Sequence Similarity Clusters for the Entities in PDB 1MI5

Entity #1 | Chains: A
MHC heavy chain protein, length: 277 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 14 17 2664
95 % 138 158 217 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 1.0
PDBFlex
90 % 197 224 138
70 % 583 777 6
50 % 594 793 7
40 % 626 845 9
30 % 686 973 12
Entity #2 | Chains: B
beta 2 microglobulin protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 539 706 2
95 % 550 721 2 Flexibility: Low
Max RMSD: 22.2, Avg RMSD: 0.9
PDBFlex
90 % 556 730 4
70 % 710 986 4
50 % 724 1010 3
40 % 724 1010 6
30 % 724 1010 9
Entity #3 | Chains: C
Epstein Barr Virus peptide protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
TcR alpha chain protein, length: 201 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 16264
95 % 2 4 15140 Flexibility: Low
Max RMSD: 1.7, Avg RMSD: 1.0
PDBFlex
90 % 5 11 3803
70 % 170 350 32
50 % 170 351 79
40 % 170 351 100
30 % 4345 7653 1
Entity #5 | Chains: E
TcR beta chain protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 3 18606
95 % 5 7 7310 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.9
PDBFlex
90 % 6 9 5580
70 % 178 360 27
50 % 178 363 73
40 % 178 363 93
30 % 4346 7653 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
2 6FR4 1 A TCR 003 alpha chain 9606
3 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
4 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
5 6FR3 1 A 003 TCR Alpha Chain 9606
6 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
7 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
8 2NW2 1 A ELS4 TCR alpha chain 9606
9 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
10 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
11 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
12 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
13 1KGC 1 D T-cell receptor alpha chain 9606
14 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
15 6FUQ 1 A Human F11 T-Cell Receptor 9606
16 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
17 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
18 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
19 6BJ8 3 D TCR 55 alpha chain 9606
20 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
21 5TEZ 4 I TCR F50 alpha chain 9606
22 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
23 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
24 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
25 6CPH 1 D TCR alpha chain 9606
26 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
27 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
28 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
29 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
30 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
31 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
32 5D7K 1 D MAV36 TCR Alpha Chain 9606
33 3VXS 3 D H27-14 TCR alpha chain 9606
34 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
35 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
36 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
37 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
38 4PJE 3 E, G TCR-alpha 9606
39 6BJ3 3 D TCR 55 alpha chain 9606
40 4MS8 1 C 42F3 alpha 10090
41 4G9F 4 D beta chain C12C TCR 9606
42 4PJH 3 E, G TCR-alpha 9606
