Sequence Similarity Clusters for the Entities in PDB 1N0Y

Entity #1 | Chains: A,B
Calmodulin protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 6 7 8865
95 % 6 7 8849 Flexibility: Low
Max RMSD: 2.5, Avg RMSD: 0.9
PDBFlex
90 % 33 203 77
70 % 34 205 93
50 % 37 238 106
40 % 38 361 41
30 % 49 432 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4YI8 1 A Recoverin 9913
7 4YI9 1 A Recoverin 9913
8 4DJC 1 A Calmodulin 9606
9 3GOF 1 A, B Calmodulin 9031
10 3GP2 1 A Calmodulin 9031
11 4LZX 1 A Calmodulin UNP residues 2-149 9606
12 2W73 1 A, B, E, F CALMODULIN 9606
13 2F3Y 1 A Calmodulin 9606
14 4MLW 1 A Recoverin 9913
15 5DOW 1 A, C, E, G Calmodulin 9606
16 4M2P 1 A Recoverin 9913
17 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
18 4M2O 1 A Recoverin 9913
19 4J9Y 2 R Calmodulin 10116
20 5G08 1 A FREQUENIN 2 7227
21 2O60 1 A Calmodulin 9031
22 5AAN 1 A CG5907-PA, ISOFORM A 7227
23 5V03 2 R Calmodulin 9606
24 3IF7 1 A Calmodulin 9913
25 4F0Z 2 B Calcineurin subunit B type 1 Calcineurin B Subunit 9606 3.1.3.16 | Details
26 5NIN 1 A, B Calmodulin 9606
27 1QTX 1 A PROTEIN (CALMODULIN) 562
28 4G28 2 R Calmodulin 10116
29 1OMR 1 A recoverin 9913
30 4G27 2 R Calmodulin 10116
31 1M45 1 A Myosin light chain 4932
32 1G4Y 2 R CALMODULIN 10116
33 4J9Z 2 R Calmodulin 10116
34 2F3Z 1 A Calmodulin 9606
35 1PRW 1 A Calmodulin 9913
36 1OSA 1 A CALMODULIN 5888
37 5JQA 1 A Calmodulin 9606
38 1MXE 1 A, B Calmodulin 7227
39 1NCX 1 A TROPONIN C 9031
40 1TOP 1 A TROPONIN C 9031
41 5B8I 2 B Calcineurin subunit B, variant 5501
42 1YR5 1 A calmodulin residues 1-148 9606
43 5JTH 1 A Calmodulin 9606
44 1CLL 1 A CALMODULIN 9606
45 4GUK 1 A, B, C, D Neuronal calcium sensor 1 9606
46 5V02 2 R Calmodulin-1 9606
47 1NCZ 1 A TROPONIN C 9031
48 2WEL 2 D CALMODULIN 9606
49 1N0Y 1 A, B Calmodulin 5888
50 3BYA 1 A Calmodulin 9606
51 1VRK 1 A CALMODULIN 32630
52 3SJQ 1 A, B Calmodulin 10116
53 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
54 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
55 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
56 1NCY 1 A TROPONIN C 9031
57 5K8Q 1 A Calmodulin 9606
58 4EHQ 1 A Calmodulin 10116
59 1CLM 1 A CALMODULIN 5888
60 5TNC 1 A TROPONIN-C 9103
61 4BW7 1 A, C CALMODULIN 9606
62 1AHR 1 A CALMODULIN 9031
63 1IQ5 1 A CALMODULIN 8355
64 5WBX 2 R Calmodulin-1 9606
65 4M2Q 1 A Recoverin 9913
66 1REC 1 A RECOVERIN 9913
67 1CM4 1 A CALMODULIN 9913
68 1ZUZ 1 A calmodulin 9606
69 4TNC 1 A TROPONIN C 9031
70 1QS7 1 A, C CALMODULIN 562
71 5FYX 1 A FREQUENIN 2 7227
72 2Y4V 1 A CALMODULIN 9606
73 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
74 3LL8 3 B, D Calcineurin subunit B type 1 UNP residues 16-170 9606
75 2HQW 1 A Calmodulin 10116
76 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
77 3SUI 1 A Calmodulin 9606
78 1UP5 1 A, B Calmodulin 9031
79 4BW8 1 A, B CALMODULIN 9606
80 3WFN 1 B, C, D, E Calmodulin, Sodium channel protein type 8 subunit alpha CHIMERA PROTEIN OF CALMODULIN (UNIPROT P62204 CALM_MOUSE) AND NAV1.6 IQ MOTIF FROM SODIUM CHANNEL PROTEIN TYPE 8 SUBUNIT ALPHA (UNIPROT Q9WTU3 SCN8A_MOUSE, RESIDUES 1893-1914) 10090
81 4QNH 2 R Calmodulin 10116
82 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
83 1G8I 1 A, B NEURONAL CALCIUM SENSOR 1 9606
84 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
85 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
86 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
87 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
88 4Q5U 1 A Calmodulin 9606
89 4AQR 1 A, B CALMODULIN-7 3702
90 2BE6 1 A, B, C Calmodulin 2 9606
91 1S6C 1 A Kv4 potassium channel-interacting protein KChIP1b Core domain (Residues 34-216) 10116
92 1N2D 1 A, B Myosin Light Chain 4932
93 1CDL 1 A, B, C, D CALMODULIN 9606
94 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
95 4DBP 2 C Calmodulin 7227
96 1AUI 2 B SERINE/THREONINE PHOSPHATASE 2B 9606 3.1.3.16 | Details
97 4HEX 1 A, B Calmodulin 10090
98 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
