Sequence Similarity Clusters for the Entities in PDB 1MI5

Entity #1 | Chains: A
MHC heavy chain protein, length: 277 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 14 17 2607
95 % 126 146 227 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 1.0
PDBFlex
90 % 185 212 138
70 % 567 757 6
50 % 576 771 7
40 % 608 823 9
30 % 667 1125 13
Entity #2 | Chains: B
beta 2 microglobulin protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 524 687 2
95 % 535 702 2 Flexibility: Low
Max RMSD: 22.2, Avg RMSD: 0.9
PDBFlex
90 % 541 711 4
70 % 693 965 4
50 % 705 987 3
40 % 705 987 6
30 % 705 987 9
Entity #3 | Chains: C
Epstein Barr Virus peptide protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
TcR alpha chain protein, length: 201 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 4 15870
95 % 2 4 14764 Flexibility: Low
Max RMSD: 1.7, Avg RMSD: 1.0
PDBFlex
90 % 5 11 3713
70 % 169 346 31
50 % 169 347 79
40 % 169 347 100
30 % 4270 7449 1
Entity #5 | Chains: E
TcR beta chain protein, length: 241 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 3 18184
95 % 5 7 7118 Flexibility: Low
Max RMSD: 1.5, Avg RMSD: 0.9
PDBFlex
90 % 6 9 5440
70 % 177 356 26
50 % 177 359 72
40 % 177 359 93
30 % 4271 7449 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
2 6FR4 1 A TCR 003 alpha chain 9606
3 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
4 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
5 6FR3 1 A 003 TCR Alpha Chain 9606
6 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
7 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
8 2NW2 1 A ELS4 TCR alpha chain 9606
9 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
10 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
11 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
12 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
13 1KGC 1 D T-cell receptor alpha chain 9606
14 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
15 6FUQ 1 A Human F11 T-Cell Receptor 9606
16 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
17 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
18 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
19 6BJ8 3 D TCR 55 alpha chain 9606
20 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
21 5TEZ 4 I TCR F50 alpha chain 9606
22 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
23 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
24 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
25 6CPH 1 D TCR alpha chain 9606
26 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
27 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
28 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
29 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
30 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
31 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
32 5D7K 1 D MAV36 TCR Alpha Chain 9606
33 3VXS 3 D H27-14 TCR alpha chain 9606
34 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
35 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
36 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
37 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
38 4PJE 3 E, G TCR-alpha 9606
39 6BJ3 3 D TCR 55 alpha chain 9606
40 4MS8 1 C 42F3 alpha 10090
41 4G9F 4 D beta chain C12C TCR 9606
