Sequence Similarity Clusters for the Entities in PDB 1MI5

Entity #1 | Chains: A
MHC heavy chain protein, length: 277 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 14 17 2713
95 % 142 163 217 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 1.0
PDBFlex
90 % 202 230 140
70 % 590 785 6
50 % 601 801 7
40 % 633 853 9
30 % 709 999 12
Entity #2 | Chains: B
beta 2 microglobulin protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 548 716 2
95 % 559 731 2 Flexibility: Low
Max RMSD: 22.2, Avg RMSD: 0.9
PDBFlex
90 % 565 740 4
70 % 733 1012 4
50 % 747 1036 3
40 % 747 1036 6
30 % 747 1036 10
Entity #3 | Chains: C
Epstein Barr Virus peptide protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
TcR alpha chain protein, length: 201 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 16512
95 % 2 4 15368 Flexibility: Low
Max RMSD: 1.7, Avg RMSD: 1.0
PDBFlex
90 % 5 11 3871
70 % 180 363 42
50 % 180 364 83
40 % 180 364 100
30 % 4448 7871 1
Entity #5 | Chains: E
TcR beta chain protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 3 18882
95 % 5 7 7414 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.9
PDBFlex
90 % 6 9 5653
70 % 188 375 38
50 % 188 376 77
40 % 188 376 92
30 % 4449 7871 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
2 6FR4 1 A TCR 003 alpha chain 9606
3 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
4 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
5 6FR3 1 A 003 TCR Alpha Chain 9606
6 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
7 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
8 2NW2 1 A ELS4 TCR alpha chain 9606
9 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
10 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
11 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
12 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
13 1KGC 1 D T-cell receptor alpha chain 9606
14 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
15 6FUQ 1 A Human F11 T-Cell Receptor 9606
16 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
17 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
18 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
19 6BJ8 3 D TCR 55 alpha chain 9606
20 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
21 5TEZ 4 I TCR F50 alpha chain 9606
22 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
23 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
24 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
25 6CPH 1 D TCR alpha chain 9606
26 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
27 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
28 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
29 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
30 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
31 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
32 5D7K 1 D MAV36 TCR Alpha Chain 9606
33 3VXS 3 D H27-14 TCR alpha chain 9606
34 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
35 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
36 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
37 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
38 4PJE 3 E, G TCR-alpha 9606
39 6BJ3 3 D TCR 55 alpha chain 9606
40 4MS8 1 C 42F3 alpha 10090
41 4G9F 4 D beta chain C12C TCR 9606
42 6MJJ 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
43 4PJH 3 E, G TCR-alpha 9606
44 5KSA 3 C Bel602 alpha TRAV20*01 9606
45 5D7J 1 A, G M33.64 TCR Alpha Chain 9606
