2 R Calmodulin-1 9606
48 1NCZ 1 A TROPONIN C 9031
49 2WEL 2 D CALMODULIN 9606
50 6EPA 1 A FI18190p1 7227
51 1N0Y 1 A, B Calmodulin 5888
52 3BYA 1 A Calmodulin 9606
53 1VRK 1 A CALMODULIN 32630
54 3SJQ 1 A, B Calmodulin 10116
55 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
56 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
57 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
58 1NCY 1 A TROPONIN C 9031
59 5K8Q 1 A Calmodulin 9606
60 4EHQ 1 A Calmodulin 10116
61 1CLM 1 A CALMODULIN 5888
62 5TNC 1 A TROPONIN-C 9103
63 4BW7 1 A, C CALMODULIN 9606
64 1AHR 1 A CALMODULIN 9031
65 1IQ5 1 A CALMODULIN 8355
66 5WBX 2 R Calmodulin-1 9606
67 4M2Q 1 A Recoverin 9913
68 1REC 1 A RECOVERIN 9913
69 1CM4 1 A CALMODULIN 9913
70 1ZUZ 1 A calmodulin 9606
71 4TNC 1 A TROPONIN C 9031
72 1QS7 1 A, C CALMODULIN 562
73 5FYX 1 A FREQUENIN 2 7227
74 2Y4V 1 A CALMODULIN 9606
75 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
76 3LL8 3 B, D Calcineurin subunit B type 1 UNP residues 16-170 9606
77 6DAE 1 A, B Calmodulin-1 9606
78 2HQW 1 A Calmodulin 10116
79 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
80 3SUI 1 A Calmodulin 9606
81 1UP5 1 A, B Calmodulin 9031
82 4BW8 1 A, B CALMODULIN 9606
83 3WFN 1 B, C, D, E Calmodulin, Sodium channel protein type 8 subunit alpha CHIMERA PROTEIN OF CALMODULIN (UNIPROT P62204 CALM_MOUSE) AND NAV1.6 IQ MOTIF FROM SODIUM CHANNEL PROTEIN TYPE 8 SUBUNIT ALPHA (UNIPROT Q9WTU3 SCN8A_MOUSE, RESIDUES 1893-1914) 10090
84 4QNH 2 R Calmodulin 10116
85 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
86 1G8I 1 A, B NEURONAL CALCIUM SENSOR 1 9606
87 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
88 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
89 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
90 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
91 4Q5U 1 A Calmodulin 9606
92 4AQR 1 A, B CALMODULIN-7 3702
93 2BE6 1 A, B, C Calmodulin 2 9606
94 1S6C 1 A Kv4 potassium channel-interacting protein KChIP1b Core domain (Residues 34-216) 10116
95 1N2D 1 A, B Myosin Light Chain 4932
96 1CDL 1 A, B, C, D CALMODULIN 9606
97 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
98 4DBP 2 C Calmodulin 7227
99 1AUI 2 B SERINE/THREONINE PHOSPHATASE 2B 9606 3.1.3.16 | Details
100 4HEX 1 A, B Calmodulin 10090
101 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
102 4M1L 1 A Calmodulin UNP residues 2-149 9606
103 5AEQ 1 A, B NEURONAL CALCIUM SENSOR 1 10116
104 1OMV 1 A recoverin 9913
105 2BCX 1 A Calmodulin 9031
106 1LIN 1 A CALMODULIN 9913
107 3CLN 1 A CALMODULIN 10117
108 1IWQ 1 A CALMODULIN 9606
109 1M46 1 A Myosin light chain 4932
110 2V01 1 A CALMODULIN 9606
111 1WRZ 1 A calmodulin 9606
112 2YGG 2 B CALMODULIN 10116
113 1UHN 1 A calcineurin B-like protein 2 residues 32-220 3702
114 1RFJ 1 A calmodulin 4113
115 5W1A 2 B, D Myosin light chain alkali 7227
116 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
117 3L9I 2 C Calmodulin 7227
118 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
119 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
120 1CM1 1 A CALMODULIN 9913
121 4DS7 1 A, B, C, D Calmodulin 28985
122 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
123 2D8N 1 A Recoverin 9606
124 1NIW 1 A, C, E, G calmodulin 10116
125 4OR9 2 B Calcineurin subunit B type 1 regulatory subunit 9606
126 2EHB 1 A Calcineurin B-like protein 4 residues in database 1-207 3702
127 4CLN 1 A CALMODULIN 7227
128 3G43 1 A, B, C, D Calmodulin 9606
129 6CZQ 2 R Calmodulin-1 residues 5-148 10116
130 3PN7 2 B, E Myosin regulatory light chain 6577
131 3PN7 3 C, F Myosin essential light chain 6577
132 1XA5 1 A Calmodulin 9913
133 1OOJ 1 A Calmodulin CMD-1 6239
134 2X0G 2 B CALMODULIN 9606
135 1DTL 1 A CARDIAC TROPONIN C 9031
136 2F2O 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
137 1TCF 1 A TROPONIN C 9986
138 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
139 6B8P 2 B, D, F, H Calmodulin-1 9606
140 4DCK 2 B Calmodulin Calmodulin 9606
141 2P6B 3 B, D Calcineurin subunit B isoform 1 Residues 16-170 9606
142 4PJJ 2 B Calmodulin 7227
143 4L79 2 B Calmodulin 9606
144 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
145 5WC5 2 R Calmodulin-1 9606
146 4BY5 1 A, B, C, D FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
147 5AER 1 A NEURONAL CALCIUM SENSOR 1 10116
148 2CT9 1 A, B Calcium-binding protein p22 10116
149 2X51 2 B CALMODULIN 7227
150 6B8N 2 B, D, F, H Calmodulin-1 9606
151 6B8L 2 B, D, F, H Calmodulin-1 9606
152 2GGM 1 A, B Centrin-2 9606
153 3BXL 1 A Calmodulin 10116
154 5OTJ 3 C, D Polcalcin Phl p 7 15957
155 3TS5 2 B, E Myosin regulatory light chain 6577
156 3TS5 3 C, F Myosin essential light chain 6577