43 5KSA 3 C Bel602 alpha TRAV20*01 9606
44 5D7J 1 A, G M33.64 TCR Alpha Chain 9606
45 4PJ9 3 C TCR-alpha 9606
46 5U16 3 E, G MAIT T-cell receptor alpha chain 9606
47 5D7I 3 E, G M33.64 TCR Alpha Chain 9606
48 4PJ5 3 D, G TCR-alpha 9606
49 5C0C 4 D, I 1E6 TCR Alpha Chain 9606
50 5M01 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
51 4L4T 3 D, G MAIT T-cell receptor alpha chain 9606
52 5EU6 4 D Human TCR Light Chain 9606
53 5M00 3 G Protein Trav14-1,Uncharacterized protein 10090
54 2IAL 1 A, C CD4+ T cell receptor E8 alpha chain 9606
55 2F53 4 D T-cell Receptor, alpha chain 9606
56 5ISZ 4 D TCRalpha chain 9606
57 3QJH 1 A, C 5c.c7 alpha chain 10090
58 5C0B 4 D, I 1E6 TCR Alpha Chain 9606
59 5YXN 1 A T cell receptor alpha chain 9606
60 3MFF 1 A, C T cell receptor alpha chain 9606
61 2VLM 1 D JM22 TCR ALPHA CHAIN 9606
62 2BNR 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
63 5IVX 3 E T-CELL RECEPTOR ALPHA CHAIN 10090
64 5NMD 1 A, C human T-cell Receptor alpha chain 9606
65 4NQE 3 D, G TCR alpha 9606
66 6AVF 2 A T-cell receptor alpha variable 4,TCR alpha chain 9606
67 4X6B 1 A, C TCR alpha 9606
68 4ELK 1 A, C Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
69 2P5W 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
70 4ZDH 1 A Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region 9606
71 6AMU 4 D DMF5 TCR alpha chain 9606
72 5U17 2 B, D MAIT T-cell receptor alpha chain 9606
73 5D5M 3 E, G M33.64 TCR Alpha Chain 9606
74 5C07 4 D, I 1E6 TCR Alpha Chain 9606
75 1LP9 4 E, L T-cell Receptor alpha chain 10090
76 4P23 1 A J809.B5 TCR V alpha chain (Va2.8) 10090
77 3VXQ 1 A, D H27-14 TCR alpha chain 9606
78 5U2V 3 E, G MAIT T-cell receptor alpha chain 9606
79 4PJX 3 E, G TCR-alpha 9606
80 3MV7 4 D alpha chain of the TK3 TCR 9606
81 5D2N 1 C, D C25 alpha 9606
82 4G8F 1 A alpha chain clone 42 TCR 9606
83 4NQD 3 D, G TCR alpha chain 9606
84 3QEU 1 A, D DMF5 alpha chain 9606
85 3TJH 3 C 42F3 alpha 10090
86 4GRM 1 A, C A6 alpha chain 9606
87 5WLG 4 D, I T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain 10090
88 4MAY 3 C HY.1B11 TCR alpha chain 9606
89 3QUY 3 C Valpha14 (mouse variable domain, human constant domain) 10090
90 2CDF 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
91 2XNA 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
92 3QH3 1 A, C A6 alpha chain 9606
93 4PJG 3 E, G TCR-alpha 9606
94 5EUO 3 E, G PF6 TCR alpha chain 9606
95 3MV8 4 D alpha chain of the TK3 TCR 9606
96 3RUG 3 E, G Valpha10(mouse variable domain, human constant domain) 10090
97 2PYF 1 A T-Cell Receptor, Alpha Chain 9606
98 3QUZ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
99 6BGA 3 C T cell receptor 2B4 alpha chain 10090
100 4Y19 4 D FS18_alpha 9606
101 2PYE 4 D T-Cell Receptor, Alpha Chain 9606
102 2EYS 1 A NKT15 9606
103 4LCW 3 D, G MAIT T cell receptor alpha chain 9606
104 4G8G 4 D alpha chain C12C TCR 9606
105 4NQC 3 D, G TCR alpha chain 9606
106 4PJC 3 E, G TCR-alpha 9606
107 4JRX 4 D CA5 TCR alpha chain 9606
108 4PJF 3 E, G TCR-alpha 9606
109 4PJ7 3 E, G TCR-alpha 9606
110 5U72 2 B, D MAIT T-cell receptor alpha chain 9606
111 3REV 1 A TCR NB20 ALPHA CHAIN 9606
112 5C08 4 D, I 1E6 TCR Alpha Chain 9606
113 4PRP 4 D TK3 TCR alpha chain 9606
114 2VLJ 4 D JM22 TCR ALPHA CHAIN 9606
115 3QFJ 4 D A6 alpha chain 9606