46 4PJ9 3 C TCR-alpha 9606
47 5U16 3 E, G MAIT T-cell receptor alpha chain 9606
48 5D7I 3 E, G M33.64 TCR Alpha Chain 9606
49 4PJ5 3 D, G TCR-alpha 9606
50 5C0C 4 D, I 1E6 TCR Alpha Chain 9606
51 5M01 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
52 6MJ4 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, chimeric protein 10090
53 4L4T 3 D, G MAIT T-cell receptor alpha chain 9606
54 5EU6 4 D Human TCR Light Chain 9606
55 5M00 3 G Protein Trav14-1,Uncharacterized protein 10090
56 2IAL 1 A, C CD4+ T cell receptor E8 alpha chain 9606
57 2F53 4 D T-cell Receptor, alpha chain 9606
58 6MIV 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain 10090
59 5ISZ 4 D TCRalpha chain 9606
60 3QJH 1 A, C 5c.c7 alpha chain 10090
61 5C0B 4 D, I 1E6 TCR Alpha Chain 9606
62 5YXN 1 A T cell receptor alpha chain 9606
63 3MFF 1 A, C T cell receptor alpha chain 9606
64 2VLM 1 D JM22 TCR ALPHA CHAIN 9606
65 2BNR 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
66 5IVX 3 E T-CELL RECEPTOR ALPHA CHAIN 10090
67 5NMD 1 A, C human T-cell Receptor alpha chain 9606
68 4NQE 3 D, G TCR alpha 9606
69 6CUH 1 A T-cell Receptor alpha variable, TRAV 9-2. BC8B TCR 9606
70 6AVF 2 A T-cell receptor alpha variable 4,TCR alpha chain 9606
71 4X6B 1 A, C TCR alpha 9606
72 4ELK 1 A, C Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
73 2P5W 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
74 4ZDH 1 A Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region 9606
75 6AMU 4 D DMF5 TCR alpha chain 9606
76 5U17 2 B, D MAIT T-cell receptor alpha chain 9606
77 5D5M 3 E, G M33.64 TCR Alpha Chain 9606
78 5C07 4 D, I 1E6 TCR Alpha Chain 9606
79 1LP9 4 E, L T-cell Receptor alpha chain 10090
80 4P23 1 A J809.B5 TCR V alpha chain (Va2.8) 10090
81 3VXQ 1 A, D H27-14 TCR alpha chain 9606
82 5U2V 3 E, G MAIT T-cell receptor alpha chain 9606
83 4PJX 3 E, G TCR-alpha 9606
84 3MV7 4 D alpha chain of the TK3 TCR 9606
85 5D2N 1 C, D C25 alpha 9606
86 4G8F 1 A alpha chain clone 42 TCR 9606
87 4NQD 3 D, G TCR alpha chain 9606
88 3QEU 1 A, D DMF5 alpha chain 9606
89 3TJH 3 C 42F3 alpha 10090
90 4GRM 1 A, C A6 alpha chain 9606
91 5WLG 4 D, I T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain 10090
92 4MAY 3 C HY.1B11 TCR alpha chain 9606
93 3QUY 3 C Valpha14 (mouse variable domain, human constant domain) 10090
94 2CDF 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
95 2XNA 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
96 3QH3 1 A, C A6 alpha chain 9606
97 4PJG 3 E, G TCR-alpha 9606
98 5EUO 3 E, G PF6 TCR alpha chain 9606
99 3MV8 4 D alpha chain of the TK3 TCR 9606
100 6MJI 1 C T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
101 3RUG 3 E, G Valpha10(mouse variable domain, human constant domain) 10090
102 2PYF 1 A T-Cell Receptor, Alpha Chain 9606
103 3QUZ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
104 6BGA 3 C T cell receptor 2B4 alpha chain 10090
105 4Y19 4 D FS18_alpha 9606
106 2PYE 4 D T-Cell Receptor, Alpha Chain 9606
107 2EYS 1 A NKT15 9606
108 4LCW 3 D, G MAIT T cell receptor alpha chain 9606
109 4G8G 4 D alpha chain C12C TCR 9606
110 4NQC 3 D, G TCR alpha chain 9606
111 4PJC 3 E, G TCR-alpha 9606
112 4JRX 4 D CA5 TCR alpha chain 9606
113 4PJF 3 E, G TCR-alpha 9606
114 6CUG 3 D T-cell receptor alpha variable TRAV9-2 - BC8B TCR 9606
115 6MJA 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
116 4PJ7 3 E, G TCR-alpha 9606
117 5U72 2 B, D MAIT T-cell receptor alpha chain 9606