157 2VB6 2 B CALMODULIN 9031
158 5DBR 1 A Calmodulin 9606
159 4BY4 1 A, B FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
160 3DVE 1 A Calmodulin 9606
161 1A2X 1 A TROPONIN C 9986
162 4DBQ 2 B Calmodulin 7227
163 6DAF 1 A, B Calmodulin-1 9606
164 3FWB 1 A Cell division control protein 31 4932
165 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
166 2BKH 2 B CALMODULIN 7227
167 2V02 1 A CALMODULIN 9606
168 5AFP 1 A, B NEURONAL CALCIUM SENSOR 1 10116
169 6B8M 2 B, D, F, H Calmodulin-1 9606
170 1TCO 2 B SERINE/THREONINE PHOSPHATASE B2 CHAIN A IS THE CATALYTIC SUBUNIT, RESIDUES 18 -392. CHAIN B IS THE REGULATORY SUBUNIT, RESIDUES 1 - 169 9913 3.1.3.16 | Details
171 1QIW 1 A, B CALMODULIN 9913
172 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
173 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
174 4ZLK 2 B Calmodulin 10090
175 3TUY 2 B, E Myosin regulatory light chain 6577
176 3TUY 3 C, F Myosin essential light chain 6577
177 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
178 1BJF 1 A, B NEUROCALCIN DELTA 9913
179 3EWT 1 A Calmodulin 9606
180 2VAS 2 B CALMODULIN 7227
181 1Y6W 1 A Calmodulin 9606
182 5SVE 2 B Calcineurin subunit B type 1 9606
183 1CTR 1 A CALMODULIN 9606
184 1L7Z 1 A CALMODULIN 9606
185 5G4P 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
186 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
187 4BYF 2 B, D CALMODULIN 9606
188 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
189 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
190 4MBE 1 A, D Cell division control protein 31 4932
191 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
192 6DAH 1 A, B, C, D Calmodulin-1 9606
193 3DVK 1 A Calmodulin 9606
194 5G58 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
195 3BXK 1 A, C Calmodulin 10116
196 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
197 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
198 1QIV 1 A CALMODULIN 9913
199 1A29 1 A CALMODULIN 9913
200 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
201 2FOT 1 A Calmodulin 9913
202 3HR4 2 B, D, F, H Calmodulin 9606
203 4ORA 2 B Calcineurin subunit B type 1 9606
204 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
205 4OV2 1 A, B, C, D Neuronal calcium sensor 1 C-terminal truncation (UNP residues 1-177) 10116
206 3QRX 1 A Centrin 3055
207 6B8Q 2 B, D, F, H Calmodulin-1 9606
208 3GN4 2 B, D, F, H Calmodulin 7227
209 3FWC 1 A, E, I, M Cell division control protein 31 4932
210 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
211 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
212 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
213 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
214 3EWV 1 A Calmodulin 9606
215 4ORC 2 B Calcineurin subunit B type 1 regulatory subunit 9606
216 2BEC 1 A Calcineurin B homologous protein 2 9606
217 3OXQ 1 A, B, C, D Calmodulin 9606
218 1K90 2 D, E, F CALMODULIN 9606
219 4GOW 1 D Calmodulin 9606
220 2F2P 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
221 4ANJ 2 B CALMODULIN 7227
222 4OVN 1 A, B, C, D, E Calmodulin 9606
223 5HIT 1 A Calmodulin 9031
224 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
225 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
226 1V1G 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
227 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
228 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
229 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
230 4E50 1 A Calmodulin, Linker, IQ motif of Neurogranin chimera of Calmodulin, Linker, IQ motif of Neurogranin 10090
231 5V7X 2 B Calmodulin-1 9606
232 5I0I 2 C Calmodulin 9606
233 5I0I 3 E Calmodulin 9606
234 4ORB 2 B Calcineurin subunit B type 1 regulatory subunit 10090
235 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
236 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
237 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
238 1J1D 1 A, D Troponin C 9606
239 4UMO 2 C, D CALMODULIN 9606
240 4JPZ 3 C, I Calmodulin 9606
241 1DEG 1 A CALMODULIN 9913
242 5M6C 1 A Neuron-specific calcium-binding protein hippocalcin 9606
243 5M6C 2 E Neuron-specific calcium-binding protein hippocalcin 9606
244 4YRU 1 A, B, C, D Neuronal calcium sensor 1 UNP residues 1-177 10116
245 3DVJ 1 A Calmodulin 9606
246 3DVM 1 A Calmodulin 9606
247 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
248 1M63 2 B, F CALCINEURIN B SUBUNIT ISOFORM 1 9606
249 2HET 1 A, B, C, D Recoverin 9913
250 1V1F 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
251 4E53 1 A, B Calmodulin, Linker, IQ motif of Neuromodulin chimera of Calmodulin, Linker, IQ motif of Neuromodulin 10090