116 3VXR 3 D H27-14 TCR alpha chain 9606
117 6AM5 4 D DMF5 TCR alpha chain 9606
118 4JFH 1 D alpha24 TCR allele 9606
119 2VLR 4 D, I JM22 TCR ALPHA CHAIN 9606
120 5C0A 4 D, I 1E6 TCR Alpha Chain 9606
121 6FR7 1 A T-Cell Receptor alpha chain 9606
122 5BS0 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
123 4G8E 1 A alpha chain clone 18 TCR 9606
124 2XN9 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
125 4PJI 3 E, G TCR-alpha 9606
126 1J8H 4 D T-CELL RECEPTOR ALPHA CHAIN Extracellular Domain 9606
127 4WW2 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
128 3QJF 1 A, C 2B4 alpha chain 10090
129 4WO4 3 C TCR variable DELTA 1 CHAIN and TCR constant Alpha 9606
130 4PRI 4 D TK3 TCR alpha chain 9606
131 5FKA 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS 9606
132 4JFD 4 D High Affinity TCR Alpha Chain 9606
133 4PJA 3 E, G TCR-alpha 9606
134 6BNL 3 C, G NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains 9606
135 6CQN 4 D F5 alpha chain 9606
136 5JHD 4 D, I TCRalpha chain 9606
137 5JZI 4 D, I HCV1406 TCR alpha chain 9606
138 4JFF 4 D High Affinity TCR Alpha Chain 9606
139 5C09 4 D, I 1E6 TCR Alpha Chain 9606
140 6FR8 1 A T-Cell Receptor HA1.7 alpha Chain 9606
141 3W0W 4 D T36-5 TCR alpha chain 9606
142 6CQL 4 D F24 alpha chain 9606
143 2YPL 4 D AGA T-CELL RECEPTOR ALPHA CHAIN 9606
144 4P2O 3 C 2B4 T-cell receptor alpha chain 10090
145 5KS9 3 E, G Bel502 TCR alpha TRAV20*01 9606
146 1TCR 1 A ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) 10090
147 3QDJ 4 D DMF5 alpha chain 9606
148 5WJO 1 A, C PG90 TCR alpha chain 9606
149 4Z7U 3 E, G T-CELL RECEPTOR, S13 ALPHA CHAIN 9606
150 4PJD 3 E, G TCR-alpha 9606
151 6AVG 2 B, C T-cell receptor alpha variable 4,TCR alpha chain 9606
152 2GJ6 4 D A6-Tcr 9606
153 4Z7V 3 E, G T-CELL RECEPTOR, L3-12 ALPHA CHAIN 9606
154 3VXM 4 D C1-28 TCR alpha chain 9606
155 3QI9 3 C NKT TCR V alpha 14 chimera of Mouse variable domain and human constant domain 10090
156 3UTT 4 D, I 1E6 TCR Alpha Chain 9606
157 4PRH 4 D TK3 TCR alpha chain 9606
158 2EYR 1 A NKT12 9606
159 5BRZ 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
160 4OZF 3 G T-CELL RECEPTOR, JR5.1 ALPHA CHAIN 9606
161 4E41 4 D, I T cell receptor G4 alpha chain 9606
162 4PJB 3 E, G TCR-alpha 9606
163 3HUJ 3 E, G NKT15 T cell receptor alpha-chain 9606
164 5U1R 2 B, D MAIT T-cell receptor alpha chain 9606
165 5HHM 4 D, I JM22 TCR alpha chain 9606
166 2VLK 4 D JM22 TCR ALPHA CHAIN 9606
167 4X6C 3 E, G TCR alpha 9606
168 4EN3 2 A HUMAN NKT TCR ALPHA CHAIN 9606
169 2EYT 1 A, C NKT15 9606
170 1MI5 4 D TcR alpha chain extracellular domain 9606
171 2UWE 4 E, L AHIII TCR ALPHA CHAIN 10090
172 3KPS 4 D LC13 TCR alpha chain 9606
173 4MXQ 1 C 42F3 alpha VmVh chimera 10090
174 4Y16 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
175 6EH8 1 A Human T Cell Receptor Alpha Chain 9606
176 3PWP 4 D A6 TCR alpha chain 9606
177 3VXT 1 A, C T36-5 TCR alpha chain 9606
178 6EQB 4 D High Affinity Mel5 TCR, alpha chain 9606
179 3O4L 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
180 3QEQ 4 D DMF4 alpha chain 9606
181 5XOV 4 G, I V-delta chain of T cell receptor 9606
182 4GKZ 1 A Alpha chain of Class II TCR 9606
183 3O8X 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
184 4E42 1 A, C T cell receptor G4 alpha chain 9606