42 4PJH 3 E, G TCR-alpha 9606
43 5KSA 3 C Bel602 alpha TRAV20*01 9606
44 5D7J 1 A, G M33.64 TCR Alpha Chain 9606
45 4PJ9 3 C TCR-alpha 9606
46 5U16 3 E, G MAIT T-cell receptor alpha chain 9606
47 5D7I 3 E, G M33.64 TCR Alpha Chain 9606
48 4PJ5 3 D, G TCR-alpha 9606
49 5C0C 4 D, I 1E6 TCR Alpha Chain 9606
50 5M01 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
51 4L4T 3 D, G MAIT T-cell receptor alpha chain 9606
52 5EU6 4 D Human TCR Light Chain 9606
53 5M00 3 G Protein Trav14-1,Uncharacterized protein 10090
54 2IAL 1 A, C CD4+ T cell receptor E8 alpha chain 9606
55 2F53 4 D T-cell Receptor, alpha chain 9606
56 5ISZ 4 D TCRalpha chain 9606
57 3QJH 1 A, C 5c.c7 alpha chain 10090
58 5C0B 4 D, I 1E6 TCR Alpha Chain 9606
59 3MFF 1 A, C T cell receptor alpha chain 9606
60 2VLM 1 D JM22 TCR ALPHA CHAIN 9606
61 2BNR 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
62 5IVX 3 E T-CELL RECEPTOR ALPHA CHAIN 10090
63 5NMD 1 A, C human T-cell Receptor alpha chain 9606
64 4NQE 3 D, G TCR alpha 9606
65 6AVF 2 A T-cell receptor alpha variable 4,TCR alpha chain 9606
66 4X6B 1 A, C TCR alpha 9606
67 4ELK 1 A, C Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
68 2P5W 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
69 4ZDH 1 A Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region 9606
70 6AMU 4 D DMF5 TCR alpha chain 9606
71 5U17 2 B, D MAIT T-cell receptor alpha chain 9606
72 5D5M 3 E, G M33.64 TCR Alpha Chain 9606
73 5C07 4 D, I 1E6 TCR Alpha Chain 9606
74 1LP9 4 E, L T-cell Receptor alpha chain 10090
75 4P23 1 A J809.B5 TCR V alpha chain (Va2.8) 10090
76 3VXQ 1 A, D H27-14 TCR alpha chain 9606
77 5U2V 3 E, G MAIT T-cell receptor alpha chain 9606
78 4PJX 3 E, G TCR-alpha 9606
79 3MV7 4 D alpha chain of the TK3 TCR 9606
80 5D2N 1 C, D C25 alpha 9606
81 4G8F 1 A alpha chain clone 42 TCR 9606
82 4NQD 3 D, G TCR alpha chain 9606
83 3QEU 1 A, D DMF5 alpha chain 9606
84 3TJH 3 C 42F3 alpha 10090
85 4GRM 1 A, C A6 alpha chain 9606
86 5WLG 4 D, I T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain chimera 10090
87 4MAY 3 C HY.1B11 TCR alpha chain 9606
88 3QUY 3 C Valpha14 (mouse variable domain, human constant domain) 10090
89 2CDF 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
90 2XNA 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
91 3QH3 1 A, C A6 alpha chain 9606
92 4PJG 3 E, G TCR-alpha 9606
93 5EUO 3 E, G PF6 TCR alpha chain 9606
94 3MV8 4 D alpha chain of the TK3 TCR 9606
95 3RUG 3 E, G Valpha10(mouse variable domain, human constant domain) 10090
96 2PYF 1 A T-Cell Receptor, Alpha Chain 9606
97 3QUZ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
98 6BGA 3 C T cell receptor 2B4 alpha chain 10090
99 4Y19 4 D FS18_alpha 9606
100 2PYE 4 D T-Cell Receptor, Alpha Chain 9606
101 2EYS 1 A NKT15 9606
102 4LCW 3 D, G MAIT T cell receptor alpha chain 9606
103 4G8G 4 D alpha chain C12C TCR 9606
104 4NQC 3 D, G TCR alpha chain 9606
105 4PJC 3 E, G TCR-alpha 9606
106 4JRX 4 D CA5 TCR alpha chain 9606
107 4PJF 3 E, G TCR-alpha 9606
108 4PJ7 3 E, G TCR-alpha 9606
109 5U72 2 B, D MAIT T-cell receptor alpha chain 9606
110 3REV 1 A TCR NB20 ALPHA CHAIN 9606
111 5C08 4 D, I 1E6 TCR Alpha Chain 9606
112 4PRP 4 D TK3 TCR alpha chain 9606
113 2VLJ 4 D JM22 TCR ALPHA CHAIN 9606
114 3QFJ 4 D A6 alpha chain 9606