252 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
253 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
254 4WPX 1 A, D Cell division control protein 31-like protein 209285
255 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
256 2BKI 2 B, D CALMODULIN 9031
257 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
258 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
259 2GV5 1 A, B, D, E Cell division control protein 31 4932
260 5D43 1 A, B Centrin-1 10090
261 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
262 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
263 2DOQ 1 A, B, C Cell division control protein 31 4932
264 1MF8 2 B CALCINEURIN B SUBUNIT ISOFORM 1 9606 3.1.3.16 | Details
265 1S26 2 D, E, F Calmodulin 9606
266 1SK6 2 D, E, F Calmodulin 9606
267 1K93 2 D, E, F CALMODULIN 9606
268 2I2R 2 E, F, G, H, M, N, O, P Kv channel-interacting protein 1 conserved structural core (residues 37-216) 9606
269 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
270 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
271 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
272 1J1E 1 A, D Troponin C 9606
273 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
274 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
275 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
276 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
277 2NZ0 1 A, C Kv channel-interacting protein 1 N-terminal deletion domain 9606
278 2OTG 2 B Myosin regulatory light chain 6577
279 2OTG 3 C Myosin essential light chain 6577
280 1YTZ 3 C Troponin C 9031
281 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
282 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
283 4R8G 2 A, B, H Calmodulin 8355
284 1PK0 2 D, E, F Calmodulin 9606
285 1QX7 1 A, B, I, M, R Calmodulin 10116
286 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
287 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
288 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
289 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
290 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
291 2EC6 3 C Myosin essential light chain 6577
292 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
293 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
294 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
295 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
296 2OS8 3 C Myosin essential light chain Myosin ELC 6577
297 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
298 4JQ0 2 C Calmodulin 9606
299 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
300 1LVC 2 D, E, F calmodulin 9606
301 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
302 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
303 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
304 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
305 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
306 1YV0 3 C Troponin C, skeletal muscle 9031
307 6E2F 2 E Calmodulin-1 9606
308 6E2G 2 E Calmodulin-1 9606
309 6GDK 1 A Calmodulin-1 9606
310 6CNM 2 E, F, G, H Calmodulin-1 9606
311 6CNN 2 E, F, G, H Calmodulin-1 9606
312 6CNO 2 E, F, G, H Calmodulin-1 9606
313 6C1D 3 R Calmodulin 32644
314 6C1G 2 R Calmodulin 32644
315 6C1H 3 R Calmodulin 32644
316 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
317 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
318 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
319 5OEO 1 A Calmodulin-1 9606
320 5VMS 2 B Calmodulin 9606
321 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
322 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
323 5TP5 1 A Calmodulin 9606
324 5TP6 1 A Calmodulin 9606
325 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
326 5T7C 1 A Hippocalcin-like protein 1 Myristoyl group is covalently attached to the N-terminal 9606
327 5T0X 1 A Calmodulin 8355
328 5SY1 1 C, D Calmodulin 7108
329 5GGM 1 A Calmodulin 9606
330 5B7X 1 A Calmodulin, putative 5759
331 5K7L 2 B Calmodulin 9606
332 5J8H 1 A Calmodulin 9606
333 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
334 2N8J 1 A Calmodulin 9606
335 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
336 2N6A 1 A human calmodulin/connexin-36 peptide hybrid 9606
337 3JAX 2 C, D smooth muscle myosin essential light chain 6183
338 2N27 1 A Calmodulin UNP residues 2-149 9606
339 2MGU 1 A Calmodulin 10116
340 2MG5 1 A Calmodulin UNP residues 2-149 9606
341 2MES 1 A Calmodulin 8355
342 3J41 2 E, F Calmodulin 9606
343 2M55 1 A Calmodulin 9606
344 2M3S 1 A Calmodulin UNP residues 1-149 9031
345 2M28 1 A Calcium-binding protein 4 10090
346 2M29 1 A Calcium-binding protein 4 10090