99 4M1L 1 A Calmodulin UNP residues 2-149 9606
100 5AEQ 1 A, B NEURONAL CALCIUM SENSOR 1 10116
101 1OMV 1 A recoverin 9913
102 2BCX 1 A Calmodulin 9031
103 1LIN 1 A CALMODULIN 9913
104 3CLN 1 A CALMODULIN 10117
105 1IWQ 1 A CALMODULIN 9606
106 1M46 1 A Myosin light chain 4932
107 2V01 1 A CALMODULIN 9606
108 1WRZ 1 A calmodulin 9606
109 2YGG 2 B CALMODULIN 10116
110 1UHN 1 A calcineurin B-like protein 2 residues 32-220 3702
111 1RFJ 1 A calmodulin 4113
112 5W1A 2 B, D Myosin light chain alkali 7227
113 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
114 3L9I 2 C Calmodulin 7227
115 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
116 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
117 1CM1 1 A CALMODULIN 9913
118 4DS7 1 A, B, C, D Calmodulin 28985
119 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
120 2D8N 1 A Recoverin 9606
121 1NIW 1 A, C, E, G calmodulin 10116
122 4OR9 2 B Calcineurin subunit B type 1 regulatory subunit 9606
123 2EHB 1 A Calcineurin B-like protein 4 residues in database 1-207 3702
124 4CLN 1 A CALMODULIN 7227
125 3G43 1 A, B, C, D Calmodulin 9606
126 3PN7 2 B, E Myosin regulatory light chain 6577
127 3PN7 3 C, F Myosin essential light chain 6577
128 1XA5 1 A Calmodulin 9913
129 1OOJ 1 A Calmodulin CMD-1 6239
130 2X0G 2 B CALMODULIN 9606
131 1DTL 1 A CARDIAC TROPONIN C 9031
132 2F2O 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
133 1TCF 1 A TROPONIN C 9986
134 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
135 6B8P 2 B, D, F, H Calmodulin-1 9606
136 4DCK 2 B Calmodulin Calmodulin 9606
137 2P6B 3 B, D Calcineurin subunit B isoform 1 Residues 16-170 9606
138 4PJJ 2 B Calmodulin 7227
139 4L79 2 B Calmodulin 9606
140 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
141 5WC5 2 R Calmodulin-1 9606
142 4BY5 1 A, B, C, D FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
143 5AER 1 A NEURONAL CALCIUM SENSOR 1 10116
144 2CT9 1 A, B Calcium-binding protein p22 10116
145 2X51 2 B CALMODULIN 7227
146 6B8N 2 B, D, F, H Calmodulin-1 9606
147 6B8L 2 B, D, F, H Calmodulin-1 9606
148 2GGM 1 A, B Centrin-2 9606
149 3BXL 1 A Calmodulin 10116
150 3TS5 2 B, E Myosin regulatory light chain 6577
151 3TS5 3 C, F Myosin essential light chain 6577
152 2VB6 2 B CALMODULIN 9031
153 5DBR 1 A Calmodulin 9606
154 4BY4 1 A, B FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
155 3DVE 1 A Calmodulin 9606
156 1A2X 1 A TROPONIN C 9986
157 4DBQ 2 B Calmodulin 7227
158 3FWB 1 A Cell division control protein 31 4932
159 2BKH 2 B CALMODULIN 7227
160 2V02 1 A CALMODULIN 9606
161 5AFP 1 A, B NEURONAL CALCIUM SENSOR 1 10116
162 6B8M 2 B, D, F, H Calmodulin-1 9606
163 1TCO 2 B SERINE/THREONINE PHOSPHATASE B2 CHAIN A IS THE CATALYTIC SUBUNIT, RESIDUES 18 -392. CHAIN B IS THE REGULATORY SUBUNIT, RESIDUES 1 - 169 9913 3.1.3.16 | Details
164 1QIW 1 A, B CALMODULIN 9913
165 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
166 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
167 4ZLK 2 B Calmodulin 10090
168 3TUY 2 B, E Myosin regulatory light chain 6577
169 3TUY 3 C, F Myosin essential light chain 6577
170 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
171 1BJF 1 A, B NEUROCALCIN DELTA 9913
172 3EWT 1 A Calmodulin 9606
173 2VAS 2 B CALMODULIN 7227
174 1Y6W 1 A Calmodulin 9606
175 5SVE 2 B Calcineurin subunit B type 1 9606
176 1CTR 1 A CALMODULIN 9606
177 1L7Z 1 A CALMODULIN 9606
178 5G4P 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
179 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
180 4BYF 2 B, D CALMODULIN 9606
181 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
182 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
183 4MBE 1 A, D Cell division control protein 31 4932
184 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
185 3DVK 1 A Calmodulin 9606
186 5G58 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
187 3BXK 1 A, C Calmodulin 10116
188 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
189 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