118 3REV 1 A TCR NB20 ALPHA CHAIN 9606
119 5C08 4 D, I 1E6 TCR Alpha Chain 9606
120 4PRP 4 D TK3 TCR alpha chain 9606
121 6MJ6 1 C T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain 10090
122 2VLJ 4 D JM22 TCR ALPHA CHAIN 9606
123 3QFJ 4 D A6 alpha chain 9606
124 3VXR 3 D H27-14 TCR alpha chain 9606
125 6AM5 4 D DMF5 TCR alpha chain 9606
126 4JFH 1 D alpha24 TCR allele 9606
127 2VLR 4 D, I JM22 TCR ALPHA CHAIN 9606
128 5C0A 4 D, I 1E6 TCR Alpha Chain 9606
129 6FR7 1 A T-Cell Receptor alpha chain 9606
130 5BS0 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
131 4G8E 1 A alpha chain clone 18 TCR 9606
132 2XN9 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
133 4PJI 3 E, G TCR-alpha 9606
134 6C61 1 A T-cell receptor alpha chain 10090
135 1J8H 4 D T-CELL RECEPTOR ALPHA CHAIN Extracellular Domain 9606
136 4WW2 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
137 3QJF 1 A, C 2B4 alpha chain 10090
138 4WO4 3 C TCR variable DELTA 1 CHAIN and TCR constant Alpha 9606
139 4PRI 4 D TK3 TCR alpha chain 9606
140 5FKA 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS 9606
141 4JFD 4 D High Affinity TCR Alpha Chain 9606
142 4PJA 3 E, G TCR-alpha 9606
143 6BNL 3 C, G NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains 9606
144 6CQN 4 D F5 alpha chain 9606
145 5JHD 4 D, I TCRalpha chain 9606
146 5JZI 4 D, I HCV1406 TCR alpha chain 9606
147 4JFF 4 D High Affinity TCR Alpha Chain 9606
148 5C09 4 D, I 1E6 TCR Alpha Chain 9606
149 6FR8 1 A T-Cell Receptor HA1.7 alpha Chain 9606
150 3W0W 4 D T36-5 TCR alpha chain 9606
151 6CQL 4 D F24 alpha chain 9606
152 2YPL 4 D AGA T-CELL RECEPTOR ALPHA CHAIN 9606
153 4P2O 3 C 2B4 T-cell receptor alpha chain 10090
154 5KS9 3 E, G Bel502 TCR alpha TRAV20*01 9606
155 1TCR 1 A ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) 10090
156 3QDJ 4 D DMF5 alpha chain 9606
157 5WJO 1 A, C PG90 TCR alpha chain 9606
158 4Z7U 3 E, G T-CELL RECEPTOR, S13 ALPHA CHAIN 9606
159 4PJD 3 E, G TCR-alpha 9606
160 6AVG 2 B, C T-cell receptor alpha variable 4,TCR alpha chain 9606
161 2GJ6 4 D A6-Tcr 9606
162 4Z7V 3 E, G T-CELL RECEPTOR, L3-12 ALPHA CHAIN 9606
163 3VXM 4 D C1-28 TCR alpha chain 9606
164 3QI9 3 C NKT TCR V alpha 14 chimera of Mouse variable domain and human constant domain 10090
165 3UTT 4 D, I 1E6 TCR Alpha Chain 9606
166 4PRH 4 D TK3 TCR alpha chain 9606
167 2EYR 1 A NKT12 9606
168 5BRZ 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
169 4OZF 3 G T-CELL RECEPTOR, JR5.1 ALPHA CHAIN 9606
170 4E41 4 D, I T cell receptor G4 alpha chain 9606
171 4PJB 3 E, G TCR-alpha 9606
172 6C68 1 A, C T-cell receptor alpha chain 10090
173 3HUJ 3 E, G NKT15 T cell receptor alpha-chain 9606
174 5U1R 2 B, D MAIT T-cell receptor alpha chain 9606
175 5HHM 4 D, I JM22 TCR alpha chain 9606
176 2VLK 4 D JM22 TCR ALPHA CHAIN 9606
177 4X6C 3 E, G TCR alpha 9606
178 4EN3 2 A HUMAN NKT TCR ALPHA CHAIN 9606
179 2EYT 1 A, C NKT15 9606
180 1MI5 4 D TcR alpha chain extracellular domain 9606
181 2UWE 4 E, L AHIII TCR ALPHA CHAIN 10090
182 3KPS 4 D LC13 TCR alpha chain 9606
183 4MXQ 1 C 42F3 alpha VmVh chimera 10090
184 4Y16 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
185 6EH8 1 A Human T Cell Receptor Alpha Chain 9606
186 3PWP 4 D A6 TCR alpha chain 9606
187 3VXT 1 A, C T36-5 TCR alpha chain 9606
188 6EQB 4 D High Affinity Mel5 TCR, alpha chain 9606
189 6MIY 1 C, G T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN 10090