347 2M0J 1 A Calmodulin 9606
348 2M0K 1 A Calmodulin 9606
349 2LV6 1 A Calmodulin 9606
350 2LMT 1 A Calmodulin-related protein 97A 7227
351 2LMU 1 A Calmodulin-related protein 97A 7227
352 2LMV 1 A Calmodulin-related protein 97A 7227
353 2LL6 1 A Calmodulin 9606
354 2LL7 1 A Calmodulin 9606
355 2LHH 1 A Calmodulin UNP RESIDUES 2-121 4932
356 2LHI 1 A Calmodulin, Serine/threonine-protein phosphatase 2B catalytic subunit A1 THE FUSION PROTEIN OF CALMODULIN (RESIDUE 1-146), LINKER (GSSTG) AND CALCINEURIN A1 (RESIDUES 453-476) 32630
357 2LGF 1 A Calmodulin sequence database residues 4-149 9606
358 2LCP 1 A Neuronal calcium sensor 1 9606
359 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
360 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
361 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
362 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
363 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
364 2L7L 1 A Calmodulin 9606
365 2L53 1 A Calmodulin calmodulin 9606
366 2L2E 1 A Calcium-binding protein NCS-1 4896
367 2L1W 1 A Calmodulin 3847
368 2KNE 1 A Calmodulin 9606
369 2KDU 1 A Calmodulin 8355
370 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
371 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
372 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
373 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
374 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
375 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
376 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
377 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
378 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
379 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
380 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
381 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
382 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
383 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
384 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
385 2K61 1 A Calmodulin 9606
386 2K0J 1 A calmodulin 9606
387 2K0E 1 A Calmodulin 9606
388 2K0F 1 A calmodulin 9606
389 2JZI 1 A Calmodulin 9606
390 2JU0 1 A Calcium-binding protein NCS-1 4932
391 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
392 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
393 2JT3 1 A Troponin C 9606
394 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
395 2JNF 1 A Troponin C 212017
396 2E30 1 A Calcium-binding protein p22 9606
397 2I94 1 A Recoverin 9913
398 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
399 1X02 1 A calmodulin 8355
400 1SY9 1 A CALMODULIN 8355
401 1NWD 1 A Calmodulin 8355
402 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
403 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
404 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
405 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
406 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
407 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
408 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
409 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
410 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
411 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
412 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
413 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
414 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
415 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
416 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
417 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
418 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
419 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
420 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
421 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
422 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
423 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
424 1LKJ 1 A Calmodulin 4932
425 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
426 1LA3 1 A Recoverin 9913
427 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
428 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
429 1GGW 1 A PROTEIN (CDC4P) 4896
430 1FPW 1 A CALCIUM-BINDING PROTEIN NCS-1 4932
431 1CFF 1 A CALMODULIN 8355
432 1CKK 1 A Calmodulin-1 8355
433 1MUX 1 A CALMODULIN 8355
434 1JSA 1 A RECOVERIN 9913
435 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
436 1DMO 1 A CALMODULIN 8355
437 1IKU 1 A RECOVERIN 9913
438 1CFD 1 A CALMODULIN 8355
439 1TNW 1 A TROPONIN C 9031
440 1TNX 1 A TROPONIN C 9031
441 1CFC 1 A CALMODULIN 8355
442 2BBM 1 A CALMODULIN 7227
443 2BBN 1 A CALMODULIN 7227