190 1QIV 1 A CALMODULIN 9913
191 1A29 1 A CALMODULIN 9913
192 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
193 2FOT 1 A Calmodulin 9913
194 3HR4 2 B, D, F, H Calmodulin 9606
195 4ORA 2 B Calcineurin subunit B type 1 9606
196 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
197 4OV2 1 A, B, C, D Neuronal calcium sensor 1 C-terminal truncation (UNP residues 1-177) 10116
198 3QRX 1 A Centrin 3055
199 6B8Q 2 B, D, F, H Calmodulin-1 9606
200 3GN4 2 B, D, F, H Calmodulin 7227
201 3FWC 1 A, E, I, M Cell division control protein 31 4932
202 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
203 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
204 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
205 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
206 3EWV 1 A Calmodulin 9606
207 4ORC 2 B Calcineurin subunit B type 1 regulatory subunit 9606
208 2BEC 1 A Calcineurin B homologous protein 2 9606
209 3OXQ 1 A, B, C, D Calmodulin 9606
210 1K90 2 D, E, F CALMODULIN 9606
211 4GOW 1 D Calmodulin 9606
212 2F2P 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
213 4ANJ 2 B CALMODULIN 7227
214 4OVN 1 A, B, C, D, E Calmodulin 9606
215 5HIT 1 A Calmodulin 9031
216 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
217 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
218 1V1G 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
219 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
220 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
221 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
222 4E50 1 A Calmodulin, Linker, IQ motif of Neurogranin chimera of Calmodulin, Linker, IQ motif of Neurogranin 10090
223 5V7X 2 B Calmodulin-1 9606
224 5I0I 2 C Calmodulin 9606
225 5I0I 3 E Calmodulin 9606
226 4ORB 2 B Calcineurin subunit B type 1 regulatory subunit 10090
227 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
228 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
229 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
230 1J1D 1 A, D Troponin C 9606
231 4UMO 2 C, D CALMODULIN 9606
232 4JPZ 3 C, I Calmodulin 9606
233 1DEG 1 A CALMODULIN 9913
234 5M6C 1 A Neuron-specific calcium-binding protein hippocalcin 9606
235 5M6C 2 E Neuron-specific calcium-binding protein hippocalcin 9606
236 4YRU 1 A, B, C, D Neuronal calcium sensor 1 UNP residues 1-177 10116
237 3DVJ 1 A Calmodulin 9606
238 3DVM 1 A Calmodulin 9606
239 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
240 1M63 2 B, F CALCINEURIN B SUBUNIT ISOFORM 1 9606
241 2HET 1 A, B, C, D Recoverin 9913
242 1V1F 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
243 4E53 1 A, B Calmodulin, Linker, IQ motif of Neuromodulin chimera of Calmodulin, Linker, IQ motif of Neuromodulin 10090
244 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
245 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
246 4WPX 1 A, D Cell division control protein 31-like protein 209285
247 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
248 2BKI 2 B, D CALMODULIN 9031
249 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
250 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
251 2GV5 1 A, B, D, E Cell division control protein 31 4932
252 5D43 1 A, B Centrin-1 10090
253 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
254 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
255 2DOQ 1 A, B, C Cell division control protein 31 4932
256 1MF8 2 B CALCINEURIN B SUBUNIT ISOFORM 1 9606 3.1.3.16 | Details
257 1S26 2 D, E, F Calmodulin 9606
258 1SK6 2 D, E, F Calmodulin 9606
259 1K93 2 D, E, F CALMODULIN 9606
260 2I2R 2 E, F, G, H, M, N, O, P Kv channel-interacting protein 1 conserved structural core (residues 37-216) 9606
261 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
262 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
263 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
264 1J1E 1 A, D Troponin C 9606
265 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