190 3O4L 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
191 3QEQ 4 D DMF4 alpha chain 9606
192 5XOV 4 G, I V-delta chain of T cell receptor 9606
193 4GKZ 1 A Alpha chain of Class II TCR 9606
194 3O8X 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
195 4E42 1 A, C T cell receptor G4 alpha chain 9606
196 2ESV 4 D KK50.4 T cell receptor alpha chain Extracellular domain 9606
197 6EH9 1 A Human T Cell Receptor Alpha Chain 9606
198 4P46 3 A J809.B5 TCR Y31A alpha chain (Va2.8) 10090
199 4JFE 4 D High Affinity TCR Alpha Chain 9606
200 5NMG 4 D, I Human T-cell receptor alpha chain 9606
201 4IRS 3 C Valpha14 (mouse variable domain, human constant domain) 10090
202 3UTS 4 D, I 1E6 TCR Alpha Chain 9606
203 1FYT 4 D T-CELL RECEPTOR ALPHA CHAIN EXTRACELLULAR DOMAIN 9606
204 6C09 3 C 3C8 T cell receptor alpha-chain 9606
205 5MEN 4 D Protein TRAV22,Human nkt tcr alpha chain 9606
206 3TA3 3 C Valpha14 chimera (mouse variable domain, human constant domain) 10090
207 3KPR 4 D, I LC13 TCR alpha chain 9606
208 2CDG 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
209 3RDT 3 A TCR 809.B5 alpha chain 10090
210 1BD2 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 210 9606
211 4L3E 4 D DMF5 alpha chain 9606
212 3PL6 3 C T-cell receptor alpha chain 9606
213 3O9W 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
214 4JRY 4 D SB47 TCR alpha chain 9606
215 5XOT 4 D The Delta chain of TU55 TCR 9606
216 3DX9 1 A, C DM1 T cell receptor alpha chain 9606
217 2JCC 4 E, L TCR ALPHA 10090
218 3UTP 1 D, K 1E6 TCR alpha chain 9606
219 4X6D 3 E, G TCR alpha 9606
220 3D39 4 D A6 TCR alpha chain 9606
221 3ARB 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
222 3QIU 3 C TCR 226 alpha chain 10090
223 4UDU 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
224 4APQ 3 C MOUSE NKT TCR VALPHA14, HUMAN NKT TCR VALPHA14 MOUSE VARIABLE DOMAIN, RESIDUES 1-121, HUMAN CONSTANT DOMAIN, RESIDUES 122-212 10090
225 2AK4 4 D, I, N, T SB27 T cell receptor alpha chain Extracellular Domain 9606
226 3QDG 4 D DMF5 alpha chain 9606
227 4P4K 3 C, G hTCRav22 alpha chain 9606
228 5SWZ 4 D, I, N, S NP1-B17 TCR alpha chain 10090
229 5NMF 4 D HUman T-cell receptor Alpha chain 9606
230 5NMF 6 I HUman T-cell receptor Alpha chain 9606
231 5WKI 3 D T-cell receptor alpha variable 26-1,TRA@ protein 9606
232 4N0C 3 C, G 42F3 VmCh alpha 10090
233 3H9S 4 D A6 TCR alpha chain 9606
234 3QIB 3 C T-cell receptor alpha chain C region 9606
235 6CQQ 4 D, I F24 alpha chain 9606
236 4MNQ 4 D Uncharacterized protein, T-cell receptor, sp3.4 alpha chain 9606
237 4FTV 4 D A6 alpha chain 9606
238 3VWK 3 C NKT15 T cell receptor alpha-chain 9606
239 2IAM 4 C CD4+ T cell receptor E8 alpha chain 9606
240 3C5Z 1 A, E TCR B3K506 Alpha Chain 10090
241 5WKF 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain Chimera 9606
242 3SKN 1 A, C, E, G RL42 T cell receptor, alpha chain 9606
243 2F54 4 D, K T-cell receptor alpha chain 9606
244 4IRJ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
245 4GRL 3 C TCR Hy.1B11 alpha chain 9606
246 3QDM 4 D DMF4 alpha chain 9606
247 1QRN 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
248 5NME 4 D, I T-cell receptor Alpha chain 9606
249 3RGV 1 A Yae62 TCR a chain 10090
250 1AO7 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 212 9606
251 4PJ8 3 C TCR-alpha 9606
252 3D3V 4 D A6 TCR alpha chain 9606
253 3TYF 1 A, C iNKT Cell Receptor Alpha Chain 562
254 4QRP 4 D, J, K DD31 TCR alpha chain 9606