115 3VXR 3 D H27-14 TCR alpha chain 9606
116 6AM5 4 D DMF5 TCR alpha chain 9606
117 4JFH 1 D alpha24 TCR allele 9606
118 2VLR 4 D, I JM22 TCR ALPHA CHAIN 9606
119 5C0A 4 D, I 1E6 TCR Alpha Chain 9606
120 6FR7 1 A T-Cell Receptor alpha chain 9606
121 5BS0 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
122 4G8E 1 A alpha chain clone 18 TCR 9606
123 2XN9 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
124 4PJI 3 E, G TCR-alpha 9606
125 1J8H 4 D T-CELL RECEPTOR ALPHA CHAIN Extracellular Domain 9606
126 4WW2 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
127 3QJF 1 A, C 2B4 alpha chain 10090
128 4WO4 3 C TCR variable DELTA 1 CHAIN and TCR constant Alpha 9606
129 4PRI 4 D TK3 TCR alpha chain 9606
130 5FKA 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS 9606
131 4JFD 4 D High Affinity TCR Alpha Chain 9606
132 4PJA 3 E, G TCR-alpha 9606
133 6BNL 3 C, G NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains 9606
134 6CQN 4 D F5 alpha chain 9606
135 5JHD 4 D, I TCRalpha chain 9606
136 5JZI 4 D, I HCV1406 TCR alpha chain 9606
137 4JFF 4 D High Affinity TCR Alpha Chain 9606
138 5C09 4 D, I 1E6 TCR Alpha Chain 9606
139 6FR8 1 A T-Cell Receptor HA1.7 alpha Chain 9606
140 3W0W 4 D T36-5 TCR alpha chain 9606
141 6CQL 4 D F24 alpha chain 9606
142 2YPL 4 D AGA T-CELL RECEPTOR ALPHA CHAIN 9606
143 4P2O 3 C 2B4 T-cell receptor alpha chain 10090
144 5KS9 3 E, G Bel502 TCR alpha TRAV20*01 9606
145 1TCR 1 A ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) 10090
146 3QDJ 4 D DMF5 alpha chain 9606
147 5WJO 1 A, C PG90 TCR alpha chain 9606
148 4Z7U 3 E, G T-CELL RECEPTOR, S13 ALPHA CHAIN 9606
149 4PJD 3 E, G TCR-alpha 9606
150 6AVG 2 B, C T-cell receptor alpha variable 4,TCR alpha chain 9606
151 2GJ6 4 D A6-Tcr 9606
152 4Z7V 3 E, G T-CELL RECEPTOR, L3-12 ALPHA CHAIN 9606
153 3VXM 4 D C1-28 TCR alpha chain 9606
154 3QI9 3 C NKT TCR V alpha 14 chimera of Mouse variable domain and human constant domain 10090
155 3UTT 4 D, I 1E6 TCR Alpha Chain 9606
156 4PRH 4 D TK3 TCR alpha chain 9606
157 2EYR 1 A NKT12 9606
158 5BRZ 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
159 4OZF 3 G T-CELL RECEPTOR, JR5.1 ALPHA CHAIN 9606
160 4E41 4 D, I T cell receptor G4 alpha chain 9606
161 4PJB 3 E, G TCR-alpha 9606
162 3HUJ 3 E, G NKT15 T cell receptor alpha-chain 9606
163 5U1R 2 B, D MAIT T-cell receptor alpha chain 9606
164 5HHM 4 D, I JM22 TCR alpha chain 9606
165 2VLK 4 D JM22 TCR ALPHA CHAIN 9606
166 4X6C 3 E, G TCR alpha 9606
167 4EN3 2 A HUMAN NKT TCR ALPHA CHAIN 9606
168 2EYT 1 A, C NKT15 9606
169 1MI5 4 D TcR alpha chain extracellular domain 9606
170 2UWE 4 E, L AHIII TCR ALPHA CHAIN 10090
171 3KPS 4 D LC13 TCR alpha chain 9606
172 4MXQ 1 C 42F3 alpha VmVh chimera 10090
173 4Y16 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
174 6EH8 1 A Human T Cell Receptor Alpha Chain 9606
175 3PWP 4 D A6 TCR alpha chain 9606
176 3VXT 1 A, C T36-5 TCR alpha chain 9606
177 3O4L 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
178 3QEQ 4 D DMF4 alpha chain 9606
179 5XOV 4 G, I V-delta chain of T cell receptor 9606
180 4GKZ 1 A Alpha chain of Class II TCR 9606
181 3O8X 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
182 4E42 1 A, C T cell receptor G4 alpha chain 9606