266 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
267 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
268 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
269 2NZ0 1 A, C Kv channel-interacting protein 1 N-terminal deletion domain 9606
270 2OTG 2 B Myosin regulatory light chain 6577
271 2OTG 3 C Myosin essential light chain 6577
272 1YTZ 3 C Troponin C 9031
273 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
274 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
275 4R8G 2 A, B, H Calmodulin 8355
276 1PK0 2 D, E, F Calmodulin 9606
277 1QX7 1 A, B, I, M, R Calmodulin 10116
278 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
279 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
280 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
281 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
282 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
283 2EC6 3 C Myosin essential light chain 6577
284 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
285 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
286 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
287 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
288 2OS8 3 C Myosin essential light chain Myosin ELC 6577
289 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
290 4JQ0 2 C Calmodulin 9606
291 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
292 1LVC 2 D, E, F calmodulin 9606
293 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
294 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
295 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
296 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
297 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
298 1YV0 3 C Troponin C, skeletal muscle 9031
299 6CNM 2 E, F, G, H Calmodulin-1 9606
300 6CNN 2 E, F, G, H Calmodulin-1 9606
301 6CNO 2 E, F, G, H Calmodulin-1 9606
302 6C1D 3 R Calmodulin 32644
303 6C1G 2 R Calmodulin 32644
304 6C1H 3 R Calmodulin 32644
305 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
306 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
307 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
308 5OEO 1 A Calmodulin-1 9606
309 5VMS 2 B Calmodulin 9606
310 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
311 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
312 5TP5 1 A Calmodulin 9606
313 5TP6 1 A Calmodulin 9606
314 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
315 5T7C 1 A Hippocalcin-like protein 1 Myristoyl group is covalently attached to the N-terminal 9606
316 5T0X 1 A Calmodulin 8355
317 5SY1 1 C, D Calmodulin 7108
318 5GGM 1 A Calmodulin 9606
319 5B7X 1 A Calmodulin, putative 5759
320 5K7L 2 B Calmodulin 9606
321 5J8H 1 A Calmodulin 9606
322 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
323 2N8J 1 A Calmodulin 9606
324 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
325 2N6A 1 A human calmodulin/connexin-36 peptide hybrid 9606
326 3JAX 2 C, D smooth muscle myosin essential light chain 6183
327 2N27 1 A Calmodulin UNP residues 2-149 9606
328 2MGU 1 A Calmodulin 10116
329 2MG5 1 A Calmodulin UNP residues 2-149 9606
330 2MES 1 A Calmodulin 8355
331 3J41 2 E, F Calmodulin 9606
332 2M55 1 A Calmodulin 9606
333 2M3S 1 A Calmodulin UNP residues 1-149 9031
334 2M28 1 A Calcium-binding protein 4 10090
335 2M29 1 A Calcium-binding protein 4 10090
336 2M0J 1 A Calmodulin 9606
337 2M0K 1 A Calmodulin 9606
338 2LV6 1 A Calmodulin 9606
339 2LMT 1 A Calmodulin-related protein 97A 7227
340 2LMU 1 A Calmodulin-related protein 97A 7227
341 2LMV 1 A Calmodulin-related protein 97A 7227
342 2LL6 1 A Calmodulin 9606
343 2LL7 1 A Calmodulin 9606
344 2LHH 1 A Calmodulin UNP RESIDUES 2-121 4932
345 2LHI 1 A Calmodulin, Serine/threonine-protein phosphatase 2B catalytic subunit A1 THE FUSION PROTEIN OF CALMODULIN (RESIDUE 1-146), LINKER (GSSTG) AND CALCINEURIN A1 (RESIDUES 453-476) 32630
346 2LGF 1 A Calmodulin sequence database residues 4-149 9606
347 2LCP 1 A Neuronal calcium sensor 1 9606
348 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