255 4ZAK 3 C Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain 10090
256 4Y4K 3 C chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain) 10090
257 3ARE 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
258 3FFC 4 D, I CF34 alpha chain 9606
259 3QUX 3 C Valpha14 (mouse variable domain, human constant domain) 10090
260 4IIQ 1 A Human Mucosal Associated Invariant T cell receptor alpha chain 9606
261 5WKH 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain 9606
262 5YXU 1 A, F T cell receptor alpha chain 9606
263 3MV9 4 D alpha chain of the TK3 TCR 9606
264 2IAN 4 D, I, N, S CD4+ T cell receptor E8 alpha chain 9606
265 4N5E 1 C 42F3 alpha VmCh 10090
266 1MWA 1 A, C 2C T CELL RECEPTOR ALPHA CHAIN 10090
267 5TIL 4 G alpha chain of P14 T cell receptor 10090
268 3HE7 3 C Valpha14(mouse variable domain, human constant domain) 10090
269 3TVM 3 C, G Valpha14 (mouse variable domain, human constant domain) 10090
270 6FR6 1 A Human T-Cell Receptor Alpha Chain 9606
271 4OZH 3 E, G T-cell receptor, s16, alpha chain 9606
272 4OZG 3 E, G T-cell receptor, d2, alpha chain 9606
273 3RTQ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
274 4QOK 4 D Mel5 TCR chain alpha 9606
275 6EQA 4 D Mel5 TCR, alpha chain 9606
276 3SCM 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
277 5VCJ 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) UNP A0A0B4J1J9 residues 22-114,UNP K7N5M3 residues 116-210 10090
278 4WWK 1 A TCR Alpha Chain-TRAV12-3 9606
279 5KSB 3 E, G T15 TCR alpha TRAV20*02 9606
280 4EI5 3 C, G Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
281 4QRR 3 D clone12 TCR beta chain 9606
282 3GSN 4 A RA14 TCR alpha chain (TRAV24, TRAJ49) 9606
283 3RZC 3 C Valpha14 mouse variable domain, human constant domain 10090
284 3O6F 3 C, G T-cell receptor alpha chain C region unp residues 1-92 9606
285 4P5T 1 A, E TRA protein 9606
286 3ARF 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
287 4Z7W 3 E, G T-CELL RECEPTOR, T316 ALPHA CHAIN 9606
288 5SWS 4 D NP1-B17 TCR alpha chain 10090
289 6MJQ 1 C, G T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, chimeric protein 10090
290 3ARD 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
291 4L8S 1 A Muccosal Associated Invariant T Cell Receptor alpha chain 9606
292 4NHU 1 A, C 2C m33 alpha VmCh chimera 10090
293 1QSE 4 D PROTEIN (human T-Cell receptor) 9606
294 1NFD 1 A, C N15 ALPHA-BETA T-CELL RECEPTOR 10090
295 3TFK 3 C 42F3 alpha Mouse-human chimera alpha chain 10090
296 4P2Q 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
297 2CKB 1 A, C ALPHA, BETA T CELL RECEPTOR VB8.2DB2JB2.4CB2\;VA3JA58CA EXTRACELLULAR DOMAINS 10090
298 1QSF 4 D HUMAN T-CELL RECEPTOR 9606
299 4C56 1 A, G T CELL RECEPTOR ALPHA CHAIN 9606
300 5HYJ 4 D, I Human T-cell Receptor, Class I, Light alpha Chain 9606
301 6BNK 3 C, G Human nkt tcr alpha chain 9606
302 6MTM 4 D EM2 TCR alpha chain 9606
303 4Y2D 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
304 4EUP 4 G, I JKF6 alpha chain 9606
305 3HE6 3 C Valpha14(mouse variable domain, human constant domain) 10090
306 5W1W 4 D, I, N, S GF4 T cell receptor alpha chain 9606
307 3KXF 3 D, G, M, N SB27 T cell receptor alpha chain 9606
308 6CQR 4 D, I F24 alpha chain 9606
309 3HG1 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
310 3TO4 3 C NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-207 IS HUMAN CONSTANT DOMAIN 10090
311 5HHO 3 D JM22 TCR alpha chain 9606
312 2NX5 4 D, I, N, T ELS4 TCR alpha chain 9606