183 2ESV 4 D KK50.4 T cell receptor alpha chain Extracellular domain 9606
184 6EH9 1 A Human T Cell Receptor Alpha Chain 9606
185 4P46 3 A J809.B5 TCR Y31A alpha chain (Va2.8) 10090
186 4JFE 4 D High Affinity TCR Alpha Chain 9606
187 5NMG 4 D, I Human T-cell receptor alpha chain 9606
188 4IRS 3 C Valpha14 (mouse variable domain, human constant domain) 10090
189 3UTS 4 D, I 1E6 TCR Alpha Chain 9606
190 1FYT 4 D T-CELL RECEPTOR ALPHA CHAIN EXTRACELLULAR DOMAIN 9606
191 6C09 3 C 3C8 T cell receptor alpha-chain 9606
192 5MEN 4 D Protein TRAV22,Human nkt tcr alpha chain 9606
193 3TA3 3 C Valpha14 chimera (mouse variable domain, human constant domain) 10090
194 3KPR 4 D, I LC13 TCR alpha chain 9606
195 2CDG 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
196 3RDT 3 A TCR 809.B5 alpha chain 10090
197 1BD2 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 210 9606
198 4L3E 4 D DMF5 alpha chain 9606
199 3PL6 3 C T-cell receptor alpha chain 9606
200 3O9W 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
201 4JRY 4 D SB47 TCR alpha chain 9606
202 5XOT 4 D The Delta chain of TU55 TCR 9606
203 3DX9 1 A, C DM1 T cell receptor alpha chain 9606
204 2JCC 4 E, L TCR ALPHA 10090
205 3UTP 1 D, K 1E6 TCR alpha chain 9606
206 4X6D 3 E, G TCR alpha 9606
207 3D39 4 D A6 TCR alpha chain 9606
208 3ARB 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
209 3QIU 3 C TCR 226 alpha chain 10090
210 4UDU 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
211 4APQ 3 C MOUSE NKT TCR VALPHA14, HUMAN NKT TCR VALPHA14 MOUSE VARIABLE DOMAIN, RESIDUES 1-121, HUMAN CONSTANT DOMAIN, RESIDUES 122-212 10090
212 2AK4 4 D, I, N, T SB27 T cell receptor alpha chain Extracellular Domain 9606
213 3QDG 4 D DMF5 alpha chain 9606
214 4P4K 3 C, G hTCRav22 alpha chain 9606
215 5SWZ 4 D, I, N, S NP1-B17 TCR alpha chain 10090
216 5NMF 4 D HUman T-cell receptor Alpha chain 9606
217 5NMF 6 I HUman T-cell receptor Alpha chain 9606
218 5WKI 3 D T-cell receptor alpha variable 26-1,TRA@ protein 9606
219 4N0C 3 C, G 42F3 VmCh alpha 10090
220 3H9S 4 D A6 TCR alpha chain 9606
221 3QIB 3 C T-cell receptor alpha chain C region 9606
222 6CQQ 4 D, I F24 alpha chain 9606
223 4MNQ 4 D Uncharacterized protein, T-cell receptor, sp3.4 alpha chain 9606
224 4FTV 4 D A6 alpha chain 9606
225 3VWK 3 C NKT15 T cell receptor alpha-chain 9606
226 2IAM 4 C CD4+ T cell receptor E8 alpha chain 9606
227 3C5Z 1 A, E TCR B3K506 Alpha Chain 10090
228 5WKF 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain Chimera 9606
229 3SKN 1 A, C, E, G RL42 T cell receptor, alpha chain 9606
230 2F54 4 D, K T-cell receptor alpha chain 9606
231 4IRJ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
232 4GRL 3 C TCR Hy.1B11 alpha chain 9606
233 3QDM 4 D DMF4 alpha chain 9606
234 1QRN 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
235 5NME 4 D, I T-cell receptor Alpha chain 9606
236 3RGV 1 A Yae62 TCR a chain 10090
237 1AO7 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 212 9606
238 4PJ8 3 C TCR-alpha 9606
239 3D3V 4 D A6 TCR alpha chain 9606
240 3TYF 1 A, C iNKT Cell Receptor Alpha Chain 562
241 4QRP 4 D, J, K DD31 TCR alpha chain 9606
242 4ZAK 3 C Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain 10090
243 4Y4K 3 C chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain) 10090