349 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
350 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
351 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
352 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
353 2L7L 1 A Calmodulin 9606
354 2L53 1 A Calmodulin calmodulin 9606
355 2L2E 1 A Calcium-binding protein NCS-1 4896
356 2L1W 1 A Calmodulin 3847
357 2KNE 1 A Calmodulin 9606
358 2KDU 1 A Calmodulin 8355
359 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
360 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
361 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
362 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
363 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
364 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
365 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
366 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
367 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
368 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
369 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
370 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
371 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
372 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
373 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
374 2K61 1 A Calmodulin 9606
375 2K0J 1 A calmodulin 9606
376 2K0E 1 A Calmodulin 9606
377 2K0F 1 A calmodulin 9606
378 2JZI 1 A Calmodulin 9606
379 2JU0 1 A Calcium-binding protein NCS-1 4932
380 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
381 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
382 2JT3 1 A Troponin C 9606
383 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
384 2JNF 1 A Troponin C 212017
385 2E30 1 A Calcium-binding protein p22 9606
386 2I94 1 A Recoverin 9913
387 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
388 1X02 1 A calmodulin 8355
389 1SY9 1 A CALMODULIN 8355
390 1NWD 1 A Calmodulin 8355
391 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
392 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
393 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
394 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
395 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
396 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
397 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
398 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
399 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
400 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
401 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
402 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
403 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
404 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
405 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
406 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
407 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
408 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
409 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
410 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
411 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
412 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
413 1LKJ 1 A Calmodulin 4932
414 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
415 1LA3 1 A Recoverin 9913
416 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
417 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
418 1GGW 1 A PROTEIN (CDC4P) 4896
419 1FPW 1 A CALCIUM-BINDING PROTEIN NCS-1 4932
420 1CFF 1 A PROTEIN (CALMODULIN) 8355
421 1CKK 1 A Calmodulin-1 8355
422 1MUX 1 A CALMODULIN 8355
423 1JSA 1 A RECOVERIN 9913
424 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
425 1DMO 1 A CALMODULIN 8355
426 1IKU 1 A RECOVERIN 9913
427 1CFD 1 A CALMODULIN 8355
428 1TNW 1 A TROPONIN C 9031
429 1TNX 1 A TROPONIN C 9031
430 1CFC 1 A CALMODULIN 8355
431 2BBM 1 A CALMODULIN 7227
432 2BBN 1 A CALMODULIN 7227