313 4OZI 3 E, G T-cell receptor, s2, alpha chain 9606
314 3VXU 4 D, I T36-5 TCR alpha chain 9606
315 3ARG 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
316 5NHT 4 A T-cell receptor alpha variable 12-2,T-cell receptor, sp3.4 alpha chain Numbering: residue 1 match first residue of TRAV12-2 defined in IMGT. Additional sequence in C-ter (ENDGGGCK) to enhance alpha-beta chain pairing. 9606
317 4Y4F 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
318 5L2K 3 D GEM42 TCR alpha chain 9606
319 3VWJ 3 C NKT15 T cell receptor alpha-chain 9606
320 4MVB 1 C 42F3 alpha VmCh 10090
321 3TPU 1 A, C, G, M 42F3 alpha 10090
322 5IW1 1 A, C, E T-CELL RECEPTOR ALPHA CHAIN 10090
323 4P2R 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
324 4MJI 4 D, I T-Cell Receptor Chain alpha 9606
325 4NDM 2 B Human nkt tcr alpha chain AB18.1 TCR delta chain 9606
326 3TZV 1 A, G Invariant Natural Killer T Cell Receptor chain A 9606
327 3QIW 3 C TCR 226 alpha chain unp residues 97-108 7130
328 3AXL 1 A, G Valpha 10 10090
329 3SDX 3 E, G NKT TCR Valpha24 chain 9606
330 2WBJ 3 C, G OB TCR E. COLI ENGA PEPTIDE COVALENTLY BOUND 9606
331 3TN0 3 C mouse NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-210 IS HUMAN CONSTANT DOMAIN 10090
332 2PO6 3 C, G NKT15 alpha-chain 9606
333 3SDA 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
334 5TJE 3 E, G ALPHA CHAIN OF MURINE T CELL RECEPTOR p14 10090
335 3SDC 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
336 5NQK 4 A T-cell receptor alpha variable 12-2,T-cell receptor alpha joining 45,T-cell receptor alpha chain C region NUMBERING: RESIDUE 1 MATCH FIRST RESIDUE OF TRAV 12-2 DEFINED IN IMGT. ADDITIONAL SEQUENCE IN C-TER (ENDGGGCK) TO ENHANCE ALPHA-BETA CHAIN PAIRING. 9606
337 4Y4H 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
338 2J8U 4 E, L AHIII TCR ALPHA CHAIN ECTODOMAIN 10090
339 1ZGL 4 M, Q, S, U T cell receptor alpha chain 9606
340 4ELM 3 E, G Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
341 5W1V 4 D, I, N, S GF4 T cell receptor alpha chain 9606
342 4ONH 2 A T-cell receptor beta 9606
343 3SDD 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
344 4MNH 2 B, D Human nkt tcr alpha chain DP10.7 TCR delta variable domain fused with human TCR alpha constant domain 9606
345 3SJV 4 D, I, N, S RL42 T cell receptor, alpha chain 9606
346 4GG6 3 E, G T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
347 3PQY 4 D, I, N, S alpha chain of the 6218-TCR chimeric construct with mouse variable domain and human constant domain 10090
348 5FK9 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS, RESIDUES 1-206 9606
349 3C60 1 A, E TCR YAe62 alpha chain 10090
350 1G6R 1 A, C ALPHA T CELL RECEPTOR EXTRACELLULAR DOMAIN 10090
351 6BJ2 1 D TCR 589 alpha chain 9606
352 4GG8 1 A, E T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
353 4LCC 2 A Human MAIT TCR alpha chain 9606
354 4L9L 2 A Human MAIT TCR alpha chain 9606
355 1YPZ 3 E, G T cell receptor delta 10090
356 3C6L 1 A, E TCR 2W20 alpha chain 10090
357 4Y1A 4 D FS17_alpha 9606
358 5D7L 3 D, G MAV36 TCR Alpha Chain 9606
359 5D2L 3 E, I, K, O C7 TCR alpha chain 9606
360 1YMM 4 D T cell receptor alpha chain 9606
361 3T0E 3 C T-cell receptor alpha chain 9606
362 2CDE 1 A, C, E INKT-TCR HUMAN INVARIANT NATURAL KILLER T CELL RECEPTOR VALPHA 24 AND VBETA11 9606
363 3DXA 4 D, I, N DM1 T cell receptor alpha chain 9606
364 5E6I 1 A, F, G, P TCR alpha chain,Human nkt tcr alpha chain 9606