244 3ARE 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
245 3FFC 4 D, I CF34 alpha chain 9606
246 3QUX 3 C Valpha14 (mouse variable domain, human constant domain) 10090
247 4IIQ 1 A Human Mucosal Associated Invariant T cell receptor alpha chain 9606
248 5WKH 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain 9606
249 3MV9 4 D alpha chain of the TK3 TCR 9606
250 2IAN 4 D, I, N, S CD4+ T cell receptor E8 alpha chain 9606
251 4N5E 1 C 42F3 alpha VmCh 10090
252 1MWA 1 A, C 2C T CELL RECEPTOR ALPHA CHAIN 10090
253 5TIL 4 G alpha chain of P14 T cell receptor 10090
254 3HE7 3 C Valpha14(mouse variable domain, human constant domain) 10090
255 3TVM 3 C, G Valpha14 (mouse variable domain, human constant domain) 10090
256 6FR6 1 A Human T-Cell Receptor Alpha Chain 9606
257 4OZH 3 E, G T-cell receptor, s16, alpha chain 9606
258 4OZG 3 E, G T-cell receptor, d2, alpha chain 9606
259 3RTQ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
260 4QOK 4 D Mel5 TCR chain alpha 9606
261 3SCM 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
262 5VCJ 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) UNP A0A0B4J1J9 residues 22-114,UNP K7N5M3 residues 116-210 10090
263 4WWK 1 A TCR Alpha Chain-TRAV12-3 9606
264 5KSB 3 E, G T15 TCR alpha TRAV20*02 9606
265 4EI5 3 C, G Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
266 4QRR 3 D clone12 TCR beta chain 9606
267 3GSN 4 A RA14 TCR alpha chain (TRAV24, TRAJ49) 9606
268 3RZC 3 C Valpha14 mouse variable domain, human constant domain 10090
269 3O6F 3 C, G T-cell receptor alpha chain C region unp residues 1-92 9606
270 4P5T 1 A, E TRA protein 9606
271 3ARF 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
272 4Z7W 3 E, G T-CELL RECEPTOR, T316 ALPHA CHAIN 9606
273 5SWS 4 D NP1-B17 TCR alpha chain 10090
274 3ARD 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
275 4L8S 1 A Muccosal Associated Invariant T Cell Receptor alpha chain 9606
276 4NHU 1 A, C 2C m33 alpha VmCh chimera 10090
277 1QSE 4 D PROTEIN (human T-Cell receptor) 9606
278 1NFD 1 A, C N15 ALPHA-BETA T-CELL RECEPTOR 10090
279 3TFK 3 C 42F3 alpha Mouse-human chimera alpha chain 10090
280 4P2Q 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
281 2CKB 1 A, C ALPHA, BETA T CELL RECEPTOR VB8.2DB2JB2.4CB2\;VA3JA58CA EXTRACELLULAR DOMAINS 10090
282 1QSF 4 D HUMAN T-CELL RECEPTOR 9606
283 4C56 1 A, G T CELL RECEPTOR ALPHA CHAIN 9606
284 5HYJ 4 D, I Human T-cell Receptor, Class I, Light alpha Chain 9606
285 6BNK 3 C, G Human nkt tcr alpha chain 9606
286 4Y2D 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
287 4EUP 4 G, I JKF6 alpha chain 9606
288 3HE6 3 C Valpha14(mouse variable domain, human constant domain) 10090
289 5W1W 4 D, I, N, S GF4 T cell receptor alpha chain 9606
290 3KXF 3 D, G, M, N SB27 T cell receptor alpha chain 9606
291 6CQR 4 D, I F24 alpha chain 9606
292 3HG1 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
293 3TO4 3 C NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-207 IS HUMAN CONSTANT DOMAIN 10090
294 5HHO 3 D JM22 TCR alpha chain 9606
295 2NX5 4 D, I, N, T ELS4 TCR alpha chain 9606
296 4OZI 3 E, G T-cell receptor, s2, alpha chain 9606
297 3VXU 4 D, I T36-5 TCR alpha chain 9606
298 3ARG 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