185 2ESV 4 D KK50.4 T cell receptor alpha chain Extracellular domain 9606
186 6EH9 1 A Human T Cell Receptor Alpha Chain 9606
187 4P46 3 A J809.B5 TCR Y31A alpha chain (Va2.8) 10090
188 4JFE 4 D High Affinity TCR Alpha Chain 9606
189 5NMG 4 D, I Human T-cell receptor alpha chain 9606
190 4IRS 3 C Valpha14 (mouse variable domain, human constant domain) 10090
191 3UTS 4 D, I 1E6 TCR Alpha Chain 9606
192 1FYT 4 D T-CELL RECEPTOR ALPHA CHAIN EXTRACELLULAR DOMAIN 9606
193 6C09 3 C 3C8 T cell receptor alpha-chain 9606
194 5MEN 4 D Protein TRAV22,Human nkt tcr alpha chain 9606
195 3TA3 3 C Valpha14 chimera (mouse variable domain, human constant domain) 10090
196 3KPR 4 D, I LC13 TCR alpha chain 9606
197 2CDG 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
198 3RDT 3 A TCR 809.B5 alpha chain 10090
199 1BD2 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 210 9606
200 4L3E 4 D DMF5 alpha chain 9606
201 3PL6 3 C T-cell receptor alpha chain 9606
202 3O9W 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
203 4JRY 4 D SB47 TCR alpha chain 9606
204 5XOT 4 D The Delta chain of TU55 TCR 9606
205 3DX9 1 A, C DM1 T cell receptor alpha chain 9606
206 2JCC 4 E, L TCR ALPHA 10090
207 3UTP 1 D, K 1E6 TCR alpha chain 9606
208 4X6D 3 E, G TCR alpha 9606
209 3D39 4 D A6 TCR alpha chain 9606
210 3ARB 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
211 3QIU 3 C TCR 226 alpha chain 10090
212 4UDU 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
213 4APQ 3 C MOUSE NKT TCR VALPHA14, HUMAN NKT TCR VALPHA14 MOUSE VARIABLE DOMAIN, RESIDUES 1-121, HUMAN CONSTANT DOMAIN, RESIDUES 122-212 10090
214 2AK4 4 D, I, N, T SB27 T cell receptor alpha chain Extracellular Domain 9606
215 3QDG 4 D DMF5 alpha chain 9606
216 4P4K 3 C, G hTCRav22 alpha chain 9606
217 5SWZ 4 D, I, N, S NP1-B17 TCR alpha chain 10090
218 5NMF 4 D HUman T-cell receptor Alpha chain 9606
219 5NMF 6 I HUman T-cell receptor Alpha chain 9606
220 5WKI 3 D T-cell receptor alpha variable 26-1,TRA@ protein 9606
221 4N0C 3 C, G 42F3 VmCh alpha 10090
222 3H9S 4 D A6 TCR alpha chain 9606
223 3QIB 3 C T-cell receptor alpha chain C region 9606
224 6CQQ 4 D, I F24 alpha chain 9606
225 4MNQ 4 D Uncharacterized protein, T-cell receptor, sp3.4 alpha chain 9606
226 4FTV 4 D A6 alpha chain 9606
227 3VWK 3 C NKT15 T cell receptor alpha-chain 9606
228 2IAM 4 C CD4+ T cell receptor E8 alpha chain 9606
229 3C5Z 1 A, E TCR B3K506 Alpha Chain 10090
230 5WKF 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain Chimera 9606
231 3SKN 1 A, C, E, G RL42 T cell receptor, alpha chain 9606
232 2F54 4 D, K T-cell receptor alpha chain 9606
233 4IRJ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
234 4GRL 3 C TCR Hy.1B11 alpha chain 9606
235 3QDM 4 D DMF4 alpha chain 9606
236 1QRN 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
237 5NME 4 D, I T-cell receptor Alpha chain 9606
238 3RGV 1 A Yae62 TCR a chain 10090
239 1AO7 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 212 9606
240 4PJ8 3 C TCR-alpha 9606
241 3D3V 4 D A6 TCR alpha chain 9606
242 3TYF 1 A, C iNKT Cell Receptor Alpha Chain 562
243 4QRP 4 D, J, K DD31 TCR alpha chain 9606
244 4ZAK 3 C Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain 10090
245 4Y4K 3 C chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain) 10090
246 3ARE 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
247 3FFC 4 D, I CF34 alpha chain 9606
248 3QUX 3 C Valpha14 (mouse variable domain, human constant domain) 10090
249 4IIQ 1 A Human Mucosal Associated Invariant T cell receptor alpha chain 9606
250 5WKH 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain 9606
251 5YXU 1 A, F T cell receptor alpha chain 9606
252 3MV9 4 D alpha chain of the TK3 TCR 9606
253 2IAN 4 D, I, N, S CD4+ T cell receptor E8 alpha chain 9606
254 4N5E 1 C 42F3 alpha VmCh 10090
255 1MWA 1 A, C 2C T CELL RECEPTOR ALPHA CHAIN 10090
256 5TIL 4 G alpha chain of P14 T cell receptor 10090
257 3HE7 3 C Valpha14(mouse variable domain, human constant domain) 10090
258 3TVM 3 C, G Valpha14 (mouse variable domain, human constant domain) 10090
259 6FR6 1 A Human T-Cell Receptor Alpha Chain 9606
260 4OZH 3 E, G T-cell receptor, s16, alpha chain 9606
261 4OZG 3 E, G T-cell receptor, d2, alpha chain 9606
262 3RTQ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
263 4QOK 4 D Mel5 TCR chain alpha 9606
264 6EQA 4 D Mel5 TCR, alpha chain 9606
265 3SCM 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
266 5VCJ 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) UNP A0A0B4J1J9 residues 22-114,UNP K7N5M3 residues 116-210 10090
267 4WWK 1 A TCR Alpha Chain-TRAV12-3 9606
268 5KSB 3 E, G T15 TCR alpha TRAV20*02 9606
269 4EI5 3 C, G Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
270 4QRR 3 D clone12 TCR beta chain 9606
271 3GSN 4 A RA14 TCR alpha chain (TRAV24, TRAJ49) 9606
272 3RZC 3 C Valpha14 mouse variable domain, human constant domain 10090
273 3O6F 3 C, G T-cell receptor alpha chain C region unp residues 1-92 9606
274 4P5T 1 A, E TRA protein 9606
275 3ARF 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
276 4Z7W 3 E, G T-CELL RECEPTOR, T316 ALPHA CHAIN 9606
277 5SWS 4 D NP1-B17 TCR alpha chain 10090
278 3ARD 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
279 4L8S 1 A Muccosal Associated Invariant T Cell Receptor alpha chain 9606
280 4NHU 1 A, C 2C m33 alpha VmCh chimera 10090
281 1QSE 4 D PROTEIN (human T-Cell receptor) 9606
282 1NFD 1 A, C N15 ALPHA-BETA T-CELL RECEPTOR 10090
283 3TFK 3 C 42F3 alpha Mouse-human chimera alpha chain 10090
284 4P2Q 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
285 2CKB 1 A, C ALPHA, BETA T CELL RECEPTOR VB8.2DB2JB2.4CB2\;VA3JA58CA EXTRACELLULAR DOMAINS 10090
286 1QSF 4 D HUMAN T-CELL RECEPTOR 9606
287 4C56 1 A, G T CELL RECEPTOR ALPHA CHAIN 9606
288 5HYJ 4 D, I Human T-cell Receptor, Class I, Light alpha Chain 9606
289 6BNK 3 C, G Human nkt tcr alpha chain 9606
290 4Y2D 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
291 4EUP 4 G, I JKF6 alpha chain 9606
292 3HE6 3 C Valpha14(mouse variable domain, human constant domain) 10090
293 5W1W 4 D, I, N, S GF4 T cell receptor alpha chain 9606
294 3KXF 3 D, G, M, N SB27 T cell receptor alpha chain 9606
295 6CQR 4 D, I F24 alpha chain 9606
296 3HG1 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
297 3TO4 3 C NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-207 IS HUMAN CONSTANT DOMAIN 10090
298 5HHO 3 D JM22 TCR alpha chain 9606
299 2NX5 4 D, I, N, T ELS4 TCR alpha chain 9606
300 4OZI 3 E, G T-cell receptor, s2, alpha chain 9606
301 3VXU 4 D, I T36-5 TCR alpha chain 9606
302 3ARG 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