299 5NHT 4 A T-cell receptor alpha variable 12-2,T-cell receptor, sp3.4 alpha chain Numbering: residue 1 match first residue of TRAV12-2 defined in IMGT. Additional sequence in C-ter (ENDGGGCK) to enhance alpha-beta chain pairing. 9606
300 4Y4F 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
301 5L2K 3 D GEM42 TCR alpha chain 9606
302 3VWJ 3 C NKT15 T cell receptor alpha-chain 9606
303 4MVB 1 C 42F3 alpha VmCh 10090
304 3TPU 1 A, C, G, M 42F3 alpha 10090
305 5IW1 1 A, C, E T-CELL RECEPTOR ALPHA CHAIN 10090
306 4P2R 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
307 4MJI 4 D, I T-Cell Receptor Chain alpha 9606
308 4NDM 2 B Human nkt tcr alpha chain AB18.1 TCR delta chain 9606
309 3TZV 1 A, G Invariant Natural Killer T Cell Receptor chain A 9606
310 3QIW 3 C TCR 226 alpha chain unp residues 97-108 7130
311 3AXL 1 A, G Valpha 10 10090
312 3SDX 3 E, G NKT TCR Valpha24 chain 9606
313 2WBJ 3 C, G OB TCR E. COLI ENGA PEPTIDE COVALENTLY BOUND 9606
314 3TN0 3 C mouse NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-210 IS HUMAN CONSTANT DOMAIN 10090
315 2PO6 3 C, G NKT15 alpha-chain 9606
316 3SDA 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
317 5TJE 3 E, G ALPHA CHAIN OF MURINE T CELL RECEPTOR p14 10090
318 3SDC 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
319 5NQK 4 A T-cell receptor alpha variable 12-2,T-cell receptor alpha joining 45,T-cell receptor alpha chain C region NUMBERING: RESIDUE 1 MATCH FIRST RESIDUE OF TRAV 12-2 DEFINED IN IMGT. ADDITIONAL SEQUENCE IN C-TER (ENDGGGCK) TO ENHANCE ALPHA-BETA CHAIN PAIRING. 9606
320 4Y4H 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
321 2J8U 4 E, L AHIII TCR ALPHA CHAIN ECTODOMAIN 10090
322 1ZGL 4 M, Q, S, U T cell receptor alpha chain 9606
323 4ELM 3 E, G Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
324 5W1V 4 D, I, N, S GF4 T cell receptor alpha chain 9606
325 4ONH 2 A T-cell receptor beta 9606
326 3SDD 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
327 4MNH 2 B, D Human nkt tcr alpha chain DP10.7 TCR delta variable domain fused with human TCR alpha constant domain 9606
328 3SJV 4 D, I, N, S RL42 T cell receptor, alpha chain 9606
329 4GG6 3 E, G T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
330 3PQY 4 D, I, N, S alpha chain of the 6218-TCR chimeric construct with mouse variable domain and human constant domain 10090
331 5FK9 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS, RESIDUES 1-206 9606
332 3C60 1 A, E TCR YAe62 alpha chain 10090
333 1G6R 1 A, C ALPHA T CELL RECEPTOR EXTRACELLULAR DOMAIN 10090
334 6BJ2 1 D TCR 589 alpha chain 9606
335 4GG8 1 A, E T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
336 4LCC 2 A Human MAIT TCR alpha chain 9606
337 4L9L 2 A Human MAIT TCR alpha chain 9606
338 1YPZ 3 E, G T cell receptor delta 10090
339 3C6L 1 A, E TCR 2W20 alpha chain 10090
340 4Y1A 4 D FS17_alpha 9606
341 5D7L 3 D, G MAV36 TCR Alpha Chain 9606
342 5D2L 3 E, I, K, O C7 TCR alpha chain 9606
343 1YMM 4 D T cell receptor alpha chain 9606
344 3T0E 3 C T-cell receptor alpha chain 9606
345 2CDE 1 A, C, E INKT-TCR HUMAN INVARIANT NATURAL KILLER T CELL RECEPTOR VALPHA 24 AND VBETA11 9606
346 3DXA 4 D, I, N DM1 T cell receptor alpha chain 9606
347 5E6I 1 A, F, G, P TCR alpha chain,Human nkt tcr alpha chain 9606