303 5NHT 4 A T-cell receptor alpha variable 12-2,T-cell receptor, sp3.4 alpha chain Numbering: residue 1 match first residue of TRAV12-2 defined in IMGT. Additional sequence in C-ter (ENDGGGCK) to enhance alpha-beta chain pairing. 9606
304 4Y4F 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
305 5L2K 3 D GEM42 TCR alpha chain 9606
306 3VWJ 3 C NKT15 T cell receptor alpha-chain 9606
307 4MVB 1 C 42F3 alpha VmCh 10090
308 3TPU 1 A, C, G, M 42F3 alpha 10090
309 5IW1 1 A, C, E T-CELL RECEPTOR ALPHA CHAIN 10090
310 4P2R 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
311 4MJI 4 D, I T-Cell Receptor Chain alpha 9606
312 4NDM 2 B Human nkt tcr alpha chain AB18.1 TCR delta chain 9606
313 3TZV 1 A, G Invariant Natural Killer T Cell Receptor chain A 9606
314 3QIW 3 C TCR 226 alpha chain unp residues 97-108 7130
315 3AXL 1 A, G Valpha 10 10090
316 3SDX 3 E, G NKT TCR Valpha24 chain 9606
317 2WBJ 3 C, G OB TCR E. COLI ENGA PEPTIDE COVALENTLY BOUND 9606
318 3TN0 3 C mouse NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-210 IS HUMAN CONSTANT DOMAIN 10090
319 2PO6 3 C, G NKT15 alpha-chain 9606
320 3SDA 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
321 5TJE 3 E, G ALPHA CHAIN OF MURINE T CELL RECEPTOR p14 10090
322 3SDC 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
323 5NQK 4 A T-cell receptor alpha variable 12-2,T-cell receptor alpha joining 45,T-cell receptor alpha chain C region NUMBERING: RESIDUE 1 MATCH FIRST RESIDUE OF TRAV 12-2 DEFINED IN IMGT. ADDITIONAL SEQUENCE IN C-TER (ENDGGGCK) TO ENHANCE ALPHA-BETA CHAIN PAIRING. 9606
324 4Y4H 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
325 2J8U 4 E, L AHIII TCR ALPHA CHAIN ECTODOMAIN 10090
326 1ZGL 4 M, Q, S, U T cell receptor alpha chain 9606
327 4ELM 3 E, G Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
328 5W1V 4 D, I, N, S GF4 T cell receptor alpha chain 9606
329 4ONH 2 A T-cell receptor beta 9606
330 3SDD 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
331 4MNH 2 B, D Human nkt tcr alpha chain DP10.7 TCR delta variable domain fused with human TCR alpha constant domain 9606
332 3SJV 4 D, I, N, S RL42 T cell receptor, alpha chain 9606
333 4GG6 3 E, G T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
334 3PQY 4 D, I, N, S alpha chain of the 6218-TCR chimeric construct with mouse variable domain and human constant domain 10090
335 5FK9 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS, RESIDUES 1-206 9606
336 3C60 1 A, E TCR YAe62 alpha chain 10090
337 1G6R 1 A, C ALPHA T CELL RECEPTOR EXTRACELLULAR DOMAIN 10090
338 6BJ2 1 D TCR 589 alpha chain 9606
339 4GG8 1 A, E T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
340 4LCC 2 A Human MAIT TCR alpha chain 9606
341 4L9L 2 A Human MAIT TCR alpha chain 9606
342 1YPZ 3 E, G T cell receptor delta 10090
343 3C6L 1 A, E TCR 2W20 alpha chain 10090
344 4Y1A 4 D FS17_alpha 9606
345 5D7L 3 D, G MAV36 TCR Alpha Chain 9606
346 5D2L 3 E, I, K, O C7 TCR alpha chain 9606
347 1YMM 4 D T cell receptor alpha chain 9606
348 3T0E 3 C T-cell receptor alpha chain 9606
349 2CDE 1 A, C, E INKT-TCR HUMAN INVARIANT NATURAL KILLER T CELL RECEPTOR VALPHA 24 AND VBETA11 9606
350 3DXA 4 D, I, N DM1 T cell receptor alpha chain 9606
351 5E6I 1 A, F, G, P TCR alpha chain,Human nkt tcr alpha chain 9606